To download the entire database in the fasta format click here
The protein entries in the database for which the sequence is not available are also included in the fasta-formatted database, and are marked as N.i.(Not identified).
The data in the fasta file follows the following format:
>Accession no. Protein name (Category) [Organism] ACDEFGHIKLMNPQRSTVWYASDEFRCFVNHKMLM(Protein Sequence)
To download the entire database in the fasta format click here