[First][Previous]  Results of query sequence 7074 through 7458

|M.Javanica_Scaff8909g053713|M.Javanica_Scaff9340g055228|M.Javanica_Scaff9655g056321|M.Javanica_Scaff996g011868|M.Javanica_Scaff8594g052560|M.Javanica_Scaff845g010499|M.Javanica_Scaff9601g056143|M.Javanica_Scaff864g010698|M.Javanica_Scaff9988g057363|M.Javanica_Scaff9193g054727|M.Javanica_Scaff9684g056391|M.Javanica_Scaff8409g051862|M.Javanica_Scaff9323g055163|M.Javanica_Scaff970g011632|M.Javanica_Scaff89g001738|M.Javanica_Scaff928g011271|M.Javanica_Scaff879g010833|M.Javanica_Scaff915g011158|M.Javanica_Scaff8557g052402|M.Javanica_Scaff909g011112|M.Javanica_Scaff9033g054129|M.Javanica_Scaff970g011636|M.Javanica_Scaff977g011689|M.Javanica_Scaff9087g054321|M.Javanica_Scaff9134g054521|M.Javanica_Scaff9599g056134|M.Javanica_Scaff8579g052497|M.Javanica_Scaff856g010615|M.Javanica_Scaff91g001759|M.Javanica_Scaff999g011894|M.Javanica_Scaff8613g052641|M.Javanica_Scaff9087g054328|M.Javanica_Scaff8448g052007|M.Javanica_Scaff8458g052043|M.Javanica_Scaff8933g053789|M.Javanica_Scaff8820g053392|M.Javanica_Scaff9926g057152|M.Javanica_Scaff8465g052070|M.Javanica_Scaff9674g056371|M.Javanica_Scaff9119g054464|M.Javanica_Scaff957g011536|M.Javanica_Scaff86g001679|M.Javanica_Scaff9992g057372|M.Javanica_Scaff9819g056816|M.Javanica_Scaff9508g055799|M.Javanica_Scaff9924g057146|M.Javanica_Scaff9606g056156|M.Javanica_Scaff9877g056994|M.Javanica_Scaff8480g052123|M.Javanica_Scaff8603g052594|M.Javanica_Scaff8747g053127|M.Javanica_Scaff8908g053709|M.Javanica_Scaff9291g055053|M.Javanica_Scaff997g011875|M.Javanica_Scaff9423g055512|M.Javanica_Scaff8931g053782|M.Javanica_Scaff9875g056987|M.Javanica_Scaff9952g057230|M.Javanica_Scaff9159g054614|M.Javanica_Scaff9220g054820|M.Javanica_Scaff922g011221|M.Javanica_Scaff90g001747|M.Javanica_Scaff91g001765|M.Javanica_Scaff852g010570|M.Javanica_Scaff8559g052409|M.Javanica_Scaff9417g055488|M.Javanica_Scaff9363g055299|M.Javanica_Scaff9234g054870|M.Javanica_Scaff933g011316|M.Javanica_Scaff8631g052723|M.Javanica_Scaff9747g056588|M.Javanica_Scaff867g010729|M.Javanica_Scaff9380g055361|M.Javanica_Scaff9761g056624|M.Javanica_Scaff8628g052711|M.Javanica_Scaff920g011207|M.Javanica_Scaff9077g054278|M.Javanica_Scaff9384g055372|M.Javanica_Scaff897g011018|M.Javanica_Scaff9225g054836|M.Javanica_Scaff962g011573|M.Javanica_Scaff9532g055902|M.Javanica_Scaff8502g052224|M.Javanica_Scaff9022g054087|M.Javanica_Scaff8587g052530|M.Javanica_Scaff8924g053755|M.Javanica_Scaff9844g056883|M.Javanica_Scaff851g010558|M.Javanica_Scaff8987g053974|M.Javanica_Scaff9578g056061|M.Javanica_Scaff8794g053292|M.Javanica_Scaff9218g054813|M.Javanica_Scaff8896g053668|M.Javanica_Scaff943g011402|M.Javanica_Scaff8703g052987|M.Javanica_Scaff936g011344|M.Javanica_Scaff970g011633|M.Javanica_Scaff8915g053733|M.Javanica_Scaff9105g054409|M.Javanica_Scaff862g010670|M.Javanica_Scaff8775g053228|M.Javanica_Scaff9809g056792|M.Javanica_Scaff997g011874|M.Javanica_Scaff9137g054533|M.Javanica_Scaff85g001646|M.Javanica_Scaff9002g054023|M.Javanica_Scaff981g011728|M.Javanica_Scaff8387g051781|M.Javanica_Scaff8805g053334|M.Javanica_Scaff8623g052693|M.Javanica_Scaff8439g051983|M.Javanica_Scaff8390g051789|M.Javanica_Scaff8755g053155|M.Javanica_Scaff8561g052420|M.Javanica_Scaff8392g051793|M.Javanica_Scaff9251g054932|M.Javanica_Scaff9530g055887|M.Javanica_Scaff8559g052408|M.Javanica_Scaff987g011782|M.Javanica_Scaff8984g053962|M.Javanica_Scaff9087g054325|M.Javanica_Scaff9812g056802|M.Javanica_Scaff8850g053500|M.Javanica_Scaff9826g056831|M.Javanica_Scaff931g011295|M.Javanica_Scaff910g011116|M.Javanica_Scaff9055g054209|M.Javanica_Scaff9654g056317|M.Javanica_Scaff9575g056053|M.Javanica_Scaff8512g052260|M.Javanica_Scaff9245g054905|M.Javanica_Scaff8686g052933|M.Javanica_Scaff899g011028|M.Javanica_Scaff9115g054452|M.Javanica_Scaff9701g056438|M.Javanica_Scaff8824g053406|M.Javanica_Scaff94g001824|M.Javanica_Scaff97g001866|M.Javanica_Scaff8462g052055|M.Javanica_Scaff8864g053550|M.Javanica_Scaff9012g054053|M.Javanica_Scaff9391g055388|M.Javanica_Scaff949g011452|M.Javanica_Scaff8533g052336|M.Javanica_Scaff9091g054347|M.Javanica_Scaff8853g053509|M.Javanica_Scaff9054g054208|M.Javanica_Scaff869g010752|M.Javanica_Scaff9472g055684|M.Javanica_Scaff9801g056756|M.Javanica_Scaff999g011899|M.Javanica_Scaff8559g052411|M.Javanica_Scaff9347g055245|M.Javanica_Scaff9801g056761|M.Javanica_Scaff8944g053829|M.Javanica_Scaff9277g055003|M.Javanica_Scaff899g011034|M.Javanica_Scaff927g011263|M.Javanica_Scaff887g010909|M.Javanica_Scaff8684g052925|M.Javanica_Scaff9418g055493|M.Javanica_Scaff9171g054650|M.Javanica_Scaff9243g054898|M.Javanica_Scaff9460g055640|M.Javanica_Scaff8409g051861|M.Javanica_Scaff8816g053374|M.Javanica_Scaff8810g053350|M.Javanica_Scaff8454g052025|M.Javanica_Scaff8683g052921|M.Javanica_Scaff9854g056914|M.Javanica_Scaff9495g055763|M.Javanica_Scaff9161g054617|M.Javanica_Scaff9335g055201|M.Javanica_Scaff93g001801|M.Javanica_Scaff9601g056142|M.Javanica_Scaff859g010643|M.Javanica_Scaff9782g056699|M.Javanica_Scaff9439g055566|M.Javanica_Scaff8997g054012|M.Javanica_Scaff9873g056977|M.Javanica_Scaff9156g054601|M.Javanica_Scaff943g011396|M.Javanica_Scaff8497g052205|M.Javanica_Scaff8615g052652|M.Javanica_Scaff9156g054606|M.Javanica_Scaff8484g052136|M.Javanica_Scaff957g011539|M.Javanica_Scaff8929g053773|M.Javanica_Scaff8926g053762|M.Javanica_Scaff9469g055674|M.Javanica_Scaff8815g053369|M.Javanica_Scaff9232g054863|M.Javanica_Scaff8995g054005|M.Javanica_Scaff9659g056331|M.Javanica_Scaff8388g051782|M.Javanica_Scaff8983g053958|M.Javanica_Scaff9284g055032|M.Javanica_Scaff9762g056632|M.Javanica_Scaff9511g055813|M.Javanica_Scaff9910g057104|M.Javanica_Scaff888g010920|M.Javanica_Scaff90g001740|M.Javanica_Scaff9982g057350|M.Javanica_Scaff8957g053873|M.Javanica_Scaff8553g052393|M.Javanica_Scaff8599g052577|M.Javanica_Scaff928g011272|M.Javanica_Scaff894g010984|M.Javanica_Scaff8621g052687|M.Javanica_Scaff914g011154|M.Javanica_Scaff911g011134|M.Javanica_Scaff8530g052326|M.Javanica_Scaff858g010640|M.Javanica_Scaff8419g051900|M.Javanica_Scaff9046g054171|M.Javanica_Scaff910g011117|M.Javanica_Scaff8491g052169|M.Javanica_Scaff9637g056251|M.Javanica_Scaff9955g057241|M.Javanica_Scaff9827g056836|M.Javanica_Scaff8735g053081|M.Javanica_Scaff8768g053203|M.Javanica_Scaff9098g054386|M.Javanica_Scaff8590g052548|M.Javanica_Scaff9351g055255|M.Javanica_Scaff9903g057080|M.Javanica_Scaff9458g055633|M.Javanica_Scaff887g010908|M.Javanica_Scaff950g011470|M.Javanica_Scaff8546g052381|M.Javanica_Scaff979g011704|M.Javanica_Scaff9017g054071|M.Javanica_Scaff9873g056972|M.Javanica_Scaff8745g053115|M.Javanica_Scaff9608g056161|M.Javanica_Scaff9483g055728|M.Javanica_Scaff888g010923|M.Javanica_Scaff8821g053394|M.Javanica_Scaff975g011674|M.Javanica_Scaff8969g053913|M.Javanica_Scaff8602g052589|M.Javanica_Scaff9535g055911|M.Javanica_Scaff936g011338|M.Javanica_Scaff9046g054172|M.Javanica_Scaff8856g053524|M.Javanica_Scaff9143g054554|M.Javanica_Scaff8605g052607|M.Javanica_Scaff855g010602|M.Javanica_Scaff964g011587|M.Javanica_Scaff8926g053763|M.Javanica_Scaff8822g053396|M.Javanica_Scaff97g001863|M.Javanica_Scaff8532g052334|M.Javanica_Scaff906g011095|M.Javanica_Scaff903g011070|M.Javanica_Scaff970g011634|M.Javanica_Scaff971g011644|M.Javanica_Scaff916g011163|M.Javanica_Scaff9097g054380|M.Javanica_Scaff83g001614|M.Javanica_Scaff879g010837|M.Javanica_Scaff939g011367|M.Javanica_Scaff846g010508|M.Javanica_Scaff9826g056832|M.Javanica_Scaff9751g056601|M.Javanica_Scaff9323g055164|M.Javanica_Scaff9652g056305|M.Javanica_Scaff9455g055621|M.Javanica_Scaff8451g052014|M.Javanica_Scaff9856g056918|M.Javanica_Scaff9903g057081|M.Javanica_Scaff9880g057008|M.Javanica_Scaff9957g057250|M.Javanica_Scaff8942g053818|M.Javanica_Scaff91g001766|M.Javanica_Scaff9805g056776|M.Javanica_Scaff9033g054130|M.Javanica_Scaff9182g054683|M.Javanica_Scaff9545g055948|M.Javanica_Scaff8793g053286|M.Javanica_Scaff851g010565|M.Javanica_Scaff8391g051791|M.Javanica_Scaff8644g052767|M.Javanica_Scaff9097g054379|M.Javanica_Scaff9158g054611|M.Javanica_Scaff9259g054957|M.Javanica_Scaff8g000230|M.Javanica_Scaff9524g055866|M.Javanica_Scaff9283g055027|M.Javanica_Scaff8774g053224|M.Javanica_Scaff9016g054067|M.Javanica_Scaff8410g051866|M.Javanica_Scaff9201g054757|M.Javanica_Scaff9476g055698|M.Javanica_Scaff946g011428|M.Javanica_Scaff9725g056507|M.Javanica_Scaff9269g054985|M.Javanica_Scaff8515g052274|M.Javanica_Scaff8745g053116|M.Javanica_Scaff9482g055724|M.Javanica_Scaff8732g053076|M.Javanica_Scaff8911g053720|M.Javanica_Scaff98g001869|M.Javanica_Scaff8911g053722|M.Javanica_Scaff8406g051853|M.Javanica_Scaff873g010791|M.Javanica_Scaff9562g056018|M.Javanica_Scaff9917g057131|M.Javanica_Scaff9118g054460|M.Javanica_Scaff996g011869|M.Javanica_Scaff8543g052370|M.Javanica_Scaff9403g055421|M.Javanica_Scaff9443g055583|M.Javanica_Scaff9223g054831|M.Javanica_Scaff9938g057198|M.Javanica_Scaff9506g055796|M.Javanica_Scaff985g011765|M.Javanica_Scaff879g010840|M.Javanica_Scaff8650g052787|M.Javanica_Scaff9145g054558|M.Javanica_Scaff8707g053002|M.Javanica_Scaff9653g056307|M.Javanica_Scaff8777g053236|M.Javanica_Scaff887g010916|M.Javanica_Scaff9615g056185|M.Javanica_Scaff8456g052031|M.Javanica_Scaff9406g055429|M.Javanica_Scaff8672g052876|M.Javanica_Scaff8825g053410|M.Javanica_Scaff9119g054462|M.Javanica_Scaff8496g052198|M.Javanica_Scaff91g001764|M.Javanica_Scaff9511g055811|M.Javanica_Scaff8817g053380|M.Javanica_Scaff9725g056509|M.Javanica_Scaff9870g056963|M.Javanica_Scaff9152g054587|M.Javanica_Scaff9794g056738|M.Javanica_Scaff843g010481|M.Javanica_Scaff9326g055177|M.Javanica_Scaff9063g054229|M.Javanica_Scaff887g010918|M.Javanica_Scaff9543g055944|M.Javanica_Scaff9097g054378|M.Javanica_Scaff870g010756|M.Javanica_Scaff9400g055409|M.Javanica_Scaff9352g055260|M.Javanica_Scaff974g011663|M.Javanica_Scaff900g011041|M.Javanica_Scaff8410g051868|M.Javanica_Scaff8861g053539|M.Javanica_Scaff8416g051892|M.Javanica_Scaff9061g054227|M.Javanica_Scaff9009g054045|M.Javanica_Scaff841g010446|M.Javanica_Scaff8442g051989|M.Javanica_Scaff8824g053405|M.Javanica_Scaff9025g054098|M.Javanica_Scaff8415g051889|M.Javanica_Scaff894g010985|M.Javanica_Scaff8502g052220|M.Javanica_Scaff8826g053412|M.Javanica_Scaff8782g053256|M.Javanica_Scaff887g010910|M.Javanica_Scaff9782g056701|M.Javanica_Scaff9824g056827|M.Javanica_Scaff845g010500|M.Javanica_Scaff9177g054673|M.Javanica_Scaff9579g056063|M.Javanica_Scaff85g001647|M.Javanica_Scaff9959g057259|M.Javanica_Scaff919g011200|M.Javanica_Scaff9873g056974|M.Javanica_Scaff9274g054996|M.Javanica_Scaff9971g057300|M.Javanica_Scaff961g011571|M.Javanica_Scaff9184g054695|M.Javanica_Scaff949g011459|M.Javanica_Scaff8902g053686|M.Javanica_Scaff856g010610|M.Javanica_Scaff9263g054969|M.Javanica_Scaff8570g052466|M.Javanica_Scaff9392g055389|M.Javanica_Scaff899g011037|M.Javanica_Scaff9g000253|


Query= M.Javanica_Scaff8909g053713
         (149 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9340g055228
         (279 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9655g056321
         (74 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff996g011868
         (81 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8594g052560
         (268 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff845g010499
         (58 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9601g056143
         (463 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff864g010698
         (372 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9988g057363
         (84 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9193g054727
         (68 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9684g056391
         (54 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8409g051862
         (85 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9323g055163
         (83 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff970g011632
         (214 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff89g001738
         (61 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff928g011271
         (148 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff879g010833
         (115 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff915g011158
         (137 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8557g052402
         (434 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff909g011112
         (109 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9033g054129
         (431 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff970g011636
         (85 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff977g011689
         (153 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9087g054321
         (149 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9134g054521
         (164 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9599g056134
         (95 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8579g052497
         (385 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff856g010615
         (96 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff91g001759
         (306 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff999g011894
         (166 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8613g052641
         (224 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9087g054328
         (57 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8448g052007
         (243 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8458g052043
         (69 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8933g053789
         (379 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8820g053392
         (52 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9926g057152
         (96 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8465g052070
         (138 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9674g056371
         (101 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9119g054464
         (58 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff957g011536
         (71 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff86g001679
         (127 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9992g057372
         (77 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9819g056816
         (122 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9508g055799
         (253 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9924g057146
         (112 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9606g056156
         (93 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9877g056994
         (252 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8480g052123
         (621 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8603g052594
         (63 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8747g053127
         (701 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8908g053709
         (207 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9291g055053
         (296 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff997g011875
         (325 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9423g055512
         (139 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8931g053782
         (282 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9875g056987
         (71 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9952g057230
         (63 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9159g054614
         (405 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9220g054820
         (148 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff922g011221
         (75 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff90g001747
         (56 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff91g001765
         (220 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff852g010570
         (109 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8559g052409
         (523 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9417g055488
         (102 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9363g055299
         (240 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9234g054870
         (199 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff933g011316
         (219 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8631g052723
         (87 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9747g056588
         (833 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff867g010729
         (506 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AAC72001   Hsp70  (Heat shock protein)  [Toxoplasma gondii]            47   8e-07
AAC72002  Hsp70  (Heat shock protein)  [Toxoplasma gondii]             47   8e-07

>M.Javanica_Scaff867g010729 on AAC72001   Hsp70  (Heat shock protein)  [Toxoplasma gondii]
          Length = 255

 Score = 47.0 bits (110), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 25/27 (92%)

Query: 47 IGIDLGTSFTCVGVYKNGRVEIIANDQ 73
          +GIDLGT+++CVGV+KN  VEIIANDQ
Sbjct: 7  VGIDLGTTYSCVGVWKNDAVEIIANDQ 33



>M.Javanica_Scaff867g010729 on AAC72002  Hsp70  (Heat shock protein)  [Toxoplasma gondii]
          Length = 255

 Score = 47.0 bits (110), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 25/27 (92%)

Query: 47 IGIDLGTSFTCVGVYKNGRVEIIANDQ 73
          +GIDLGT+++CVGV+KN  VEIIANDQ
Sbjct: 7  VGIDLGTTYSCVGVWKNDAVEIIANDQ 33






BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9380g055361
         (261 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9761g056624
         (327 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8628g052711
         (177 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff920g011207
         (414 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9077g054278
         (104 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9384g055372
         (61 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff897g011018
         (364 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9225g054836
         (284 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff962g011573
         (529 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9532g055902
         (82 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8502g052224
         (79 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9022g054087
         (106 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8587g052530
         (154 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8924g053755
         (71 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9844g056883
         (181 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff851g010558
         (71 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8987g053974
         (79 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9578g056061
         (342 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8794g053292
         (330 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9218g054813
         (53 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8896g053668
         (258 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff943g011402
         (129 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8703g052987
         (63 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff936g011344
         (128 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff970g011633
         (99 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8915g053733
         (568 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9105g054409
         (209 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff862g010670
         (151 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8775g053228
         (78 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9809g056792
         (50 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff997g011874
         (236 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9137g054533
         (89 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff85g001646
         (203 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9002g054023
         (514 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff981g011728
         (62 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8387g051781
         (218 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8805g053334
         (151 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8623g052693
         (95 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8439g051983
         (302 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8390g051789
         (191 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8755g053155
         (306 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8561g052420
         (141 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8392g051793
         (94 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9251g054932
         (131 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9530g055887
         (79 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8559g052408
         (128 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff987g011782
         (212 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8984g053962
         (308 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9087g054325
         (65 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9812g056802
         (658 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8850g053500
         (57 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9826g056831
         (101 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff931g011295
         (152 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff910g011116
         (95 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9055g054209
         (62 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9654g056317
         (136 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9575g056053
         (277 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AAR88085  TbcatB  (Cysteine proteases)  [Trypanosoma brucei]           83   3e-19
P92132  CP2  (Cysteine protease)  [Giardia duodenalis]                 62   3e-12
CAA54436  CP2  (Cysteine protease)  [Trichomonas vaginalis]            51   1e-08
PF14_0553  Falcipain1  (Cysteine protease)  [Plasmodium falciparum]    52   2e-08
ABC02174  Falstatin  (Others)  [Plasmodium falciparum]                 47   4e-07
XP_001347836  Falcipain 2  (Cysteine protease)  [Plasmodium falc...    47   4e-07
CAC67416  Brucipain  (Cysteine proteases)  [Trypanosoma brucei]        45   2e-06
AAX77225  Falcipain 2'  (Cysteine protease)  [Plasmodium falcipa...    44   3e-06
XP_001347833  Falcipain 3  (Cysteine protease)  [Plasmodium falc...    44   4e-06
XP_650937  CP5  (Cysteine protease)  [Entamoeba histolytica]           42   2e-05
AAS38514  CP65  (Cysteine protease)  [Trichomonas vaginalis]           41   3e-05

>M.Javanica_Scaff9575g056053 on AAR88085  TbcatB  (Cysteine proteases)  [Trypanosoma brucei]
          Length = 340

 Score = 82.8 bits (203), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 89/175 (50%), Gaps = 24/175 (13%)

Query: 71  IAQINEQNGGYWKAKVN-YYSLLPEDEQKRICGVQNNGRSKNGDAKPEFPILEKLANNDD 129
           + ++N  N G WKAK +     +   E KR+ GV    ++ N    P+    E+ A    
Sbjct: 37  VDRVNRLNRGIWKAKYDGVMQNITLREAKRLNGVIK--KNNNASILPKRRFTEEEARAP- 93

Query: 130 CVTEIEFDARENWPDCSSFINYIQNQGRCGSCWAVSTASAYTDRSCIQRSLNGLSTSIDD 189
                 FD+ E WP+C + I  I +Q  CGSCWAV+ ASA +DR C   ++ G+      
Sbjct: 94  --LPSSFDSAEAWPNCPT-IPQIADQSACGSCWAVAAASAMSDRFC---TMGGVQ----- 142

Query: 190 PSLHFSSTDVMSCSIDY-DGCEGGWPSKAWQWIQSNGVCTGTDHVWNNGCKPYPY 243
             +H S+ D+++C  D  DGC GG P +AW +  S G+ +       + C+PYP+
Sbjct: 143 -DVHISAGDLLACCSDCGDGCNGGDPDRAWAYFSSTGLVS-------DYCQPYPF 189



>M.Javanica_Scaff9575g056053 on P92132  CP2  (Cysteine protease)  [Giardia duodenalis]
          Length = 255

 Score = 62.0 bits (149), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 45/93 (48%), Gaps = 11/93 (11%)

Query: 136 FDARENWPDCSSFINYIQNQGRCGSCWAVSTASAYTDRSCIQRSLNGLSTSIDDPSLHFS 195
           FD RE +P C   I  + +QG CGSCWA S+ + + DR C+          +D   + +S
Sbjct: 79  FDFREEYPHC---IPEVVDQGGCGSCWAFSSVATFGDRRCV--------AGLDKKPVKYS 127

Query: 196 STDVMSCSIDYDGCEGGWPSKAWQWIQSNGVCT 228
              V+SC      C GGW    W+++   G  T
Sbjct: 128 PQYVVSCDHGDMACNGGWLPNVWKFLTKTGTTT 160



>M.Javanica_Scaff9575g056053 on CAA54436  CP2  (Cysteine protease)  [Trichomonas vaginalis]
          Length = 255

 Score = 51.2 bits (121), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/151 (25%), Positives = 63/151 (41%), Gaps = 28/151 (18%)

Query: 71  IAQINEQNGGYWKAKVNYYSLLPEDEQKRICGVQNNGRSKNGDAKPEFPILEKLANNDDC 130
           + + N  N G+ K  +N  + L + E + + G +  G+      K + P        +D 
Sbjct: 51  VQEHNAANKGF-KLGLNKLAHLTQSEYRSLLGAKRLGQKSGNFFKCDAPA-------NDA 102

Query: 131 VTEIEFDARENWPDCSSFINYIQNQGRCGSCWAVSTASAYTDRSCIQRSLNGLSTSIDDP 190
           V         +W D    +N I++QG+CGSCWA S   A   R              +  
Sbjct: 103 V---------DWRD-KGIVNKIKDQGQCGSCWAFSAIQASESR----------YAQANKQ 142

Query: 191 SLHFSSTDVMSCSIDYDGCEGGWPSKAWQWI 221
            L  +  +++ C     GC GGWPSKA  ++
Sbjct: 143 LLDLAEQNIVDCVTSCYGCNGGWPSKAIDYV 173



>M.Javanica_Scaff9575g056053 on PF14_0553  Falcipain1  (Cysteine protease)  [Plasmodium falciparum]
          Length = 569

 Score = 51.6 bits (122), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/199 (24%), Positives = 85/199 (42%), Gaps = 43/199 (21%)

Query: 61  EEQIRKIAGDIAQINE---------QNGGYWKAKVNYYSLLPEDEQKR----ICGVQNNG 107
           +EQ+RK   +I +IN               +K KVN +S   E+E K     +  V N+ 
Sbjct: 240 DEQMRKF--EIFKINYISIKNHNKLNKNAMYKKKVNQFSDYSEEELKEYFKTLLHVPNHM 297

Query: 108 RSKNGDAKPEFPILEKLANNDDCVTEIEFDARENWPDCSSFINYI------------QNQ 155
             K   +KP     E    ++  ++E   + + N  D  S +  I            ++Q
Sbjct: 298 IEKY--SKP----FENHLKDNILISEFYTNGKRNEKDIFSKVPEILDYREKGIVHEPKDQ 351

Query: 156 GRCGSCWAVSTASAYTDRSCIQRSLNGLSTSIDDPSLHFSSTDVMSCSIDYDGCEGGWPS 215
           G CGSCWA ++            ++  +    +   L FS  +V+ CS D  GC+GG P 
Sbjct: 352 GLCGSCWAFASVG----------NIESVFAKKNKNILSFSEQEVVDCSKDNFGCDGGHPF 401

Query: 216 KAWQWIQSNGVCTGTDHVW 234
            ++ ++  N +C G ++ +
Sbjct: 402 YSFLYVLQNELCLGDEYKY 420



>M.Javanica_Scaff9575g056053 on ABC02174  Falstatin  (Others)  [Plasmodium falciparum]
          Length = 492

 Score = 47.4 bits (111), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 36/167 (21%), Positives = 74/167 (44%), Gaps = 22/167 (13%)

Query: 75  NEQNGGYWKAKVNYYS-LLPEDEQKRICGVQNNGRSKNGDAKPEFP-----ILEKLANND 128
           N++    +K  +N +  L PE+ + +   ++ +G  K       +      +++K    D
Sbjct: 206 NKKTNSLYKRGMNKFGDLSPEEFRSKYLNLKTHGPFKTLSPPVSYEANYEDVIKKYKPAD 265

Query: 129 DCVTEIEFDARENWPDCSSFINYIQNQGRCGSCWAVSTASAYTDRSCIQRSLNGLSTSID 188
             +  I +D R         +  +++Q  CGSCWA S+  +   +  I++    L     
Sbjct: 266 AKLDRIAYDWR-----LHGGVTPVKDQALCGSCWAFSSVGSVESQYAIRKKALFL----- 315

Query: 189 DPSLHFSSTDVMSCSIDYDGCEGGWPSKAW-QWIQSNGVCTGTDHVW 234
                FS  +++ CS+  +GC GG+ + A+   I   G+C+  D+ +
Sbjct: 316 -----FSEQELVDCSVKNNGCYGGYITNAFDDMIDLGGLCSQDDYPY 357



>M.Javanica_Scaff9575g056053 on XP_001347836  Falcipain 2  (Cysteine protease)  [Plasmodium
           falciparum]
          Length = 492

 Score = 47.4 bits (111), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 36/167 (21%), Positives = 74/167 (44%), Gaps = 22/167 (13%)

Query: 75  NEQNGGYWKAKVNYYS-LLPEDEQKRICGVQNNGRSKNGDAKPEFP-----ILEKLANND 128
           N++    +K  +N +  L PE+ + +   ++ +G  K       +      +++K    D
Sbjct: 206 NKKTNSLYKRGMNKFGDLSPEEFRSKYLNLKTHGPFKTLSPPVSYEANYEDVIKKYKPAD 265

Query: 129 DCVTEIEFDARENWPDCSSFINYIQNQGRCGSCWAVSTASAYTDRSCIQRSLNGLSTSID 188
             +  I +D R         +  +++Q  CGSCWA S+  +   +  I++    L     
Sbjct: 266 AKLDRIAYDWR-----LHGGVTPVKDQALCGSCWAFSSVGSVESQYAIRKKALFL----- 315

Query: 189 DPSLHFSSTDVMSCSIDYDGCEGGWPSKAW-QWIQSNGVCTGTDHVW 234
                FS  +++ CS+  +GC GG+ + A+   I   G+C+  D+ +
Sbjct: 316 -----FSEQELVDCSVKNNGCYGGYITNAFDDMIDLGGLCSQDDYPY 357



>M.Javanica_Scaff9575g056053 on CAC67416  Brucipain  (Cysteine proteases)  [Trypanosoma brucei]
          Length = 450

 Score = 45.4 bits (106), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 66/260 (25%), Positives = 106/260 (40%), Gaps = 47/260 (18%)

Query: 5   LLIFFSLQFVLIASFESSEILNIIGNVFDGKLNEEEVKKLAEEISLIKEVYDV---EINE 61
           ++ F  L  VL+A      +   + +V  G L+ EE   L    +  K+ Y     +  E
Sbjct: 6   MVRFVRLPVVLLA------MAACLASVALGSLHVEE--SLEMRFAAFKKKYGKVYKDAKE 57

Query: 62  EQIRKIA----GDIAQINEQNGGYWKAKVNYYSLLPEDEQKRICGVQNNGRSKNGDAKPE 117
           E  R  A     + A+I      Y    V  +S +  +E +         R +NG +   
Sbjct: 58  EAFRFRAFEENMEQAKIQAAANPYATFGVTPFSDMTREEFR--------ARYRNGASY-- 107

Query: 118 FPILEKLANNDDCVTEIEFDARENWPDCSSFINYIQNQGRCGSCWAVSTASAYTDRSCIQ 177
           F   +K       VT     A  +W +  + +  +++QG+CGSCWA ST           
Sbjct: 108 FAAAQKRLRKTVNVTTGRAPAAVDWREKGA-VTPVKDQGQCGSCWAFSTIG--------- 157

Query: 178 RSLNGLSTSIDDPSLHFSSTDVMSC-SIDYDGCEGGWPSKAWQWI-QSNGVCTGTDHVWN 235
            ++ G      +P +  S   ++SC +ID+ GC GG    A+ WI  SNG      +V+ 
Sbjct: 158 -NIEGQWQVAGNPLVSLSEQMLVSCDTIDF-GCGGGLMDNAFNWIVNSNG-----GNVFT 210

Query: 236 NGCKPYPYEPKGKAEQVKCE 255
               PY     G  EQ +C+
Sbjct: 211 EASYPY---VSGNGEQPQCQ 227



>M.Javanica_Scaff9575g056053 on AAX77225  Falcipain 2'  (Cysteine protease)  [Plasmodium
           falciparum]
          Length = 484

 Score = 44.3 bits (103), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 43/84 (51%), Gaps = 11/84 (13%)

Query: 152 IQNQGRCGSCWAVSTASAYTDRSCIQRSLNGLSTSIDDPSLHFSSTDVMSCSIDYDGCEG 211
           +++Q  CGSCWA S+  +   +  I++  N L T         S  +++ CS    GC G
Sbjct: 276 VKDQKNCGSCWAFSSIGSVESQYAIRK--NKLIT--------LSEQELVDCSFKNYGCNG 325

Query: 212 GWPSKAWQ-WIQSNGVCTGTDHVW 234
           G  + A++  I+  G+CT  D+ +
Sbjct: 326 GLINNAFEDMIELGGICTDDDYPY 349



>M.Javanica_Scaff9575g056053 on XP_001347833  Falcipain 3  (Cysteine protease)  [Plasmodium
           falciparum]
          Length = 482

 Score = 44.3 bits (103), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 43/84 (51%), Gaps = 11/84 (13%)

Query: 152 IQNQGRCGSCWAVSTASAYTDRSCIQRSLNGLSTSIDDPSLHFSSTDVMSCSIDYDGCEG 211
           +++Q  CGSCWA S+  +   +  I++  N L T         S  +++ CS    GC G
Sbjct: 274 VKDQKNCGSCWAFSSIGSVESQYAIRK--NKLIT--------LSEQELVDCSFKNYGCNG 323

Query: 212 GWPSKAWQ-WIQSNGVCTGTDHVW 234
           G  + A++  I+  G+CT  D+ +
Sbjct: 324 GLINNAFEDMIELGGICTDDDYPY 347



>M.Javanica_Scaff9575g056053 on XP_650937  CP5  (Cysteine protease)  [Entamoeba histolytica]
          Length = 318

 Score = 41.6 bits (96), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 62/127 (48%), Gaps = 12/127 (9%)

Query: 133 EIEFDARENWPDCSSF-----INYIQNQGRCGSCWAVSTASAYTDRSCIQRSLNGLSTSI 187
           EI +D+R + P+   +     +  I++Q  CGSC++ ++ +A   R  +  S      ++
Sbjct: 86  EIVYDSRGDVPESVDWRAKGKVPAIRDQASCGSCYSFASVAAIEGRLLVAGSKK---FTV 142

Query: 188 DDPSLHFSSTDVMSCSIDY--DGCEGGWPSKAWQWIQSNGVCTGTDHVWNNGCKPYPYEP 245
           DD  L  S   ++ CS+     GC GG    ++++++ NG+    D+ +    +   Y+ 
Sbjct: 143 DD--LDLSEQQLVDCSVSVGNKGCNGGSLLLSFRYVKLNGIMQEKDYPYVAAEETCTYDK 200

Query: 246 KGKAEQV 252
           K  A ++
Sbjct: 201 KKVAVKI 207



>M.Javanica_Scaff9575g056053 on AAS38514  CP65  (Cysteine protease)  [Trichomonas vaginalis]
          Length = 206

 Score = 40.8 bits (94), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 38/73 (52%), Gaps = 10/73 (13%)

Query: 149 INYIQNQGRCGSCWAVSTASAYTDRSCIQRSLNGLSTSIDDPSLHFSSTDVMSCSIDYDG 208
           +N IQ+QG+CGSCWA S   A   +  I        TS +   L  S  +++ C    DG
Sbjct: 33  VNPIQDQGQCGSCWAFSAIQAQESQYAI--------TSGELQKL--SEQNLVDCVTTCDG 82

Query: 209 CEGGWPSKAWQWI 221
           CEGG  + A+ ++
Sbjct: 83  CEGGLMTNAYDYV 95






BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8512g052260
         (88 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9245g054905
         (95 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8686g052933
         (349 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff899g011028
         (63 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9115g054452
         (62 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9701g056438
         (769 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8824g053406
         (288 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff94g001824
         (92 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff97g001866
         (84 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8462g052055
         (114 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8864g053550
         (371 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9012g054053
         (478 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9391g055388
         (368 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff949g011452
         (99 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8533g052336
         (171 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9091g054347
         (70 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8853g053509
         (496 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9054g054208
         (256 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff869g010752
         (60 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9472g055684
         (82 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9801g056756
         (53 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff999g011899
         (115 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8559g052411
         (63 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9347g055245
         (353 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9801g056761
         (135 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8944g053829
         (213 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9277g055003
         (137 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff899g011034
         (139 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff927g011263
         (81 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff887g010909
         (312 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8684g052925
         (261 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9418g055493
         (175 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9171g054650
         (206 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9243g054898
         (208 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9460g055640
         (66 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8409g051861
         (185 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8816g053374
         (186 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8810g053350
         (188 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8454g052025
         (644 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8683g052921
         (60 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9854g056914
         (101 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9495g055763
         (906 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9161g054617
         (53 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9335g055201
         (113 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff93g001801
         (122 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9601g056142
         (245 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff859g010643
         (526 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9782g056699
         (81 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9439g055566
         (267 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8997g054012
         (112 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9873g056977
         (87 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9156g054601
         (225 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff943g011396
         (75 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8497g052205
         (144 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8615g052652
         (175 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9156g054606
         (398 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8484g052136
         (136 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff957g011539
         (462 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8929g053773
         (259 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8926g053762
         (115 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9469g055674
         (76 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8815g053369
         (90 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9232g054863
         (94 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8995g054005
         (387 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9659g056331
         (185 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8388g051782
         (898 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8983g053958
         (64 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9284g055032
         (165 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9762g056632
         (72 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9511g055813
         (161 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9910g057104
         (212 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff888g010920
         (547 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff90g001740
         (93 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9982g057350
         (226 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8957g053873
         (99 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8553g052393
         (312 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8599g052577
         (233 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff928g011272
         (151 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff894g010984
         (292 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8621g052687
         (154 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff914g011154
         (103 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff911g011134
         (140 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8530g052326
         (145 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff858g010640
         (91 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8419g051900
         (104 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9046g054171
         (77 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff910g011117
         (646 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8491g052169
         (100 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9637g056251
         (166 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9955g057241
         (218 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9827g056836
         (82 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8735g053081
         (797 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8768g053203
         (396 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9098g054386
         (177 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8590g052548
         (60 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9351g055255
         (124 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9903g057080
         (90 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9458g055633
         (140 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff887g010908
         (281 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff950g011470
         (186 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8546g052381
         (185 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff979g011704
         (167 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9017g054071
         (906 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9873g056972
         (103 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8745g053115
         (68 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9608g056161
         (364 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9483g055728
         (952 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff888g010923
         (475 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8821g053394
         (70 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff975g011674
         (355 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8969g053913
         (77 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8602g052589
         (73 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9535g055911
         (917 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff936g011338
         (680 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9046g054172
         (113 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8856g053524
         (185 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9143g054554
         (483 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8605g052607
         (85 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff855g010602
         (107 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff964g011587
         (410 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8926g053763
         (196 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8822g053396
         (364 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff97g001863
         (201 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8532g052334
         (117 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff906g011095
         (1031 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff903g011070
         (208 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff970g011634
         (177 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff971g011644
         (56 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff916g011163
         (102 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9097g054380
         (189 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff83g001614
         (220 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff879g010837
         (224 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff939g011367
         (284 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff846g010508
         (142 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9826g056832
         (141 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9751g056601
         (186 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9323g055164
         (257 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9652g056305
         (160 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9455g055621
         (69 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8451g052014
         (63 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9856g056918
         (74 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9903g057081
         (102 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9880g057008
         (292 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9957g057250
         (71 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8942g053818
         (94 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff91g001766
         (244 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9805g056776
         (115 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9033g054130
         (197 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9182g054683
         (83 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9545g055948
         (384 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AAR88085  TbcatB  (Cysteine proteases)  [Trypanosoma brucei]          124   2e-33
AAX77225  Falcipain 2'  (Cysteine protease)  [Plasmodium falcipa...    59   2e-10
XP_001347833  Falcipain 3  (Cysteine protease)  [Plasmodium falc...    57   8e-10
P92132  CP2  (Cysteine protease)  [Giardia duodenalis]                 51   3e-08
CAC67416  Brucipain  (Cysteine proteases)  [Trypanosoma brucei]        45   4e-06
PF14_0553  Falcipain1  (Cysteine protease)  [Plasmodium falciparum]    42   3e-05
CAA54436  CP2  (Cysteine protease)  [Trichomonas vaginalis]            41   6e-05

>M.Javanica_Scaff9545g055948 on AAR88085  TbcatB  (Cysteine proteases)  [Trypanosoma brucei]
          Length = 340

 Score =  124 bits (311), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 98/340 (28%), Positives = 159/340 (46%), Gaps = 58/340 (17%)

Query: 30  KGLVDTINNASDVRWKARFNPFGIRVQDFSHKSLKNLTAIKEYVAHLERFFDSSRMKEHL 89
           K  VD +N  +   WKA+++  G+ +Q+ + +  K L  +      +++  ++S + +  
Sbjct: 34  KAFVDRVNRLNRGIWKAKYD--GV-MQNITLREAKRLNGV------IKKNNNASILPKR- 83

Query: 90  KELEEFPDSKLPRHFDAREKWSLCPSIHQIPNQGGCGSCYAVAAMTVAADRTCILSNGTK 149
           +  EE   + LP  FD+ E W  CP+I QI +Q  CGSC+AVAA +  +DR C +  G +
Sbjct: 84  RFTEEEARAPLPSSFDSAEAWPNCPTIPQIADQSACGSCWAVAAASAMSDRFCTMG-GVQ 142

Query: 150 KSQLSALDVIECCSVCGN-CFGGDPLKAMVYWALEGVVTGGPDGCHPYTVNAECGTPCSP 208
              +SA D++ CCS CG+ C GGDP +A  Y++  G+V+   D C PY         CS 
Sbjct: 143 DVHISAGDLLACCSDCGDGCNGGDPDRAWAYFSSTGLVS---DYCQPYPF-----PHCS- 193

Query: 209 QVYGIEQQKRFCRRDKCQPGYYRNINYEEDKQKGSIAYTLFPRKMSIDQSGNKRVMLPSV 268
                          K + GY     +  D  K    YT            +  + + + 
Sbjct: 194 ------------HHSKSKNGYPPCSQFNFDTPK--CNYTC----------DDPTIPVVNY 229

Query: 269 IGHFNKTLKGNLDRDKIRNIIRKELITVGPTTLALPLTEEFLHYDSGIFHPYPEKDFENR 328
               +  L+G  D         +EL   GP  +A  + E+F+ Y+SG++H         +
Sbjct: 230 RSWTSYALQGEDD-------YMRELFFRGPFEVAFDVYEDFIAYNSGVYH-----HVSGQ 277

Query: 329 IIYWHVVRLIGWGHDEEDRLYWIAANSFGEQWGENGHFKV 368
            +  H VRL+GWG       YW  ANS+  +WG +G+F +
Sbjct: 278 YLGGHAVRLVGWG-TSNGVPYWKIANSWNTEWGMDGYFLI 316



>M.Javanica_Scaff9545g055948 on AAX77225  Falcipain 2'  (Cysteine protease)  [Plasmodium
           falciparum]
          Length = 484

 Score = 58.9 bits (141), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 78/354 (22%), Positives = 131/354 (37%), Gaps = 102/354 (28%)

Query: 33  VDTINNASDVRWKARFNPFG-IRVQDFSHK--SLKNLTAIKEYVAHLERFFDSSRMKEHL 89
           V+  NN  +  +K   N F  +   +F +K  SL++   +K          +S  + + +
Sbjct: 196 VNMHNNNKNSLYKKELNRFADLTYHEFKNKYLSLRSSKPLK----------NSKYLLDQM 245

Query: 90  KELEEFPDSKLPRHFD-AREKWSLCPSIHQIPNQGGCGSCYAVAAMTVAADRTCILSNGT 148
              E     K   +FD A   W L   +  + +Q  CGSC+A +++     +  I  N  
Sbjct: 246 NYEEVIKKYKGNENFDHAAYDWRLHSGVTPVKDQKNCGSCWAFSSIGSVESQYAIRKN-- 303

Query: 149 KKSQLSALDVIECCSVCGNCFGGDPLKAMVYWALEGVVTGG---PDGCHPYTVNAECGTP 205
           K   LS  ++++C      C GG     ++  A E ++  G    D  +PY  +A     
Sbjct: 304 KLITLSEQELVDCSFKNYGCNGG-----LINNAFEDMIELGGICTDDDYPYVSDA----- 353

Query: 206 CSPQVYGIEQQKRFCRRDKCQPGYYRNINYEEDKQKGSIAYTLFPRKMSIDQSGNKRVML 265
             P +         C  D+C   Y            G   Y   P               
Sbjct: 354 --PNL---------CNIDRCTEKY------------GIKNYLSVPD-------------- 376

Query: 266 PSVIGHFNKTLKGNLDRDKIRNIIRKELITVGPTTLALPLTEEFLHYDSGIFHPYPEKDF 325
                                N +++ L  +GP ++++ ++++F  Y  GIF      D 
Sbjct: 377 ---------------------NKLKEALRFLGPISISVAVSDDFAFYKEGIF------DG 409

Query: 326 ENRIIYWHVVRLIGWGHDE---------EDRLYWIAANSFGEQWGENGHFKVDT 370
           E      H V L+G+G  E         E   Y+I  NS+G+QWGE G   ++T
Sbjct: 410 ECGDQLNHAVMLVGFGMKEIVNPLTKKGEKHYYYIIKNSWGQQWGERGFINIET 463



>M.Javanica_Scaff9545g055948 on XP_001347833  Falcipain 3  (Cysteine protease)  [Plasmodium
           falciparum]
          Length = 482

 Score = 56.6 bits (135), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 63/281 (22%), Positives = 102/281 (36%), Gaps = 89/281 (31%)

Query: 103 HFD-AREKWSLCPSIHQIPNQGGCGSCYAVAAMTVAADRTCILSNGTKKSQLSALDVIEC 161
           +FD A   W L   +  + +Q  CGSC+A +++     +  I  N  K   LS  ++++C
Sbjct: 257 NFDHAAYDWRLHSGVTPVKDQKNCGSCWAFSSIGSVESQYAIRKN--KLITLSEQELVDC 314

Query: 162 CSVCGNCFGGDPLKAMVYWALEGVVTGG---PDGCHPYTVNAECGTPCSPQVYGIEQQKR 218
                 C GG     ++  A E ++  G    D  +PY  +A                  
Sbjct: 315 SFKNYGCNGG-----LINNAFEDMIELGGICTDDDYPYVSDAP----------------N 353

Query: 219 FCRRDKCQPGYYRNINYEEDKQKGSIAYTLFPRKMSIDQSGNKRVMLPSVIGHFNKTLKG 278
            C  D+C   Y            G   Y   P                            
Sbjct: 354 LCNIDRCTEKY------------GIKNYLSVPD--------------------------- 374

Query: 279 NLDRDKIRNIIRKELITVGPTTLALPLTEEFLHYDSGIFHPYPEKDFENRIIYWHVVRLI 338
                   N +++ L  +GP ++++ ++++F  Y  GIF      D E      H V L+
Sbjct: 375 --------NKLKEALRFLGPISISIAVSDDFPFYKEGIF------DGECGDELNHAVMLV 420

Query: 339 GWGHDE---------EDRLYWIAANSFGEQWGENGHFKVDT 370
           G+G  E         E   Y+I  NS+G+QWGE G   ++T
Sbjct: 421 GFGMKEIVNPLTKKGEKHYYYIIKNSWGQQWGERGFINIET 461



>M.Javanica_Scaff9545g055948 on P92132  CP2  (Cysteine protease)  [Giardia duodenalis]
          Length = 255

 Score = 50.8 bits (120), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 51/113 (45%), Gaps = 10/113 (8%)

Query: 100 LPRHFDAREKWSLCPSIHQIPNQGGCGSCYAVAAMTVAADRTCILSNGTKKSQLSALDVI 159
           +P  FD RE++  C  I ++ +QGGCGSC+A +++    DR C+     K  + S   V+
Sbjct: 75  VPESFDFREEYPHC--IPEVVDQGGCGSCWAFSSVATFGDRRCVAGLDKKPVKYSPQYVV 132

Query: 160 ECCSVCGNCFGGDPLKAMVYWALEGVVTGGPDGCHPY-----TVNAECGTPCS 207
            C      C GG       +    G  T   D C PY     T+   C T C+
Sbjct: 133 SCDHGDMACNGGWLPNVWKFLTKTGTTT---DECVPYKSGSTTLRGTCPTKCA 182



>M.Javanica_Scaff9545g055948 on CAC67416  Brucipain  (Cysteine proteases)  [Trypanosoma brucei]
          Length = 450

 Score = 45.1 bits (105), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 52/113 (46%), Gaps = 9/113 (7%)

Query: 258 SGNKRVMLPSVIGH-FNKTLKGNLDRDKIRNIIRKELITVGPTTLALPLTEEFLHYDSGI 316
           SGN       + GH     +  ++D  +  + I   L   GP  +A+  T  F+ Y+ GI
Sbjct: 218 SGNGEQPQCQMNGHEIGAAITDHVDLPQDEDAIAAYLAENGPLAIAVDATS-FMDYNGGI 276

Query: 317 FHPYPEKDFENRIIYWHVVRLIGWGHDEEDRLYWIAANSFGEQWGENGHFKVD 369
                 +  +      H V L+G+ +D  +  YWI  NS+   WGE+G+ +++
Sbjct: 277 LTSCTSEQLD------HGVLLVGY-NDSSNPPYWIIKNSWSNMWGEDGYIRIE 322



>M.Javanica_Scaff9545g055948 on PF14_0553  Falcipain1  (Cysteine protease)  [Plasmodium falciparum]
          Length = 569

 Score = 42.4 bits (98), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 40/87 (45%), Gaps = 16/87 (18%)

Query: 98  SKLPRHFDAREKWSLCPSIHQIPNQGGCGSCYAVAAM-----TVAADRTCILSNGTKKSQ 152
           SK+P   D REK      +H+  +QG CGSC+A A++       A     ILS       
Sbjct: 331 SKVPEILDYREK----GIVHEPKDQGLCGSCWAFASVGNIESVFAKKNKNILS------- 379

Query: 153 LSALDVIECCSVCGNCFGGDPLKAMVY 179
            S  +V++C      C GG P  + +Y
Sbjct: 380 FSEQEVVDCSKDNFGCDGGHPFYSFLY 406



>M.Javanica_Scaff9545g055948 on CAA54436  CP2  (Cysteine protease)  [Trichomonas vaginalis]
          Length = 255

 Score = 40.8 bits (94), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 36/64 (56%), Gaps = 2/64 (3%)

Query: 116 IHQIPNQGGCGSCYAVAAMTVAADRTCILSNGTKKSQLSALDVIECCSVCGNCFGGDPLK 175
           +++I +QG CGSC+A +A+  +  R        +   L+  ++++C + C  C GG P K
Sbjct: 111 VNKIKDQGQCGSCWAFSAIQASESR--YAQANKQLLDLAEQNIVDCVTSCYGCNGGWPSK 168

Query: 176 AMVY 179
           A+ Y
Sbjct: 169 AIDY 172






BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8793g053286
         (207 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff851g010565
         (170 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8391g051791
         (211 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8644g052767
         (111 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9097g054379
         (100 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9158g054611
         (108 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9259g054957
         (83 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8g000230
         (64 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9524g055866
         (359 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AAR88085  TbcatB  (Cysteine proteases)  [Trypanosoma brucei]          149   4e-43
P92132  CP2  (Cysteine protease)  [Giardia duodenalis]                 91   5e-22
PF14_0553  Falcipain1  (Cysteine protease)  [Plasmodium falciparum]    84   9e-19
ABC02174  Falstatin  (Others)  [Plasmodium falciparum]                 81   8e-18
XP_001347836  Falcipain 2  (Cysteine protease)  [Plasmodium falc...    81   8e-18
AAX77225  Falcipain 2'  (Cysteine protease)  [Plasmodium falcipa...    78   7e-17
XP_001347833  Falcipain 3  (Cysteine protease)  [Plasmodium falc...    77   1e-16
CAC67416  Brucipain  (Cysteine proteases)  [Trypanosoma brucei]        70   3e-14
XP_650937  CP5  (Cysteine protease)  [Entamoeba histolytica]           65   9e-13
AAS38514  CP65  (Cysteine protease)  [Trichomonas vaginalis]           59   2e-11
CAA54436  CP2  (Cysteine protease)  [Trichomonas vaginalis]            51   3e-08
CAA54438  CP1  (Cysteine protease)  [Trichomonas vaginalis]            50   8e-08
XP_650156  CP1  (Cysteine protease)  [Entamoeba histolytica]           48   4e-07
XP_650642  CP2  (Cysteine protease)  [Entamoeba histolytica]           47   1e-06
AAV98582  CP4  (Cysteine protease)  [Trichomonas vaginalis]            46   1e-06

>M.Javanica_Scaff9524g055866 on AAR88085  TbcatB  (Cysteine proteases)  [Trypanosoma brucei]
          Length = 340

 Score =  149 bits (377), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 119/336 (35%), Positives = 159/336 (47%), Gaps = 50/336 (14%)

Query: 38  AKDLVKKINVKAAGIWTASVN-ELSRLPLAKQKILCGVKLSAELKINKTEATPPK--FDT 94
           +K  V ++N    GIW A  +  +  + L + K L GV     +K N   +  PK  F  
Sbjct: 33  SKAFVDRVNRLNRGIWKAKYDGVMQNITLREAKRLNGV-----IKKNNNASILPKRRFTE 87

Query: 95  KPGCECFPKVDYDARTKWSGCSQIIGRIQHQGQCGSCWAVSTASAYTDRYCIARAKKGQN 154
           +      P   +D+   W  C   I +I  Q  CGSCWAV+ ASA +DR+C     +   
Sbjct: 88  EEARAPLPS-SFDSAEAWPNCP-TIPQIADQSACGSCWAVAAASAMSDRFCTMGGVQD-- 143

Query: 155 SPANDAGYQFSAFDVLTC-SMQGDGCRGGWPYSAWQWIQTKGVCTGTDYTWKSGCKPYPF 213
                     SA D+L C S  GDGC GG P  AW +  + G+ +  DY     C+PYPF
Sbjct: 144 -------VHISAGDLLACCSDCGDGCNGGDPDRAWAYFSSTGLVS--DY-----CQPYPF 189

Query: 214 ------SPNQAGPAPPCKSSCTASWKTAYPQDKHMGVSATQLNGGQATVAAIQ------R 261
                 S ++ G  PPC      + K  Y  D     +   +N    T  A+Q      R
Sbjct: 190 PHCSHHSKSKNG-YPPCSQFNFDTPKCNYTCDD---PTIPVVNYRSWTSYALQGEDDYMR 245

Query: 262 EIQTNGPVVAIFAVYSDFMSYRSGVYFRTSNQLVGYHAVRIIGWGTQTCFNSNQKVDFWI 321
           E+   GP    F VY DF++Y SGVY   S Q +G HAVR++GWGT      +  V +W 
Sbjct: 246 ELFFRGPFEVAFDVYEDFIAYNSGVYHHVSGQYLGGHAVRLVGWGT------SNGVPYWK 299

Query: 322 GANSWGTGWGEYGFFKIRRGVNEVGFEQSGISFGVP 357
            ANSW T WG  G+F IRRG +E G E  G S G+P
Sbjct: 300 IANSWNTEWGMDGYFLIRRGSSECGIEDGG-SAGIP 334



>M.Javanica_Scaff9524g055866 on P92132  CP2  (Cysteine protease)  [Giardia duodenalis]
          Length = 255

 Score = 90.9 bits (224), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 62/203 (30%), Positives = 91/203 (44%), Gaps = 26/203 (12%)

Query: 106 YDARTKWSGCSQIIGRIQHQGQCGSCWAVSTASAYTDRYCIARAKKGQNSPANDAGYQFS 165
           +D R ++  C   I  +  QG CGSCWA S+ + + DR C+A   K           ++S
Sbjct: 79  FDFREEYPHC---IPEVVDQGGCGSCWAFSSVATFGDRRCVAGLDKKP--------VKYS 127

Query: 166 AFDVLTCSMQGDGCRGGWPYSAWQWIQTKGVCTGTDYTWKSGCKPYPFSPNQAGPAPPCK 225
              V++C      C GGW  + W+++   G  T     +KSG      S    G  P   
Sbjct: 128 PQYVVSCDHGDMACNGGWLPNVWKFLTKTGTTTDECVPYKSG------STTLRGTCPT-- 179

Query: 226 SSCTASWKTAYPQDKHMGVSATQLNGGQATVAAIQREIQTNGPVVAIFAVYSDFMSYRSG 285
                  K A    K    +AT        + A+ + + T+GP+   F V+SDFM Y SG
Sbjct: 180 -------KCADGSSKVHLATATSYKDYGLDIPAMMKALSTSGPLQVAFLVHSDFMYYESG 232

Query: 286 VYFRTSNQLVGYHAVRIIGWGTQ 308
           VY  T   + G HAV ++G+GT 
Sbjct: 233 VYQHTYGYMEGGHAVEMVGYGTD 255



>M.Javanica_Scaff9524g055866 on PF14_0553  Falcipain1  (Cysteine protease)  [Plasmodium falciparum]
          Length = 569

 Score = 84.0 bits (206), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 67/245 (27%), Positives = 106/245 (43%), Gaps = 55/245 (22%)

Query: 118 IIGRIQHQGQCGSCWAVSTASAYTDRYCIARAKKGQNSPANDAGYQFSAFDVLTCSMQGD 177
           I+   + QG CGSCWA ++       +    AKK +N  +      FS  +V+ CS    
Sbjct: 344 IVHEPKDQGLCGSCWAFASVGNIESVF----AKKNKNILS------FSEQEVVDCSKDNF 393

Query: 178 GCRGGWPYSAWQWIQTKGVCTGTDYTWKSGCKPYPFSPNQAGPAPPCKSSCTASWKTAYP 237
           GC GG P+ ++ ++    +C G +Y +K+  K   F  N       CK   + S      
Sbjct: 394 GCDGGHPFYSFLYVLQNELCLGDEYKYKA--KDDMFCLNYR-----CKRKVSLS------ 440

Query: 238 QDKHMGVSATQLNGGQATVAAIQREIQTNGPVVAIFAVYSDFMSYRSGVYFRTSNQLVGY 297
                 + A + N  Q  +A     +   GP+     V +DF++Y  GVY  T ++ +  
Sbjct: 441 -----SIGAVKEN--QLILA-----LNEVGPLSVNVGVNNDFVAYSEGVYNGTCSEELN- 487

Query: 298 HAVRIIGWG--TQTCFNSNQKVD-----------------FWIGANSWGTGWGEYGFFKI 338
           H+V ++G+G   +T  N N K+                  +WI  NSW   WGE GF ++
Sbjct: 488 HSVLLVGYGQVEKTKLNYNNKIQTYNTKENSNQPDDNIIYYWIIKNSWSKKWGENGFMRL 547

Query: 339 RRGVN 343
            R  N
Sbjct: 548 SRNKN 552



>M.Javanica_Scaff9524g055866 on ABC02174  Falstatin  (Others)  [Plasmodium falciparum]
          Length = 492

 Score = 81.3 bits (199), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 58/227 (25%), Positives = 95/227 (41%), Gaps = 41/227 (18%)

Query: 122 IQHQGQCGSCWAVSTASAYTDRYCIARAKKGQNSPANDAGYQFSAFDVLTCSMQGDGCRG 181
           ++ Q  CGSCWA S+  +   +Y I +           A + FS  +++ CS++ +GC G
Sbjct: 284 VKDQALCGSCWAFSSVGSVESQYAIRKK----------ALFLFSEQELVDCSVKNNGCYG 333

Query: 182 GWPYSAWQ-WIQTKGVCTGTDYTWKSGCKPYPFSPNQAGPAPPCKSSCTASWKTAYPQDK 240
           G+  +A+   I   G+C+  DY       PY  +  +      C    T     + P DK
Sbjct: 334 GYITNAFDDMIDLGGLCSQDDY-------PYVSNLPETCNLKRCNERYTIKSYVSIPDDK 386

Query: 241 HMGVSATQLNGGQATVAAIQREIQTNGPVVAIFAVYSDFMSYRSGVYFRTSNQLVGYHAV 300
                              +  ++  GP+    A   DF  YR G Y          HAV
Sbjct: 387 ------------------FKEALRYLGPISISIAASDDFAFYRGGFYDGECGAAPN-HAV 427

Query: 301 RIIGWGTQTCFNSN----QKVDFWIGANSWGTGWGEYGFFKIRRGVN 343
            ++G+G +  +N +    +K  ++I  NSWG+ WGE G+  +    N
Sbjct: 428 ILVGYGMKDIYNEDTGRMEKFYYYIIKNSWGSDWGEGGYINLETDEN 474



>M.Javanica_Scaff9524g055866 on XP_001347836  Falcipain 2  (Cysteine protease)  [Plasmodium
           falciparum]
          Length = 492

 Score = 81.3 bits (199), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 58/227 (25%), Positives = 95/227 (41%), Gaps = 41/227 (18%)

Query: 122 IQHQGQCGSCWAVSTASAYTDRYCIARAKKGQNSPANDAGYQFSAFDVLTCSMQGDGCRG 181
           ++ Q  CGSCWA S+  +   +Y I +           A + FS  +++ CS++ +GC G
Sbjct: 284 VKDQALCGSCWAFSSVGSVESQYAIRKK----------ALFLFSEQELVDCSVKNNGCYG 333

Query: 182 GWPYSAWQ-WIQTKGVCTGTDYTWKSGCKPYPFSPNQAGPAPPCKSSCTASWKTAYPQDK 240
           G+  +A+   I   G+C+  DY       PY  +  +      C    T     + P DK
Sbjct: 334 GYITNAFDDMIDLGGLCSQDDY-------PYVSNLPETCNLKRCNERYTIKSYVSIPDDK 386

Query: 241 HMGVSATQLNGGQATVAAIQREIQTNGPVVAIFAVYSDFMSYRSGVYFRTSNQLVGYHAV 300
                              +  ++  GP+    A   DF  YR G Y          HAV
Sbjct: 387 ------------------FKEALRYLGPISISIAASDDFAFYRGGFYDGECGAAPN-HAV 427

Query: 301 RIIGWGTQTCFNSN----QKVDFWIGANSWGTGWGEYGFFKIRRGVN 343
            ++G+G +  +N +    +K  ++I  NSWG+ WGE G+  +    N
Sbjct: 428 ILVGYGMKDIYNEDTGRMEKFYYYIIKNSWGSDWGEGGYINLETDEN 474



>M.Javanica_Scaff9524g055866 on AAX77225  Falcipain 2'  (Cysteine protease)  [Plasmodium
           falciparum]
          Length = 484

 Score = 78.2 bits (191), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 68/249 (27%), Positives = 105/249 (42%), Gaps = 48/249 (19%)

Query: 97  GCECFPKVDYDARTKWSGCSQIIGRIQHQGQCGSCWAVSTASAYTDRYCIARAKKGQNSP 156
           G E F    YD R   SG + +    + Q  CGSCWA S+  +   +Y I + K      
Sbjct: 256 GNENFDHAAYDWRLH-SGVTPV----KDQKNCGSCWAFSSIGSVESQYAIRKNKL----- 305

Query: 157 ANDAGYQFSAFDVLTCSMQGDGCRGGWPYSAWQ-WIQTKGVCTGTDYTWKSGCKPYPFSP 215
                   S  +++ CS +  GC GG   +A++  I+  G+CT  DY + S       +P
Sbjct: 306 -----ITLSEQELVDCSFKNYGCNGGLINNAFEDMIELGGICTDDDYPYVSD------AP 354

Query: 216 NQAGPAPPCKSSCTASWKTAYPQDKHMGVSATQLNGGQATVAAIQREIQTNGPVVAIFAV 275
           N           CT  +        ++ V   +L          +  ++  GP+    AV
Sbjct: 355 NLCNI-----DRCTEKYGIK----NYLSVPDNKL----------KEALRFLGPISISVAV 395

Query: 276 YSDFMSYRSGVYF-RTSNQLVGYHAVRIIGWGTQTCFN----SNQKVDFWIGANSWGTGW 330
             DF  Y+ G++     +QL   HAV ++G+G +   N      +K  ++I  NSWG  W
Sbjct: 396 SDDFAFYKEGIFDGECGDQL--NHAVMLVGFGMKEIVNPLTKKGEKHYYYIIKNSWGQQW 453

Query: 331 GEYGFFKIR 339
           GE GF  I 
Sbjct: 454 GERGFINIE 462



>M.Javanica_Scaff9524g055866 on XP_001347833  Falcipain 3  (Cysteine protease)  [Plasmodium
           falciparum]
          Length = 482

 Score = 77.4 bits (189), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 66/248 (26%), Positives = 103/248 (41%), Gaps = 46/248 (18%)

Query: 97  GCECFPKVDYDARTKWSGCSQIIGRIQHQGQCGSCWAVSTASAYTDRYCIARAKKGQNSP 156
           G E F    YD R   SG + +    + Q  CGSCWA S+  +   +Y I + K      
Sbjct: 254 GNENFDHAAYDWRLH-SGVTPV----KDQKNCGSCWAFSSIGSVESQYAIRKNKL----- 303

Query: 157 ANDAGYQFSAFDVLTCSMQGDGCRGGWPYSAWQ-WIQTKGVCTGTDYTWKSGCKPYPFSP 215
                   S  +++ CS +  GC GG   +A++  I+  G+CT  DY + S       +P
Sbjct: 304 -----ITLSEQELVDCSFKNYGCNGGLINNAFEDMIELGGICTDDDYPYVSD------AP 352

Query: 216 NQAGPAPPCKSSCTASWKTAYPQDKHMGVSATQLNGGQATVAAIQREIQTNGPVVAIFAV 275
           N           CT  +        ++ V   +L          +  ++  GP+    AV
Sbjct: 353 NLCNI-----DRCTEKYGIK----NYLSVPDNKL----------KEALRFLGPISISIAV 393

Query: 276 YSDFMSYRSGVYFRTSNQLVGYHAVRIIGWGTQTCFN----SNQKVDFWIGANSWGTGWG 331
             DF  Y+ G++       +  HAV ++G+G +   N      +K  ++I  NSWG  WG
Sbjct: 394 SDDFPFYKEGIFDGECGDELN-HAVMLVGFGMKEIVNPLTKKGEKHYYYIIKNSWGQQWG 452

Query: 332 EYGFFKIR 339
           E GF  I 
Sbjct: 453 ERGFINIE 460



>M.Javanica_Scaff9524g055866 on CAC67416  Brucipain  (Cysteine proteases)  [Trypanosoma brucei]
          Length = 450

 Score = 70.1 bits (170), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 66/235 (28%), Positives = 95/235 (40%), Gaps = 48/235 (20%)

Query: 122 IQHQGQCGSCWAVSTASAYTDRYCIARAKKGQNSPANDAGYQFSAFDVLTCSMQGDGCRG 181
           ++ QGQCGSCWA ST              +GQ   A +     S   +++C     GC G
Sbjct: 141 VKDQGQCGSCWAFSTIGNI----------EGQWQVAGNPLVSLSEQMLVSCDTIDFGCGG 190

Query: 182 GWPYSAWQWIQTKGVCTGTDYTWKSGCKPYPFSPNQAGPAPPCKSS-----CTASWKTAY 236
           G   +A+ WI       G  +T  S    YP+     G  P C+ +        +     
Sbjct: 191 GLMDNAFNWIVNSN--GGNVFTEAS----YPYVSGN-GEQPQCQMNGHEIGAAITDHVDL 243

Query: 237 PQDKHMGVSATQLNGGQATVAAIQREIQTNGPVVAIFAVYSDFMSYRSGVYFR-TSNQLV 295
           PQD+                 AI   +  NGP+ AI    + FM Y  G+    TS QL 
Sbjct: 244 PQDED----------------AIAAYLAENGPL-AIAVDATSFMDYNGGILTSCTSEQL- 285

Query: 296 GYHAVRIIGWGTQTCFNSNQKVDFWIGANSWGTGWGEYGFFKIRRGVNEVGFEQS 350
             H V ++G      +N +    +WI  NSW   WGE G+ +I +G N+    Q+
Sbjct: 286 -DHGVLLVG------YNDSSNPPYWIIKNSWSNMWGEDGYIRIEKGTNQCLMNQA 333



>M.Javanica_Scaff9524g055866 on XP_650937  CP5  (Cysteine protease)  [Entamoeba histolytica]
          Length = 318

 Score = 65.1 bits (157), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 64/242 (26%), Positives = 98/242 (40%), Gaps = 51/242 (21%)

Query: 122 IQHQGQCGSCWAVSTASAYTDRYCIARAKKGQNSPANDAGYQFSAFDVLTCSMQGDGCRG 181
           I+ Q  CGSC++ ++ +A   R  +A +KK      +D           + S+   GC G
Sbjct: 110 IRDQASCGSCYSFASVAAIEGRLLVAGSKK---FTVDDLDLSEQQLVDCSVSVGNKGCNG 166

Query: 182 GWPYSAWQWIQTKGVCTGTDYTWKSGCKPYPFSPNQAGPAPPCKSSCTASWKTAYPQDKH 241
           G    ++++++  G+    DY                 P    + +CT          K 
Sbjct: 167 GSLLLSFRYVKLNGIMQEKDY-----------------PYVAAEETCTY-------DKKK 202

Query: 242 MGVSATQLNGGQATV-----AAIQREIQTNGPVVAIFAVYSDFMSYRSGVYFR---TSNQ 293
           + V  T    GQ  V      A+ R         AI A    F  Y+SG+Y     +S Q
Sbjct: 203 VAVKIT----GQKLVRPGSEKALMRAAAEGPVAAAIDASGVKFQLYKSGIYNSKECSSTQ 258

Query: 294 LVGYHAVRIIGWGTQTCFNSNQKVDFWIGANSWGTGWGEYGFFKIRRGVNEVGFEQSGIS 353
           L   H V ++G+GTQ         ++WI  NSWGT WG+ G+  + R  N     Q GI+
Sbjct: 259 L--NHGVAVVGYGTQN------GTEYWIVRNSWGTIWGDQGYVLMSRNKN----NQCGIA 306

Query: 354 FG 355
            G
Sbjct: 307 SG 308



>M.Javanica_Scaff9524g055866 on AAS38514  CP65  (Cysteine protease)  [Trichomonas vaginalis]
          Length = 206

 Score = 59.3 bits (142), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 56/214 (26%), Positives = 81/214 (37%), Gaps = 44/214 (20%)

Query: 118 IIGRIQHQGQCGSCWAVSTASAYTDRYCIARAKKGQNSPANDAGYQFSAFDVLTCSMQGD 177
           ++  IQ QGQCGSCWA S   A   +Y I   +  + S  N          ++ C    D
Sbjct: 32  VVNPIQDQGQCGSCWAFSAIQAQESQYAITSGELQKLSEQN----------LVDCVTTCD 81

Query: 178 GCRGGWPYSAWQWI---QTKGVCTGTDYTWKSGCKPYPFSPNQAGPAPPCKSSCTASWKT 234
           GC GG   +A+ ++   Q        DY       PY                    +  
Sbjct: 82  GCEGGLMTNAYDYVIKYQDGKFMLENDY-------PYT----------------AYYYDC 118

Query: 235 AYPQDKHMGVSATQLNGGQATVAAIQREIQTNGP-VVAIFAVYSDFMSYRSGVYFRTSNQ 293
            +  DK +    + +N  +     +  +I TNGP  VAI A +  F  Y  G+Y   S  
Sbjct: 119 LFDTDKAVSNIVSYINVVEGDENDLATKISTNGPAAVAIDASHYSFQLYSQGIYNVPSRS 178

Query: 294 LVGY-HAVRIIGWGTQTCFNSNQKVDFWIGANSW 326
             G  H V  +G+G +          +WI  NSW
Sbjct: 179 SYGLDHGVGCVGYGAEG------STKYWIVKNSW 206



>M.Javanica_Scaff9524g055866 on CAA54436  CP2  (Cysteine protease)  [Trichomonas vaginalis]
          Length = 255

 Score = 50.8 bits (120), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 42/153 (27%), Positives = 63/153 (41%), Gaps = 27/153 (17%)

Query: 39  KDLVKKINVKAAGIWTASVNELSRLPLAKQKILCGVKLSAELKINKTEATPPKFDTKPGC 98
           K LV++ N    G +   +N+L+ L  ++ + L G K   +   N  +   P  D     
Sbjct: 48  KRLVQEHNAANKG-FKLGLNKLAHLTQSEYRSLLGAKRLGQKSGNFFKCDAPANDA---- 102

Query: 99  ECFPKVDYDARTKWSGCSQIIGRIQHQGQCGSCWAVSTASAYTDRYCIARAKKGQNSPAN 158
                   D R K      I+ +I+ QGQCGSCWA S   A   RY          + AN
Sbjct: 103 -------VDWRDKG-----IVNKIKDQGQCGSCWAFSAIQASESRY----------AQAN 140

Query: 159 DAGYQFSAFDVLTCSMQGDGCRGGWPYSAWQWI 191
                 +  +++ C     GC GGWP  A  ++
Sbjct: 141 KQLLDLAEQNIVDCVTSCYGCNGGWPSKAIDYV 173



>M.Javanica_Scaff9524g055866 on CAA54438  CP1  (Cysteine protease)  [Trichomonas vaginalis]
          Length = 255

 Score = 49.7 bits (117), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 68/275 (24%), Positives = 106/275 (38%), Gaps = 56/275 (20%)

Query: 39  KDLVKKINVKAAGIWTASVNELSRLPLAKQKILCGVKLSAELKINKTEATPPKFDTKPGC 98
           K LV++ N    G +T ++N+L+ L  A+   L G       ++NK E    K +     
Sbjct: 25  KRLVQEHNRANLG-FTVALNKLAHLTPAEYNSLLG------FRMNKAERKAVKSNAIANA 77

Query: 99  ECFPKVDYDARTKWSGCSQIIGRIQHQGQCGSCWAVSTASAYTDRYCIARAKKGQNSPAN 158
           +C      D R K +     +  I+ QGQCGSCWA S   A   +Y I+       S  N
Sbjct: 78  DC------DWRKKGA-----VNPIKDQGQCGSCWAFSAIQAQESQYYISFKTLQSLSEQN 126

Query: 159 DAGYQFSAFDVLTCSMQGDGCRGGWPYSAWQWI---QTKGVCTGTDYTWKSGCKPYPFSP 215
                     ++ C     GC GG   +A+ ++   Q+    T  DY             
Sbjct: 127 ----------LVDCVTTCYGCNGGLMDAAYDYVVKHQSGKFMTEADY------------- 163

Query: 216 NQAGPAPPCKSSCTASWKTAYPQDKHMGVSATQLNGGQATVAAIQREIQTNGP-VVAIFA 274
               P      SC  +      Q K      + +N  +     +  ++ T GP  +AI A
Sbjct: 164 ----PYTARDGSCKFNAAKGTSQIK------SYVNVAEGDEKDLATKVSTLGPAAIAIDA 213

Query: 275 VYSDFMSYRSGVYFRTSNQLVGY-HAVRIIGWGTQ 308
               F  Y SG+Y  ++       H V  +G+GT+
Sbjct: 214 SAWSFQLYSSGIYDESACSSYNLDHGVGCVGYGTE 248



>M.Javanica_Scaff9524g055866 on XP_650156  CP1  (Cysteine protease)  [Entamoeba histolytica]
          Length = 315

 Score = 47.8 bits (112), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 57/225 (25%), Positives = 83/225 (36%), Gaps = 48/225 (21%)

Query: 122 IQHQGQCGSCWAVSTASAYTDRYCIARAKKGQNSPANDAGYQFSAFDVLTCSMQGDGCRG 181
           I+ QG CGSC+   + +A   R  I   +KG +S   D     S   ++ C+ +      
Sbjct: 109 IRDQGNCGSCYTFGSIAALEGRLLI---EKGGDSETLD----LSEEHMVQCTREDGNNGC 161

Query: 182 GWPYS--AWQWIQTKGVCTGTDYTWKSGCKPYPFSPNQAGPAPPCKSSCTASWKTAYPQD 239
                   + +I   G+   +DY       PY       G    C+S   A  K      
Sbjct: 162 NGGLGSNVYNYIMENGIAKESDY-------PY------TGSDSTCRSDVKAFAKIK---- 204

Query: 240 KHMGVSATQLNGGQATVAAIQREIQTNGPVVAIFAVYSDFMSYRSGVYFRT---SNQLVG 296
                +    N      AAI + +      V+I A    F  Y+SG Y      +N    
Sbjct: 205 ---SYNRVARNNEVELKAAISQGLVD----VSIDASSVQFQLYKSGAYTDKQCKNNYFAL 257

Query: 297 YHAVRIIGWGT---QTCFNSNQKVDFWIGANSWGTGWGEYGFFKI 338
            H V  +G+G    + C         WI  NSWGTGWGE G+  +
Sbjct: 258 NHEVCAVGYGVVDGKEC---------WIVRNSWGTGWGEKGYINM 293



>M.Javanica_Scaff9524g055866 on XP_650642  CP2  (Cysteine protease)  [Entamoeba histolytica]
          Length = 315

 Score = 46.6 bits (109), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 56/225 (24%), Positives = 86/225 (38%), Gaps = 48/225 (21%)

Query: 122 IQHQGQCGSCWAVSTASAYTDRYCIARAKKGQNSPANDAGYQFSAFDVLTCSMQGDGCRG 181
           I+ Q QCGSC+   + +A   R  I   +KG ++   D     S   ++ C+        
Sbjct: 109 IRDQAQCGSCYTFGSLAALEGRLLI---EKGGDANTLD----LSEEHMVQCTRDNGNNGC 161

Query: 182 GWPYS--AWQWIQTKGVCTGTDYTWKSGCKPYPFSPNQAGPAPPCKSSCTASWKTAYPQD 239
                   + +I   GV   +DY       PY       G    CK++  +  K      
Sbjct: 162 NGGLGSNVYDYIIEHGVAKESDY-------PY------TGSDSTCKTNVKSFAKIT---- 204

Query: 240 KHMGVSATQLNGGQATVAAIQREIQTNGPVVAIFAVYSDFMSYRSGVYFRT---SNQLVG 296
              G +    N      AA+ + +      V+I A  + F  Y+SG Y  T   +N    
Sbjct: 205 ---GYTKVPRNNEAELKAALSQGLVD----VSIDASSAKFQLYKSGAYTDTKCKNNYFAL 257

Query: 297 YHAVRIIGWGT---QTCFNSNQKVDFWIGANSWGTGWGEYGFFKI 338
            H V  +G+G    + C         WI  NSWGTGWG+ G+  +
Sbjct: 258 NHEVCAVGYGVVDGKEC---------WIVRNSWGTGWGDKGYINM 293



>M.Javanica_Scaff9524g055866 on AAV98582  CP4  (Cysteine protease)  [Trichomonas vaginalis]
          Length = 255

 Score = 45.8 bits (107), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 63/253 (24%), Positives = 96/253 (37%), Gaps = 55/253 (21%)

Query: 39  KDLVKKINVKAAGIWTASVNELSRLPLAKQKILCGVKLSAELKINKTEATPPKFDTKPGC 98
           K LV++ N    G +T ++N+L+ L  A+   L G       ++NK E    K +     
Sbjct: 38  KRLVQEHNRANLG-FTVALNKLAHLTPAEYNSLLG------FRMNKAERKAVKSNAIANA 90

Query: 99  ECFPKVDYDARTKWSGCSQIIGRIQHQGQCGSCWAVSTASAYTDRYCIARAKKGQNSPAN 158
           +C      D R K +     +  I+ QGQCGSCWA S   A   +Y I+       S  N
Sbjct: 91  DC------DWRKKGA-----VNPIKDQGQCGSCWAFSAIQAQESQYYISFKTLQSLSEQN 139

Query: 159 DAGYQFSAFDVLTCSMQGDGCRGGWPYSAWQWI---QTKGVCTGTDYTWKSGCKPYPFSP 215
                     ++ C     GC GG   +A+ ++   Q+    T  DY             
Sbjct: 140 ----------LVDCVTTCYGCNGGLMDAAYDYVVKHQSGKFMTEADY------------- 176

Query: 216 NQAGPAPPCKSSCTASWKTAYPQDKHMGVSATQLNGGQATVAAIQREIQTNGP-VVAIFA 274
               P      SC  +      Q K      + +N  +     +  ++ T GP  +AI A
Sbjct: 177 ----PYTARDGSCKFNAAKGTSQIK------SYVNVAEGDEKDLATKVSTLGPAAIAIDA 226

Query: 275 VYSDFMSYRSGVY 287
               F  Y SG+Y
Sbjct: 227 SAWSFQLYSSGIY 239






BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9283g055027
         (129 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8774g053224
         (80 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9016g054067
         (55 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8410g051866
         (123 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9201g054757
         (128 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9476g055698
         (146 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff946g011428
         (124 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9725g056507
         (124 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9269g054985
         (353 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8515g052274
         (167 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8745g053116
         (345 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9482g055724
         (122 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8732g053076
         (324 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8911g053720
         (246 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff98g001869
         (68 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8911g053722
         (120 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8406g051853
         (86 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff873g010791
         (350 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9562g056018
         (63 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9917g057131
         (280 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9118g054460
         (166 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff996g011869
         (123 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8543g052370
         (199 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9403g055421
         (200 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9443g055583
         (74 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9223g054831
         (149 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9938g057198
         (654 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9506g055796
         (118 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff985g011765
         (76 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff879g010840
         (245 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8650g052787
         (56 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9145g054558
         (103 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8707g053002
         (343 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9653g056307
         (77 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8777g053236
         (241 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff887g010916
         (322 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9615g056185
         (80 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8456g052031
         (165 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9406g055429
         (126 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8672g052876
         (128 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8825g053410
         (209 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9119g054462
         (103 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8496g052198
         (103 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff91g001764
         (145 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9511g055811
         (149 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8817g053380
         (215 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9725g056509
         (120 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9870g056963
         (66 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9152g054587
         (52 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9794g056738
         (81 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff843g010481
         (76 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9326g055177
         (60 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9063g054229
         (103 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff887g010918
         (355 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9543g055944
         (111 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9097g054378
         (54 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff870g010756
         (305 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9400g055409
         (58 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9352g055260
         (149 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff974g011663
         (79 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff900g011041
         (229 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8410g051868
         (378 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8861g053539
         (183 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8416g051892
         (156 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9061g054227
         (69 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9009g054045
         (143 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff841g010446
         (92 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8442g051989
         (154 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8824g053405
         (50 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9025g054098
         (98 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8415g051889
         (133 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff894g010985
         (137 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8502g052220
         (76 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8826g053412
         (100 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8782g053256
         (103 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff887g010910
         (296 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9782g056701
         (229 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9824g056827
         (64 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff845g010500
         (87 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9177g054673
         (96 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9579g056063
         (275 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff85g001647
         (77 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9959g057259
         (70 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff919g011200
         (239 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9873g056974
         (100 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9274g054996
         (124 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9971g057300
         (78 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff961g011571
         (80 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9184g054695
         (92 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff949g011459
         (66 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8902g053686
         (246 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff856g010610
         (243 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9263g054969
         (198 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff8570g052466
         (95 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9392g055389
         (662 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff899g011037
         (263 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******





BLASTP 2.2.26 [Sep-21-2011]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= M.Javanica_Scaff9g000253
         (134 letters)

Database: protseq.fasta 
           1775 sequences; 1,065,101 total letters

Searching..................................................done

 ***** No hits found ******


  Database: protseq.fasta
    Posted date:  Dec 26, 2008  2:04 PM
  Number of letters in database: 1,065,101
  Number of sequences in database:  1775
  
Lambda     K      H
   0.316    0.135    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1775
Number of Hits to DB: 3,182,704,500
Number of extensions: 155718500
Number of successful extensions: 583241
Number of sequences better than 1.0e-04: 1492
Number of HSP's gapped: 576690
Number of HSP's successfully gapped: 2437
Length of database: 1,065,101
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 90 (39.3 bits)



[First][Previous]  Results of query sequence 7074 through 7458