YKR013W | sterol-binding protein

UniProt_ID: P36110

Computed_GO_Component_IDs: GO:0005576
Computed_GO_Components: extracellular region
Computed_GO_Function_IDs: GO:0008289
Computed_GO_Functions: lipid binding
Computed_GO_Process_IDs: GO:0006869 GO:0006810
Computed_GO_Processes: lipid transport transport
Curated_GO_Component_IDs: GO:0005783 GO:0005576 GO:0005615 GO:0000324
Curated_GO_Components: endoplasmic reticulum extracellular region extracellular space fungal-type vacuole
Curated_GO_Function_IDs: GO:0032934
Curated_GO_Functions: sterol binding
Curated_GO_Processes: sterol transport

	_ID	Prediction	OTHER	SP	mTP	CS_Position
	YKR013W	SP	0.001421	0.998553	0.000025	CS pos: 18-19. ALS-AP. Pr: 0.7454

No Results

Fasta :-
>YKR013W MKFSKVSLLAASASVALSAPVAVTVTQHVHQAATVVVQGIVRVENGQTLTTFITKGTQTA SASPVATTSAPIVVANAQVDSIATSVIQESAVVAESATFEESSTETSEAFSTATATIQAV QTSASATQDDVTTTLTSSTQPTSTTTPTTTTTSPTTTTSPTTTASPTTTASPTTATTTQS TASSTQSSSSDFSTSMVNEHNTKRALHKDTGSLTWSDTLATYAQNYADSYDCSGNLVHSG GPYGENLALGYGTTGSVDAWYNEITSYDYSNPGFSESAGHFTQVVWKGTSEVGCGLKSCG GEWGDYIICSYKAAGNVIGEFADNVMPLA
Download Fasta

MitoProt II - v1.101 File : /home/rajan/sadaf/4480_mitoprot/test/YKR013W.fa Sequence name : YKR013W Sequence length : 329 VALUES OF COMPUTED PARAMETERS Coef20 : 4.748 CoefTot : -0.264 ChDiff : -16 ZoneTo : 79 KR : 4 DE : 1 CleavSite : 0 HYDROPHOBIC SCALE USED GES KD GVH1 ECS H17 : 1.682 1.794 0.285 0.579 MesoH : 0.580 0.711 -0.132 0.304 MuHd_075 : 20.468 14.355 5.392 5.251 MuHd_095 : 35.225 33.881 11.423 10.027 MuHd_100 : 33.313 29.348 10.887 8.877 MuHd_105 : 28.275 25.470 9.905 7.383 Hmax_075 : 8.167 16.700 0.060 4.970 Hmax_095 : 16.888 25.463 4.471 7.122 Hmax_100 : 16.300 22.400 4.039 6.420 Hmax_105 : 14.400 21.583 4.154 5.230 CLASS NOT-MITO MITO(/CHLORO) DFM : 0.4520 0.5480 DFMC : 0.2819 0.7181 This protein is probably imported in chloroplast. f(Ser) = 0.1013 f(Arg) = 0.0127 CMi = 1.15440 CMi is the Chloroplast/Mitochondria Index It has been proposed by Von Heijne et al (Eur J Biochem,1989, 180: 535-545)

##### ProP v.1.0b ProPeptide Cleavage Site Prediction ##### ##### Furin-type cleavage site prediction (Arginine/Lysine residues) ##### 329 YKR013W MKFSKVSLLAASASVALSAPVAVTVTQHVHQAATVVVQGIVRVENGQTLTTFITKGTQTASASPVATTSAPIVVANAQVD 80 SIATSVIQESAVVAESATFEESSTETSEAFSTATATIQAVQTSASATQDDVTTTLTSSTQPTSTTTPTTTTTSPTTTTSP 160 TTTASPTTTASPTTATTTQSTASSTQSSSSDFSTSMVNEHNTKRALHKDTGSLTWSDTLATYAQNYADSYDCSGNLVHSG 240 GPYGENLALGYGTTGSVDAWYNEITSYDYSNPGFSESAGHFTQVVWKGTSEVGCGLKSCGGEWGDYIICSYKAAGNVIGE 320 FADNVMPLA 400 ................................................................................ 80 ................................................................................ 160 ................................................................................ 240 ................................................................................ 320 ......... 400 Propeptide cleavage sites predicted: Arg(R)/Lys(K): 0 Name Pos Context Score Pred ____________________________v_________________ YKR013W 2 -----MK|FS 0.072 . YKR013W 5 --MKFSK|VS 0.057 . YKR013W 42 VVQGIVR|VE 0.072 . YKR013W 55 LTTFITK|GT 0.066 . YKR013W 203 VNEHNTK|RA 0.065 . YKR013W 204 NEHNTKR|AL 0.262 . YKR013W 208 TKRALHK|DT 0.110 . YKR013W 287 FTQVVWK|GT 0.095 . YKR013W 297 EVGCGLK|SC 0.077 . YKR013W 312 YIICSYK|AA 0.088 . ____________________________^_________________

Fasta :-
>YKR013W ATGAAATTTTCTAAAGTCTCACTACTGGCCGCATCTGCATCTGTCGCTTTATCTGCCCCA GTTGCTGTGACTGTCACGCAACATGTCCACCAAGCTGCCACTGTAGTGGTACAAGGTATA GTTCGTGTAGAAAATGGCCAGACTCTAACGACGTTCATTACCAAGGGCACTCAAACGGCT TCTGCTAGTCCCGTTGCCACAACATCAGCTCCTATTGTGGTTGCTAATGCTCAAGTGGAC AGCATAGCTACTTCCGTTATCCAAGAAAGCGCTGTCGTGGCTGAATCTGCAACATTTGAA GAATCCTCTACAGAAACATCTGAAGCATTTTCTACAGCAACTGCAACCATACAAGCGGTG CAAACCTCCGCAAGTGCCACACAGGATGATGTAACCACAACTTTAACATCTTCAACACAA CCTACCAGCACAACTACTCCAACAACCACTACCACTAGCCCAACCACTACCACTAGCCCA ACTACTACCGCTAGTCCAACTACTACTGCTAGCCCAACCACCGCTACCACCACTCAATCT ACCGCCTCAAGCACTCAATCCTCAAGCTCCGATTTCTCAACGTCAATGGTTAACGAACAC AACACTAAAAGGGCGTTGCACAAGGATACCGGTTCTTTGACATGGTCTGACACACTAGCA ACATATGCACAAAACTACGCTGACTCCTACGATTGTTCAGGCAACCTAGTCCACTCCGGC GGTCCATACGGTGAAAACTTGGCACTTGGTTACGGTACGACCGGCTCTGTTGATGCCTGG TATAACGAAATTACCAGCTACGACTATTCCAACCCTGGTTTTAGTGAAAGCGCAGGTCAC TTCACCCAAGTCGTATGGAAGGGAACTTCTGAAGTTGGTTGCGGTTTGAAATCTTGCGGT GGCGAATGGGGCGATTACATCATTTGTTCCTACAAAGCCGCTGGTAATGTCATTGGTGAG TTTGCTGACAACGTTATGCCATTAGCTTAA
Download Fasta

Fasta :-

MKFSKVSLLAASASVALSAPVAVTVTQHVHQAATVVVQGIVRVENGQTLTTFITKGTQTA SASPVATTSAPIVVANAQVDSIATSVIQESAVVAESATFEESSTETSEAFSTATATIQAV QTSASATQDDVTTTLTSSTQPTSTTTPTTTTTSPTTTTSPTTTASPTTTASPTTATTTQS TASSTQSSSSDFSTSMVNEHNTKRALHKDTGSLTWSDTLATYAQNYADSYDCSGNLVHSG GPYGENLALGYGTTGSVDAWYNEITSYDYSNPGFSESAGHFTQVVWKGTSEVGCGLKSCG GEWGDYIICSYKAAGNVIGEFADNVMPLA

PR-1-like

No Results

	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore
	YKR013W	T	156	0.852	0.037	YKR013W	T	157	0.852	0.466	YKR013W	T	158	0.851	0.317	YKR013W	T	151	0.850	0.574	YKR013W	T	152	0.849	0.075	YKR013W	T	162	0.848	0.071	YKR013W	T	161	0.847	0.255	YKR013W	T	163	0.845	0.523	YKR013W	T	155	0.844	0.220	YKR013W	T	148	0.842	0.216	YKR013W	T	150	0.840	0.095	YKR013W	T	149	0.839	0.039	YKR013W	T	146	0.834	0.051	YKR013W	T	167	0.833	0.301	YKR013W	T	168	0.832	0.210	YKR013W	T	169	0.832	0.522	YKR013W	T	145	0.822	0.383	YKR013W	T	174	0.820	0.056	YKR013W	T	173	0.819	0.327	YKR013W	T	144	0.807	0.374	YKR013W	T	176	0.805	0.024	YKR013W	S	159	0.801	0.041	YKR013W	S	153	0.798	0.041	YKR013W	T	178	0.794	0.073	YKR013W	T	177	0.793	0.076	YKR013W	T	142	0.792	0.392	YKR013W	T	139	0.781	0.172	YKR013W	S	165	0.781	0.061	YKR013W	T	181	0.781	0.035	YKR013W	S	171	0.760	0.038	YKR013W	T	136	0.758	0.078	YKR013W	T	134	0.739	0.311	YKR013W	S	180	0.726	0.021	YKR013W	T	133	0.721	0.152	YKR013W	S	143	0.721	0.029	YKR013W	T	132	0.703	0.121	YKR013W	T	185	0.703	0.099	YKR013W	S	137	0.702	0.033	YKR013W	S	138	0.701	0.035	YKR013W	S	183	0.665	0.019	YKR013W	T	112	0.647	0.099	YKR013W	T	127	0.643	0.087	YKR013W	S	184	0.643	0.022	YKR013W	T	104	0.623	0.242	YKR013W	T	98	0.612	0.023	YKR013W	T	106	0.608	0.043	YKR013W	T	116	0.603	0.098	YKR013W	T	59	0.597	0.048	YKR013W	T	114	0.593	0.060	YKR013W	T	122	0.592	0.118	YKR013W	S	187	0.586	0.069	YKR013W	T	57	0.579	0.035	YKR013W	T	68	0.578	0.663	YKR013W	T	67	0.571	0.408	YKR013W	S	111	0.543	0.053	YKR013W	S	188	0.537	0.065	YKR013W	T	54	0.536	0.078	YKR013W	S	107	0.516	0.062	YKR013W	S	102	0.512	0.018	YKR013W	S	96	0.505	0.044	YKR013W	S	189	0.502	0.035

	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore	ID	Site	Position	Gscore	Iscore
	YKR013W	T	156	0.852	0.037	YKR013W	T	157	0.852	0.466	YKR013W	T	158	0.851	0.317	YKR013W	T	151	0.850	0.574	YKR013W	T	152	0.849	0.075	YKR013W	T	162	0.848	0.071	YKR013W	T	161	0.847	0.255	YKR013W	T	163	0.845	0.523	YKR013W	T	155	0.844	0.220	YKR013W	T	148	0.842	0.216	YKR013W	T	150	0.840	0.095	YKR013W	T	149	0.839	0.039	YKR013W	T	146	0.834	0.051	YKR013W	T	167	0.833	0.301	YKR013W	T	168	0.832	0.210	YKR013W	T	169	0.832	0.522	YKR013W	T	145	0.822	0.383	YKR013W	T	174	0.820	0.056	YKR013W	T	173	0.819	0.327	YKR013W	T	144	0.807	0.374	YKR013W	T	176	0.805	0.024	YKR013W	S	159	0.801	0.041	YKR013W	S	153	0.798	0.041	YKR013W	T	178	0.794	0.073	YKR013W	T	177	0.793	0.076	YKR013W	T	142	0.792	0.392	YKR013W	T	139	0.781	0.172	YKR013W	S	165	0.781	0.061	YKR013W	T	181	0.781	0.035	YKR013W	S	171	0.760	0.038	YKR013W	T	136	0.758	0.078	YKR013W	T	134	0.739	0.311	YKR013W	S	180	0.726	0.021	YKR013W	T	133	0.721	0.152	YKR013W	S	143	0.721	0.029	YKR013W	T	132	0.703	0.121	YKR013W	T	185	0.703	0.099	YKR013W	S	137	0.702	0.033	YKR013W	S	138	0.701	0.035	YKR013W	S	183	0.665	0.019	YKR013W	T	112	0.647	0.099	YKR013W	T	127	0.643	0.087	YKR013W	S	184	0.643	0.022	YKR013W	T	104	0.623	0.242	YKR013W	T	98	0.612	0.023	YKR013W	T	106	0.608	0.043	YKR013W	T	116	0.603	0.098	YKR013W	T	59	0.597	0.048	YKR013W	T	114	0.593	0.060	YKR013W	T	122	0.592	0.118	YKR013W	S	187	0.586	0.069	YKR013W	T	57	0.579	0.035	YKR013W	T	68	0.578	0.663	YKR013W	T	67	0.571	0.408	YKR013W	S	111	0.543	0.053	YKR013W	S	188	0.537	0.065	YKR013W	T	54	0.536	0.078	YKR013W	S	107	0.516	0.062	YKR013W	S	102	0.512	0.018	YKR013W	S	96	0.505	0.044	YKR013W	S	189	0.502	0.035

	ID	Site	Peptide	Score	Method	ID	Site	Peptide	Score	Method	ID	Site	Peptide	Score	Method	ID	Site	Peptide	Score	Method	ID	Site	Peptide	Score	Method
	YKR013W	190 S	QSSSSDFST	0.992	unsp	YKR013W	190 S	QSSSSDFST	0.992	unsp	YKR013W	190 S	QSSSSDFST	0.992	unsp	YKR013W	103 S	FEESSTETS	0.99	unsp	YKR013W	188 S	STQSSSSDF	0.995	unsp

YKR013W | sterol-binding protein

ID's

UniProt_ID: P36110

GEO Functions

Computed_GO_Component_IDs: GO:0005576

Computed_GO_Components: extracellular region

Computed_GO_Function_IDs: GO:0008289

Computed_GO_Functions: lipid binding

Computed_GO_Process_IDs: GO:0006869 GO:0006810

Computed_GO_Processes: lipid transport transport

Curated_GO_Component_IDs: GO:0005783 GO:0005576 GO:0005615 GO:0000324

Curated_GO_Components: endoplasmic reticulum extracellular region extracellular space fungal-type vacuole

Curated_GO_Function_IDs: GO:0032934

Curated_GO_Functions: sterol binding

Curated_GO_Processes: sterol transport

Subcellular Localization

Targetp

Signalp

Fasta :-

Mitoprot

ProPeptide Prediction

Sequence

Nucleotide sequence

Fasta :-

Protein sequence

Fasta :-

Domains

PR-1-like

Structure

Post Translational Modifications

N_Linked Glycosylation

O_Linked Glycosylation

Phosphorylation

Protein-Protein Interaction

String

YKR013W

Literature

PubMed

Google Scholar

Dinesh Gupta lab Translational bioinformatics group, ICGEB, New Delhi, India