|
Chro.10032 | Chro.10032-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1281 | Chro.10032 | GPI-anchor transamidase (U32517) -related | GPI-anchor transamidase (U32517) -related | 3415671 | | Not Assigned | AAEL01000091:147..1,427(-) | AAEL01000091:147..1427(-) | AAEL01000091 | Cryptosporidium hominis TU502 | 13 | OG6_101767 | 0 | 426 | 1281 | 49834 | 9.54 | 1 | HMM: MKIFLAFTILLFYSLEILFQR, NN: MKIFLAFTILLFYSLEILFQR | NN Sum: 3, NN D: .65, HMM Prob: .92 | | | GO:0008233 | peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.-.-.- (Hydrolases.) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.10032ORGPI-anchor transamidase (U32517) -relatedANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.10032 OR GPI-anchor transamidase (U32517) -related AND Cryptosporidium hominis TU502 |
|
Chro.10040 | Chro.10040-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1467 | Chro.10040 | tRNA-guaninine transglycosylase | tRNA-guaninine transglycosylase | 3415673 | | Not Assigned | AAEL01000091:10,098..11,564(+) | AAEL01000091:10098..11564(+) | AAEL01000091 | Cryptosporidium hominis TU502 | 14 | OG6_101892 | 0 | 488 | 1467 | 55450 | 5.37 | 0 | | | | | GO:0005515;GO:0036459 | protein binding;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.10040ORtRNA-guaninine transglycosylaseANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.10040 OR tRNA-guaninine transglycosylase AND Cryptosporidium hominis TU502 |
|
Chro.10044 | Chro.10044-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1194 | Chro.10044 | hypothetical protein | hypothetical protein | 3415680 | | Not Assigned | AAEL01000091:19,742..20,935(+) | AAEL01000091:19742..20935(+) | AAEL01000091 | Cryptosporidium hominis TU502 | 13 | OG6_104644 | 0 | 397 | 1194 | 45544 | 5.69 | 0 | | | | | GO:0005515;GO:0004843 | protein binding;thiol-dependent ubiquitin-specific protease activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.10044ORhypothetical proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.10044 OR hypothetical protein AND Cryptosporidium hominis TU502 |
|
Chro.10047 | Chro.10047-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1612 | Chro.10047 | hypothetical protein | hypothetical protein | 3414598 | | Not Assigned | AAEL01000727:687..2,298(+) | AAEL01000727:687..2298(+) | AAEL01000727 | Cryptosporidium hominis TU502 | 10 | OG6_141901 | 0 | 537 | 1612 | 61513 | 6.89 | 1 | HMM: MKKQRKPSDIISFLTIIFLIFIYKVFGY, NN: MKKQRKPSDIISFLTIIFLIFIYKVFGY | NN Sum: 4, NN D: .65, HMM Prob: .08 | | | GO:0004181;GO:0008270 | metallocarboxypeptidase activity;zinc ion binding | GO:0006508 | proteolysis | | | | | | | | 3.4.17.- (Metallocarboxypeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.10047ORhypothetical proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.10047 OR hypothetical protein AND Cryptosporidium hominis TU502 |
|
Chro.10054 | Chro.10054-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 252 | Chro.10054 | 20S proteasome beta subunit D2 (PBD2) | 20S proteasome beta subunit D2 (PBD2) | 3412934 | | Not Assigned | AAEL01000257:3,717..3,968(-) | AAEL01000257:3717..3968(-) | AAEL01000257 | Cryptosporidium hominis TU502 | 13 | OG6_102061 | 0 | 83 | 252 | 9340 | 7.51 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.10054OR20S proteasome beta subunit D2 (PBD2)ANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.10054 OR 20S proteasome beta subunit D2 (PBD2) AND Cryptosporidium hominis TU502 |
|
Chro.10092 | Chro.10092-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 363 | Chro.10092 | similar to ash2 | similar to ash2 | 3412129 | | Not Assigned | AAEL01000499:1,007..1,369(+) | AAEL01000499:1007..1369(+) | AAEL01000499 | Cryptosporidium hominis TU502 | 12 | OG6_102272 | 0 | 120 | 363 | 13611 | 10.30 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.10092ORsimilar to ash2ANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.10092 OR similar to ash2 AND Cryptosporidium hominis TU502 |
|
Chro.10129 | Chro.10129-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 324 | Chro.10129 | hypothetical protein | hypothetical protein | 3413876 | | Not Assigned | AAEL01000347:4,150..4,473(+) | AAEL01000347:4150..4473(+) | AAEL01000347 | Cryptosporidium hominis TU502 | 13 | OG6_106560 | 0 | 107 | 324 | 12896 | 8.65 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.10129ORhypothetical proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.10129 OR hypothetical protein AND Cryptosporidium hominis TU502 |
|
Chro.10131 | Chro.10131-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2841 | Chro.10131 | hypothetical protein | hypothetical protein | 3414436 | | Not Assigned | AAEL01000008:48,278..51,118(-) | AAEL01000008:48278..51118(-) | AAEL01000008 | Cryptosporidium hominis TU502 | 11 | OG6_124529 | 0 | 946 | 2841 | 108126 | 8.52 | 4 | | | | | GO:0008239;GO:0016787 | dipeptidyl-peptidase activity;hydrolase activity | | | | | | | | | | 3.1.1.- (Carboxylic ester hydrolases.) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.10131ORhypothetical proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.10131 OR hypothetical protein AND Cryptosporidium hominis TU502 |
|
Chro.10139 | Chro.10139-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1125 | Chro.10139 | UCHL5 protein | UCHL5 protein | 3414438 | | Not Assigned | AAEL01000008:38,392..39,516(+) | AAEL01000008:38392..39516(+) | AAEL01000008 | Cryptosporidium hominis TU502 | 13 | OG6_102753 | 0 | 374 | 1125 | 42442 | 4.71 | 0 | | | GO:0005622 | intracellular | GO:0004843 | thiol-dependent ubiquitin-specific protease activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.10139ORUCHL5 proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.10139 OR UCHL5 protein AND Cryptosporidium hominis TU502 |
|
Chro.10148 | Chro.10148-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1182 | Chro.10148 | hypothetical protein | hypothetical protein | 3414779 | | Not Assigned | AAEL01000008:13,084..14,265(-) | AAEL01000008:13084..14265(-) | AAEL01000008 | Cryptosporidium hominis TU502 | 18 | OG6_102579 | 0 | 393 | 1182 | 44002 | 5.69 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.10148ORhypothetical proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.10148 OR hypothetical protein AND Cryptosporidium hominis TU502 |
|
Chro.10193 | Chro.10193-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1071 | Chro.10193 | hypothetical protein | hypothetical protein | 3413241 | | Not Assigned | AAEL01000326:7,327..8,397(-) | AAEL01000326:7327..8397(-) | AAEL01000326 | Cryptosporidium hominis TU502 | 13 | OG6_158720 | 0 | 356 | 1071 | 41880 | 8.91 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.56 (Insulysin) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.10193ORhypothetical proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.10193 OR hypothetical protein AND Cryptosporidium hominis TU502 |
|
Chro.10255 | Chro.10255-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 948 | Chro.10255 | AT hook motif protein | AT hook motif protein | 3414021 | | Not Assigned | AAEL01000220:5,706..6,653(-) | AAEL01000220:5706..6653(-) | AAEL01000220 | Cryptosporidium hominis TU502 | 22 | OG6_107443 | 1 | 315 | 948 | 35673 | 8.60 | 0 | HMM: MWINKLISVILQIIIAIKLSVGR, NN: MWINKLISVILQIIIAIKLSVGR | NN Sum: 4, NN D: .75, HMM Prob: .83 | | | | | | | | | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.10255ORAT hook motif proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.10255 OR AT hook motif protein AND Cryptosporidium hominis TU502 |
|
Chro.10279 | Chro.10279-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 324 | Chro.10279 | proteasome subunit beta type 1 (20S proteasome alpha subunit F) (20S proteasome subunit beta-6) | proteasome subunit beta type 1 (20S proteasome alpha subunit F) (20S proteasome subunit beta-6) | 3414383 | | Not Assigned | AAEL01000022:33,084..33,407(+) | AAEL01000022:33084..33407(+) | AAEL01000022 | Cryptosporidium hominis TU502 | 12 | OG6_101631 | 0 | 107 | 324 | 11790 | 8.74 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.10279ORproteasome subunit beta type 1 (20S proteasome alpha subunit F) (20S proteasome subunit beta-6)ANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.10279 OR proteasome subunit beta type 1 (20S proteasome alpha subunit F) (20S proteasome subunit beta-6) AND Cryptosporidium hominis TU502 |
|
Chro.10305 | Chro.10305-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1224 | Chro.10305 | methionine aminopeptidase 1 (MetAP 1) (MAP 1) (Peptidase M 1) | methionine aminopeptidase 1 (MetAP 1) (MAP 1) (Peptidase M 1) | 3414739 | | Not Assigned | AAEL01000010:34,052..35,275(-) | AAEL01000010:34052..35275(-) | AAEL01000010 | Cryptosporidium hominis TU502 | 16 | OG6_100342 | 0 | 407 | 1224 | 45424 | 7.58 | 0 | | | | | GO:0004177;GO:0008235 | aminopeptidase activity;metalloexopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.10305ORmethionine aminopeptidase 1 (MetAP 1) (MAP 1) (Peptidase M 1)ANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.10305 OR methionine aminopeptidase 1 (MetAP 1) (MAP 1) (Peptidase M 1) AND Cryptosporidium hominis TU502 |
|
Chro.10321 | Chro.10321-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2079 | Chro.10321 | cg1 protein | cg1 protein | 3414262 | | Not Assigned | AAEL01000029:31,536..33,614(-) | AAEL01000029:31536..33614(-) | AAEL01000029 | Cryptosporidium hominis TU502 | 12 | OG6_153953 | 0 | 692 | 2079 | 80442 | 6.60 | 0 | HMM: MNFIFGAILWGLLIFPALFQKCHGN, NN: MNFIFGAILWGLLIFPALFQKCHGN | NN Sum: 4, NN D: .84, HMM Prob: .99 | | | GO:0003677 | DNA binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.10321ORcg1 proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.10321 OR cg1 protein AND Cryptosporidium hominis TU502 |
|
Chro.10416 | Chro.10416-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 2385 | Chro.10416 | aspartyl (acid) protease | aspartyl (acid) protease | 3413878 | | Not Assigned | AAEL01000346:5,498..7,882(+) | AAEL01000346:5498..7882(+) | AAEL01000346 | Cryptosporidium hominis TU502 | 11 | OG6_158722 | 0 | 794 | 2385 | 88529 | 6.36 | 1 | HMM: MNMMKILIATLGGAILFGCSFSRVEAR, NN: MNMMKILIATLGGAILFGCSFSRVEAR | NN Sum: 4, NN D: .63, HMM Prob: .99 | | | | | | | | | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.10416ORaspartyl (acid) proteaseANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.10416 OR aspartyl (acid) protease AND Cryptosporidium hominis TU502 |
|
Chro.10431 | Chro.10431-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1590 | Chro.10431 | hypothetical protein | hypothetical protein | 3413566 | | Not Assigned | AAEL01000183:179..1,768(-) | AAEL01000183:179..1768(-) | AAEL01000183 | Cryptosporidium hominis TU502 | 8 | OG6_594021 | 0 | 529 | 1590 | 60809 | 5.04 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.10431ORhypothetical proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.10431 OR hypothetical protein AND Cryptosporidium hominis TU502 |
|
Chro.20043 | Chro.20043-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 2175 | Chro.20043 | hypothetical protein | hypothetical protein | 3412720 | | Not Assigned | AAEL01000097:15,015..17,189(+) | AAEL01000097:15015..17189(+) | AAEL01000097 | Cryptosporidium hominis TU502 | 15 | OG6_101924 | 0 | 724 | 2175 | 84046 | 4.96 | 0 | | | GO:0005852 | eukaryotic translation initiation factor 3 complex | GO:0003723;GO:0003743;GO:0031369 | RNA binding;translation initiation factor activity;translation initiation factor binding | GO:0006413 | translational initiation | | | | | | | | 3.6.3.14 (Transferred entry: 7.1.2.2) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.20043ORhypothetical proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.20043 OR hypothetical protein AND Cryptosporidium hominis TU502 |
|
Chro.20061 | Chro.20061-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 609 | Chro.20061 | proteasome component | proteasome component | 3412612 | | Not Assigned | AAEL01000151:5,752..6,360(+) | AAEL01000151:5752..6360(+) | AAEL01000151 | Cryptosporidium hominis TU502 | 13 | OG6_101970 | 0 | 202 | 609 | 22401 | 6.26 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.20061ORproteasome componentANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.20061 OR proteasome component AND Cryptosporidium hominis TU502 |
|
Chro.20081 | Chro.20081-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 810 | Chro.20081 | hypothetical protein | hypothetical protein | 3412184 | | Not Assigned | AAEL01000046:26,068..26,877(-) | AAEL01000046:26068..26877(-) | AAEL01000046 | Cryptosporidium hominis TU502 | 18 | OG6_101256 | 0 | 269 | 810 | 30447 | 7.08 | 0 | | | | | | | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.20081ORhypothetical proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.20081 OR hypothetical protein AND Cryptosporidium hominis TU502 |
|
Chro.20097 | Chro.20097-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 633 | Chro.20097 | proteasome B type subunit | proteasome B type subunit | 3412182 | | Not Assigned | AAEL01000046:1,442..2,074(+) | AAEL01000046:1442..2074(+) | AAEL01000046 | Cryptosporidium hominis TU502 | 13 | OG6_101390 | 0 | 210 | 633 | 22985 | 5.33 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.20097ORproteasome B type subunitANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.20097 OR proteasome B type subunit AND Cryptosporidium hominis TU502 |
|
Chro.20103 | Chro.20103-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3081 | Chro.20103 | involved in a-factor processing | involved in a-factor processing | 3414753 | | Not Assigned | AAEL01000009:43,145..46,225(-) | AAEL01000009:43145..46225(-) | AAEL01000009 | Cryptosporidium hominis TU502 | 33 | OG6_100422 | 1 | 1026 | 3081 | 118500 | 6.71 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.56 (Insulysin) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.20103ORinvolved in a-factor processingANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.20103 OR involved in a-factor processing AND Cryptosporidium hominis TU502 |
|
Chro.20104 | Chro.20104-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3042 | Chro.20104 | ENSANGP00000016000 | ENSANGP00000016000 | 3414754 | | Not Assigned | AAEL01000009:39,678..42,719(-) | AAEL01000009:39678..42719(-) | AAEL01000009 | Cryptosporidium hominis TU502 | 33 | OG6_100422 | 1 | 1013 | 3042 | 116362 | 5.19 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.56 (Insulysin) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.20104ORENSANGP00000016000ANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.20104 OR ENSANGP00000016000 AND Cryptosporidium hominis TU502 |
|
Chro.20147 | Chro.20147-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1278 | Chro.20147 | 26S protease subunit regulatory subunit 6a | 26S protease subunit regulatory subunit 6a | 3414360 | | Not Assigned | AAEL01000024:31,293..32,570(+) | AAEL01000024:31293..32570(+) | AAEL01000024 | Cryptosporidium hominis TU502 | 13 | OG6_101915 | 0 | 425 | 1278 | 47622 | 4.92 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | | | | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.20147OR26S protease subunit regulatory subunit 6aANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.20147 OR 26S protease subunit regulatory subunit 6a AND Cryptosporidium hominis TU502 |
|
Chro.20158 | Chro.20158-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 735 | Chro.20158 | proteasome subunit alpha type 7 (Proteasome component DD5) | proteasome subunit alpha type 7 (Proteasome component DD5) | 3415131 | | Not Assigned | AAEL01000065:7,817..8,551(-) | AAEL01000065:7817..8551(-) | AAEL01000065 | Cryptosporidium hominis TU502 | 13 | OG6_101207 | 0 | 244 | 735 | 26894 | 6.04 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.20158ORproteasome subunit alpha type 7 (Proteasome component DD5)ANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.20158 OR proteasome subunit alpha type 7 (Proteasome component DD5) AND Cryptosporidium hominis TU502 |
|
Chro.20222 | Chro.20222-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 780 | Chro.20222 | proteasome A type subunit | proteasome A type subunit | 3414794 | | Not Assigned | AAEL01000248:1,957..2,736(+) | AAEL01000248:1957..2736(+) | AAEL01000248 | Cryptosporidium hominis TU502 | 13 | OG6_102143 | 0 | 259 | 780 | 29293 | 5.18 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.20222ORproteasome A type subunitANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.20222 OR proteasome A type subunit AND Cryptosporidium hominis TU502 |
|
Chro.20263 | Chro.20263-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1419 | Chro.20263 | methionine aminopeptidase, type II | methionine aminopeptidase, type II | 3413259 | | Not Assigned | AAEL01000321:5,819..7,237(-) | AAEL01000321:5819..7237(-) | AAEL01000321 | Cryptosporidium hominis TU502 | 13 | OG6_100815 | 0 | 472 | 1419 | 53665 | 6.28 | 0 | | | | | GO:0004177;GO:0008235 | aminopeptidase activity;metalloexopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.20263ORmethionine aminopeptidase, type IIANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.20263 OR methionine aminopeptidase, type II AND Cryptosporidium hominis TU502 |
|
Chro.20292 | Chro.20292-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 2046 | Chro.20292 | hypothetical protein | hypothetical protein | 3412797 | | Not Assigned | AAEL01000126:14,758..16,803(+) | AAEL01000126:14758..16803(+) | AAEL01000126 | Cryptosporidium hominis TU502 | 14 | OG6_110270 | 0 | 681 | 2046 | 77976 | 4.62 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.20292ORhypothetical proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.20292 OR hypothetical protein AND Cryptosporidium hominis TU502 |
|
Chro.20348 | Chro.20348-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2475 | Chro.20348 | P3ECSL-related | P3ECSL-related | 3412465 | | Not Assigned | AAEL01000038:17,061..19,535(-) | AAEL01000038:17061..19535(-) | AAEL01000038 | Cryptosporidium hominis TU502 | 15 | OG6_148524 | 0 | 824 | 2475 | 95773 | 5.60 | 0 | HMM: MGRFKSRFHISLRRKWTLFCWFFSILIREISSD, NN: MGRFKSRFHISLRRKWTLFCWFFSILIREISSD | NN Sum: 4, NN D: .79, HMM Prob: .89 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.14.1 (Dipeptidyl-peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.20348ORP3ECSL-relatedANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.20348 OR P3ECSL-related AND Cryptosporidium hominis TU502 |
|
Chro.20366 | Chro.20366-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1149 | Chro.20366 | ubiquitin specific protease 66 | ubiquitin specific protease 66 | 3412190 | | Not Assigned | AAEL01000045:20,644..21,792(-) | AAEL01000045:20644..21792(-) | AAEL01000045 | Cryptosporidium hominis TU502 | 15 | OG6_101021 | 0 | 382 | 1149 | 43189 | 6.41 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.20366ORubiquitin specific protease 66ANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.20366 OR ubiquitin specific protease 66 AND Cryptosporidium hominis TU502 |
|
Chro.20391 | Chro.20391-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 204 | Chro.20391 | hypothetical protein | hypothetical protein | 3412518 | | Not Assigned | AAEL01000106:10,785..10,988(-) | AAEL01000106:10785..10988(-) | AAEL01000106 | Cryptosporidium hominis TU502 | 12 | OG6_121085 | 0 | 67 | 204 | 7617 | 5.79 | 0 | | | | | | | | | | | | | | | | 3.4.21.62 (Subtilisin) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.20391ORhypothetical proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.20391 OR hypothetical protein AND Cryptosporidium hominis TU502 |
|
Chro.20459 | Chro.20459-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3741 | Chro.20459 | hypothetical protein | hypothetical protein | 3413895 | | Not Assigned | AAEL01000341:1,078..4,818(-) | AAEL01000341:1078..4818(-) | AAEL01000341 | Cryptosporidium hominis TU502 | 10 | OG6_174421 | 0 | 1246 | 3741 | 139525 | 5.61 | 1 | HMM: MHIKKVNPWFAVILCISLLNGI, NN: MHIKKVNPWFAVILCISLLNGI | NN Sum: 4, NN D: .73, HMM Prob: .84 | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.56 (Insulysin) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.20459ORhypothetical proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.20459 OR hypothetical protein AND Cryptosporidium hominis TU502 |
|
Chro.30077 | Chro.30077-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3519 | Chro.30077 | hypothetical protein | hypothetical protein | 3415552 | | Not Assigned | AAEL01000053:9,837..13,355(-) | AAEL01000053:9837..13355(-) | AAEL01000053 | Cryptosporidium hominis TU502 | 13 | OG6_113142 | 0 | 1172 | 3519 | 134059 | 9.21 | 4 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.30077ORhypothetical proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.30077 OR hypothetical protein AND Cryptosporidium hominis TU502 |
|
Chro.30101 | Chro.30101-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1260 | Chro.30101 | RIKEN cDNA 1110065L07 | RIKEN cDNA 1110065L07 | 3413825 | | Not Assigned | AAEL01000362:402..1,661(+) | AAEL01000362:402..1661(+) | AAEL01000362 | Cryptosporidium hominis TU502 | 13 | OG6_101827 | 0 | 419 | 1260 | 48211 | 9.28 | 1 | | | | | | | | | | | | | | | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.30101ORRIKEN cDNA 1110065L07ANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.30101 OR RIKEN cDNA 1110065L07 AND Cryptosporidium hominis TU502 |
|
Chro.30106 | Chro.30106-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 885 | Chro.30106 | hypothetical protein | hypothetical protein | 3415227 | | Not Assigned | AAEL01000693:90..974(+) | AAEL01000693:90..974(+) | AAEL01000693 | Cryptosporidium hominis TU502 | 12 | OG6_102905 | 0 | 294 | 885 | 34465 | 8.46 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.30106ORhypothetical proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.30106 OR hypothetical protein AND Cryptosporidium hominis TU502 |
|
Chro.30129 | Chro.30129-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 252 | Chro.30129 | hypothetical protein | hypothetical protein | 3415823 | | Not Assigned | AAEL01000291:4,637..4,888(-) | AAEL01000291:4637..4888(-) | AAEL01000291 | Cryptosporidium hominis TU502 | 28 | OG6_100562 | 2 | 83 | 252 | 9060 | 8.51 | 2 | | | | | | | | | | | | | | | | 3.4.21.- (Serine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.30129ORhypothetical proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.30129 OR hypothetical protein AND Cryptosporidium hominis TU502 |
|
Chro.30253 | Chro.30253-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 540 | Chro.30253 | DKFZP547N043 protein | DKFZP547N043 protein | 3413524 | | Not Assigned | AAEL01000001:73,812..74,351(+) | AAEL01000001:73812..74351(+) | AAEL01000001 | Cryptosporidium hominis TU502 | 12 | OG6_104384 | 0 | 179 | 540 | 21021 | 8.39 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.30253ORDKFZP547N043 proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.30253 OR DKFZP547N043 protein AND Cryptosporidium hominis TU502 |
|
Chro.30254 | Chro.30254-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 300 | Chro.30254 | 20S proteasome subunit PAA1 | 20S proteasome subunit PAA1 | 3414785 | | Not Assigned | AAEL01000001:74,618..74,917(+) | AAEL01000001:74618..74917(+) | AAEL01000001 | Cryptosporidium hominis TU502 | 13 | OG6_102240 | 1 | 99 | 300 | 11117 | 9.99 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.30254OR20S proteasome subunit PAA1ANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.30254 OR 20S proteasome subunit PAA1 AND Cryptosporidium hominis TU502 |
|
Chro.30255 | Chro.30255-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 351 | Chro.30255 | proteasome subunit alpha type 6 (20S proteasome alpha subunit A) (20S proteasome subunit alpha-1) (Proteasome iota subunit) | proteasome subunit alpha type 6 (20S proteasome alpha subunit A) (20S proteasome subunit alpha-1) (Proteasome iota subunit) | 3413525 | | Not Assigned | AAEL01000001:75,087..75,437(+) | AAEL01000001:75087..75437(+) | AAEL01000001 | Cryptosporidium hominis TU502 | 13 | OG6_102240 | 1 | 116 | 351 | 12843 | 4.07 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.30255ORproteasome subunit alpha type 6 (20S proteasome alpha subunit A) (20S proteasome subunit alpha-1) (Proteasome iota subunit)ANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.30255 OR proteasome subunit alpha type 6 (20S proteasome alpha subunit A) (20S proteasome subunit alpha-1) (Proteasome iota subunit) AND Cryptosporidium hominis TU502 |
|
Chro.30259 | Chro.30259-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1155 | Chro.30259 | hypothetical protein | hypothetical protein | 3413713 | | Not Assigned | AAEL01000076:11,822..12,976(+) | AAEL01000076:11822..12976(+) | AAEL01000076 | Cryptosporidium hominis TU502 | 15 | OG6_101685 | 0 | 384 | 1155 | 43409 | 4.47 | 0 | | | | | GO:0004190;GO:0005515 | aspartic-type endopeptidase activity;protein binding | GO:0006508 | proteolysis | | | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.30259ORhypothetical proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.30259 OR hypothetical protein AND Cryptosporidium hominis TU502 |
|
Chro.30260 | Chro.30260-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 756 | Chro.30260 | proteasome subunit alpha type 3 | proteasome subunit alpha type 3 | 3413710 | | Not Assigned | AAEL01000076:10,851..11,606(+) | AAEL01000076:10851..11606(+) | AAEL01000076 | Cryptosporidium hominis TU502 | 13 | OG6_102011 | 0 | 251 | 756 | 27668 | 4.97 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.30260ORproteasome subunit alpha type 3ANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.30260 OR proteasome subunit alpha type 3 AND Cryptosporidium hominis TU502 |
|
Chro.30278 | Chro.30278-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1146 | Chro.30278 | nuclear DNA-binding protein G2p -related | nuclear DNA-binding protein G2p -related | 3414976 | | Not Assigned | AAEL01000171:6,380..7,525(+) | AAEL01000171:6380..7525(+) | AAEL01000171 | Cryptosporidium hominis TU502 | 11 | OG6_101895 | 0 | 381 | 1146 | 42338 | 6.38 | 0 | | | | | | | | | | | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.30278ORnuclear DNA-binding protein G2p -relatedANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.30278 OR nuclear DNA-binding protein G2p -related AND Cryptosporidium hominis TU502 |
|
Chro.30293 | Chro.30293-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 840 | Chro.30293 | proteasome component precursor | proteasome component precursor | 3415352 | | Not Assigned | AAEL01000068:8,658..9,497(-) | AAEL01000068:8658..9497(-) | AAEL01000068 | Cryptosporidium hominis TU502 | 13 | OG6_101382 | 0 | 279 | 840 | 30318 | 5.34 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.30293ORproteasome component precursorANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.30293 OR proteasome component precursor AND Cryptosporidium hominis TU502 |
|
Chro.30306 | Chro.30306-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 521 | Chro.30306 | hypothetical protein | hypothetical protein | 3414659 | | Not Assigned | AAEL01001198:363..883(+) | AAEL01001198:363..883(+) | AAEL01001198 | Cryptosporidium hominis TU502 | 12 | OG6_102447 | 0 | 173 | 521 | 19982 | 9.62 | 1 | HMM: MDSLFSRINIIFCSFIISLACCAVGN, NN: MDSLFSRINIIFCSFIISLAC | NN Sum: 4, NN D: .61, HMM Prob: .52 | GO:0016021;GO:0005787 | integral component of membrane;signal peptidase complex | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.30306ORhypothetical proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.30306 OR hypothetical protein AND Cryptosporidium hominis TU502 |
|
Chro.30331 | Chro.30331-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 783 | Chro.30331 | hypothetical protein | hypothetical protein | 3412620 | | Not Assigned | AAEL01000150:11,129..11,911(+) | AAEL01000150:11129..11911(+) | AAEL01000150 | Cryptosporidium hominis TU502 | 14 | OG6_100501 | 0 | 260 | 783 | 29381 | 5.67 | 0 | | | | | | | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.30331ORhypothetical proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.30331 OR hypothetical protein AND Cryptosporidium hominis TU502 |
|
Chro.30369 | Chro.30369-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 660 | Chro.30369 | hypothetical protein | hypothetical protein | 3413026 | | Not Assigned | AAEL01000888:379..1,038(+) | AAEL01000888:379..1038(+) | AAEL01000888 | Cryptosporidium hominis TU502 | 10 | OG6_104922 | 0 | 219 | 660 | 25018 | 8.29 | 0 | | | | | GO:0008270 | zinc ion binding | | | | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.30369ORhypothetical proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.30369 OR hypothetical protein AND Cryptosporidium hominis TU502 |
|
Chro.30408 | Chro.30408-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1398 | Chro.30408 | hypothetical protein | hypothetical protein | 3414799 | | Not Assigned | AAEL01000246:1,932..3,329(-) | AAEL01000246:1932..3329(-) | AAEL01000246 | Cryptosporidium hominis TU502 | 13 | OG6_102047 | 0 | 465 | 1398 | 52151 | 6.10 | 0 | | | | | GO:0004177;GO:0008270 | aminopeptidase activity;zinc ion binding | GO:0006508 | proteolysis | | | | | | | | 3.4.11.21 (Aspartyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.30408ORhypothetical proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.30408 OR hypothetical protein AND Cryptosporidium hominis TU502 |
|
Chro.30468 | Chro.30468-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1011 | Chro.30468 | insulin degrading enzyme | insulin degrading enzyme | 3413990 | | Not Assigned | AAEL01000226:1,377..2,387(-) | AAEL01000226:1377..2387(-) | AAEL01000226 | Cryptosporidium hominis TU502 | 8 | OG6_593598 | 0 | 336 | 1011 | 39548 | 9.92 | 0 | HMM: MFISLKFLFLFGLVYLLPLNFNYYNSE, NN: MFISLKFLFLFGLVYLL | NN Sum: 4, NN D: .77, HMM Prob: .55 | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.56 (Insulysin) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.30468ORinsulin degrading enzymeANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.30468 OR insulin degrading enzyme AND Cryptosporidium hominis TU502 |
|
Chro.30469 | Chro.30469-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3381 | Chro.30469 | integral membrane protein | integral membrane protein | 3413991 | | Not Assigned | AAEL01000226:2,739..6,119(-) | AAEL01000226:2739..6119(-) | AAEL01000226 | Cryptosporidium hominis TU502 | 8 | OG6_593860 | 0 | 1126 | 3381 | 129052 | 5.93 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.56 (Insulysin) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.30469ORintegral membrane proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.30469 OR integral membrane protein AND Cryptosporidium hominis TU502 |
|
Chro.30470 | Chro.30470-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3258 | Chro.30470 | hypothetical protein | hypothetical protein | 3413988 | | Not Assigned | AAEL01000226:7,139..10,396(-) | AAEL01000226:7139..10396(-) | AAEL01000226 | Cryptosporidium hominis TU502 | 8 | OG6_593997 | 0 | 1085 | 3258 | 123534 | 7.70 | 0 | HMM: MFRLISLISVACLFLLNENLISSY, NN: MFRLISLISVACLFLLNENLISS | NN Sum: 3, NN D: .57, HMM Prob: .98 | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.30470ORhypothetical proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.30470 OR hypothetical protein AND Cryptosporidium hominis TU502 |
|
Chro.30474 | Chro.30474-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 3765 | Chro.30474 | peptidase, M16 family | peptidase, M16 family | 3415775 | | Not Assigned | AAEL01000304:4,920..8,684(+) | AAEL01000304:4920..8684(+) | AAEL01000304 | Cryptosporidium hominis TU502 | 30 | OG6_174425 | 3 | 1254 | 3765 | 144841 | 7.04 | 0 | HMM: MTSKIFLFGLLVQLSLSLERCLAS, NN: MTSKIFLFGLLVQLSLSLERCLAS | NN Sum: 4, NN D: .83, HMM Prob: 1 | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.56 (Insulysin) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.30474ORpeptidase, M16 familyANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.30474 OR peptidase, M16 family AND Cryptosporidium hominis TU502 |
|
Chro.30475 | Chro.30475-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 3828 | Chro.30475 | peptidase, insulinase family | peptidase, insulinase family | 3415774 | | Not Assigned | AAEL01000304:429..4,256(+) | AAEL01000304:429..4256(+) | AAEL01000304 | Cryptosporidium hominis TU502 | 30 | OG6_174425 | 3 | 1275 | 3828 | 148239 | 6.80 | 1 | HMM: MLINCKHFKLLKMDGLLCLLFVIFIFAQYLNFASCF, NN: MLINCKHFKLLKMDGLLCLLFVIFIFAQ | NN Sum: 4, NN D: .72, HMM Prob: .47 | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.56 (Insulysin) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.30475ORpeptidase, insulinase familyANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.30475 OR peptidase, insulinase family AND Cryptosporidium hominis TU502 |
|
Chro.30478 | Chro.30478-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2076 | Chro.30478 | hypothetical protein | hypothetical protein | 3415900 | | Not Assigned | AAEL01000610:1,005..3,080(-) | AAEL01000610:1005..3080(-) | AAEL01000610 | Cryptosporidium hominis TU502 | 8 | OG6_592994 | 0 | 691 | 2076 | 80734 | 10.20 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.56 (Insulysin) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.30478ORhypothetical proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.30478 OR hypothetical protein AND Cryptosporidium hominis TU502 |
|
Chro.30479 | Chro.30479-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1611 | Chro.30479 | zinc protease | zinc protease | 3413053 | | Not Assigned | AAEL01000600:373..1,983(+) | AAEL01000600:373..1983(+) | AAEL01000600 | Cryptosporidium hominis TU502 | 24 | OG6_201693 | 1 | 536 | 1611 | 62174 | 4.65 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.56 (Insulysin) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.30479ORzinc proteaseANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.30479 OR zinc protease AND Cryptosporidium hominis TU502 |
|
Chro.30482 | Chro.30482-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 918 | Chro.30482 | hypothetical protein | hypothetical protein | 3415280 | | Not Assigned | AAEL01000649:1,822..2,739(-) | AAEL01000649:1822..2739(-) | AAEL01000649 | Cryptosporidium hominis TU502 | 8 | OG6_593571 | 1 | 305 | 918 | 35329 | 9.45 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.56 (Insulysin) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.30482ORhypothetical proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.30482 OR hypothetical protein AND Cryptosporidium hominis TU502 |
|
Chro.40035 | Chro.40035-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 456 | Chro.40035 | ubiquitin-conjugating enzyme | ubiquitin-conjugating enzyme | 3412868 | | Not Assigned | AAEL01000271:6,821..7,276(+) | AAEL01000271:6821..7276(+) | AAEL01000271 | Cryptosporidium hominis TU502 | 15 | OG6_103192 | 0 | 151 | 456 | 17387 | 4.55 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 6.3.2.19 (Transferred entry: 2.3.2.23, 2.3.2.27 and 6.2.1.45) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.40035ORubiquitin-conjugating enzymeANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.40035 OR ubiquitin-conjugating enzyme AND Cryptosporidium hominis TU502 |
|
Chro.40039 | Chro.40039-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 786 | Chro.40039 | proteasome subunit | proteasome subunit | 3415864 | | Not Assigned | AAEL01000642:1,815..2,600(+) | AAEL01000642:1815..2600(+) | AAEL01000642 | Cryptosporidium hominis TU502 | 13 | OG6_101968 | 0 | 261 | 786 | 29072 | 5.02 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.40039ORproteasome subunitANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.40039 OR proteasome subunit AND Cryptosporidium hominis TU502 |
|
Chro.40069 | Chro.40069-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1152 | Chro.40069 | 26S proteasome regulatory subunit S5A | 26S proteasome regulatory subunit S5A | 3415167 | | Not Assigned | AAEL01000062:12,137..13,288(-) | AAEL01000062:12137..13288(-) | AAEL01000062 | Cryptosporidium hominis TU502 | 14 | OG6_102002 | 0 | 383 | 1152 | 41502 | 4.31 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.40069OR26S proteasome regulatory subunit S5AANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.40069 OR 26S proteasome regulatory subunit S5A AND Cryptosporidium hominis TU502 |
|
Chro.40078 | Chro.40078-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 300 | Chro.40078 | hypothetical protein | hypothetical protein | 3412322 | | Not Assigned | AAEL01000835:440..739(+) | AAEL01000835:440..739(+) | AAEL01000835 | Cryptosporidium hominis TU502 | 17 | OG6_100609 | 0 | 99 | 300 | 11303 | 10.33 | 0 | | | | | | | | | | | | | | | | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.40078ORhypothetical proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.40078 OR hypothetical protein AND Cryptosporidium hominis TU502 |
|
Chro.40138 | Chro.40138-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1338 | Chro.40138 | 26S proteasome AAA-ATPase subunit RPT2a | 26S proteasome AAA-ATPase subunit RPT2a | 3413169 | | Not Assigned | AAEL01000424:1,366..2,703(-) | AAEL01000424:1366..2703(-) | AAEL01000424 | Cryptosporidium hominis TU502 | 13 | OG6_101477 | 0 | 445 | 1338 | 49645 | 6.44 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | | | | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.40138OR26S proteasome AAA-ATPase subunit RPT2aANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.40138 OR 26S proteasome AAA-ATPase subunit RPT2a AND Cryptosporidium hominis TU502 |
|
Chro.40151 | Chro.40151-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 2406 | Chro.40151 | hypothetical protein | hypothetical protein | 3415831 | | Not Assigned | AAEL01000288:319..2,724(+) | AAEL01000288:319..2724(+) | AAEL01000288 | Cryptosporidium hominis TU502 | 18 | OG6_102131 | 0 | 801 | 2406 | 91361 | 9.12 | 3 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.40151ORhypothetical proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.40151 OR hypothetical protein AND Cryptosporidium hominis TU502 |
|
Chro.40175 | Chro.40175-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 750 | Chro.40175 | hypothetical protein | hypothetical protein | 3412320 | | Not Assigned | AAEL01000837:302..1,051(+) | AAEL01000837:302..1051(+) | AAEL01000837 | Cryptosporidium hominis TU502 | 30 | OG6_100915 | 1 | 249 | 750 | 28988 | 6.84 | 0 | | | | | | | | | | | | | | | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.40175ORhypothetical proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.40175 OR hypothetical protein AND Cryptosporidium hominis TU502 |
|
Chro.40239 | Chro.40239-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1908 | Chro.40239 | preprocathepsin c precursor | preprocathepsin c precursor | 3415686 | | Not Assigned | AAEL01000090:8,859..10,766(-) | AAEL01000090:8859..10766(-) | AAEL01000090 | Cryptosporidium hominis TU502 | 15 | OG6_103622 | 0 | 635 | 1908 | 72129 | 5.04 | 0 | HMM: MFKSLGKTILLAFFYIVFVKCD, NN: MFKSLGKTILLAFFYIVFVKCD | NN Sum: 4, NN D: .79, HMM Prob: .65 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.14.1 (Dipeptidyl-peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.40239ORpreprocathepsin c precursorANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.40239 OR preprocathepsin c precursor AND Cryptosporidium hominis TU502 |
|
Chro.40249 | Chro.40249-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1653 | Chro.40249 | hypothetical protein | hypothetical protein | 3412673 | | Not Assigned | AAEL01000337:273..1,925(-) | AAEL01000337:273..1925(-) | AAEL01000337 | Cryptosporidium hominis TU502 | 22 | OG6_107443 | 1 | 550 | 1653 | 63486 | 9.59 | 1 | HMM: MNLLIFLITTLFAIIKGK, NN: MNLLIFLITTLFAIIKGK | NN Sum: 4, NN D: .83, HMM Prob: .98 | | | | | | | | | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.40249ORhypothetical proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.40249 OR hypothetical protein AND Cryptosporidium hominis TU502 |
|
Chro.40284 | Chro.40284-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1206 | Chro.40284 | 26S proteasome AAA-ATPase subunit RPT3 | 26S proteasome AAA-ATPase subunit RPT3 | 3415493 | | Not Assigned | AAEL01000058:20,709..21,914(-) | AAEL01000058:20709..21914(-) | AAEL01000058 | Cryptosporidium hominis TU502 | 14 | OG6_101965 | 0 | 401 | 1206 | 45405 | 5.40 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | | | | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.40284OR26S proteasome AAA-ATPase subunit RPT3ANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.40284 OR 26S proteasome AAA-ATPase subunit RPT3 AND Cryptosporidium hominis TU502 |
|
Chro.40329 | Chro.40329-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 798 | Chro.40329 | hypothetical protein | hypothetical protein | 3415239 | | Not Assigned | AAEL01000680:1,058..1,855(-) | AAEL01000680:1058..1855(-) | AAEL01000680 | Cryptosporidium hominis TU502 | 129 | OG6_100178 | 6 | 265 | 798 | 31289 | 4.67 | 0 | | | | | | | | | | | | | | | | 2.3.1.39 ([Acyl-carrier-protein] S-malonyltransferase) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.40329ORhypothetical proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.40329 OR hypothetical protein AND Cryptosporidium hominis TU502 |
|
Chro.40331 | Chro.40331-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 2052 | Chro.40331 | aminopeptidase | aminopeptidase | 3413571 | | Not Assigned | AAEL01000182:10,620..12,671(+) | AAEL01000182:10620..12671(+) | AAEL01000182 | Cryptosporidium hominis TU502 | 14 | OG6_100896 | 0 | 683 | 2052 | 78183 | 5.98 | 0 | | | | | GO:0016787 | hydrolase activity | | | | | | | | | | 3.4.11.9 (Xaa-Pro aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.40331ORaminopeptidaseANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.40331 OR aminopeptidase AND Cryptosporidium hominis TU502 |
|
Chro.40469 | Chro.40469-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1623 | Chro.40469 | hypothetical protein | hypothetical protein | 3412348 | | Not Assigned | AAEL01000805:240..1,862(+) | AAEL01000805:240..1862(+) | AAEL01000805 | Cryptosporidium hominis TU502 | 14 | OG6_119794 | 0 | 540 | 1623 | 60159 | 5.34 | 0 | | | | | | | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.40469ORhypothetical proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.40469 OR hypothetical protein AND Cryptosporidium hominis TU502 |
|
Chro.40483 | Chro.40483-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1575 | Chro.40483 | hypothetical protein | hypothetical protein | 3412395 | | Not Assigned | AAEL01000757:354..1,928(+) | AAEL01000757:354..1928(+) | AAEL01000757 | Cryptosporidium hominis TU502 | 8 | OG6_593355 | 0 | 524 | 1575 | 61334 | 8.77 | 1 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.40483ORhypothetical proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.40483 OR hypothetical protein AND Cryptosporidium hominis TU502 |
|
Chro.40501 | Chro.40501-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 465 | Chro.40501 | hypothetical protein | hypothetical protein | 3412156 | | Not Assigned | AAEL01000486:3,885..4,349(+) | AAEL01000486:3885..4349(+) | AAEL01000486 | Cryptosporidium hominis TU502 | 16 | OG6_102788 | 1 | 154 | 465 | 17782 | 9.59 | 0 | | | | | | | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.40501ORhypothetical proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.40501 OR hypothetical protein AND Cryptosporidium hominis TU502 |
|
Chro.40502 | Chro.40502-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 164 | Chro.40502 | hypothetical protein | hypothetical protein | 3412154 | | Not Assigned | AAEL01000486:4,659..4,822(+) | AAEL01000486:4659..4822(+) | AAEL01000486 | Cryptosporidium hominis TU502 | 16 | OG6_102788 | 1 | 54 | 164 | 6093 | 3.77 | 0 | | | | | | | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.40502ORhypothetical proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.40502 OR hypothetical protein AND Cryptosporidium hominis TU502 |
|
Chro.50031 | Chro.50031-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1128 | Chro.50031 | mitochondrial processing peptidase beta subunit | mitochondrial processing peptidase beta subunit | 3412591 | | Not Assigned | AAEL01000155:13,753..14,880(+) | AAEL01000155:13753..14880(+) | AAEL01000155 | Cryptosporidium hominis TU502 | 13 | OG6_100777 | 1 | 375 | 1128 | 42940 | 8.97 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.50031ORmitochondrial processing peptidase beta subunitANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.50031 OR mitochondrial processing peptidase beta subunit AND Cryptosporidium hominis TU502 |
|
Chro.50040 | Chro.50040-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 633 | Chro.50040 | similar to XM_028438 CGI-101 | similar to XM_028438 CGI-101 | 3413235 | | Not Assigned | AAEL01000328:5,909..6,541(+) | AAEL01000328:5909..6541(+) | AAEL01000328 | Cryptosporidium hominis TU502 | 14 | OG6_101672 | 0 | 210 | 633 | 24731 | 8.82 | 5 | HMM: MLVVNNIPPVTKVYFAISTLLMVLCTLDIISPF, NN: MLVVNNIPPVTKVYFAISTLLMVLCTLDIISPF | NN Sum: 2, NN D: .52, HMM Prob: .23 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.50040ORsimilar to XM_028438 CGI-101ANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.50040 OR similar to XM_028438 CGI-101 AND Cryptosporidium hominis TU502 |
|
Chro.50050 | Chro.50050-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 840 | Chro.50050 | beta tubulin | beta tubulin | 3412060 | | Not Assigned | AAEL01000450:4,053..4,892(-) | AAEL01000450:4053..4892(-) | AAEL01000450 | Cryptosporidium hominis TU502 | 13 | OG6_101718 | 0 | 279 | 840 | 31938 | 5.54 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.50050ORbeta tubulinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.50050 OR beta tubulin AND Cryptosporidium hominis TU502 |
|
Chro.50094 | Chro.50094-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 579 | Chro.50094 | hypothetical protein | hypothetical protein | 3412025 | | Not Assigned | AAEL01000464:4,360..4,938(-) | AAEL01000464:4360..4938(-) | AAEL01000464 | Cryptosporidium hominis TU502 | 13 | OG6_101235 | 0 | 192 | 579 | 22798 | 7.27 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.68 (Ulp1 peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.50094ORhypothetical proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.50094 OR hypothetical protein AND Cryptosporidium hominis TU502 |
|
Chro.50111 | Chro.50111-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 3819 | Chro.50111 | hypothetical protein | hypothetical protein | 3412278 | | Not Assigned | AAEL01000032:18,271..22,089(+) | AAEL01000032:18271..22089(+) | AAEL01000032 | Cryptosporidium hominis TU502 | 10 | OG6_593102 | 0 | 1272 | 3819 | 147632 | 8.96 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.50111ORhypothetical proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.50111 OR hypothetical protein AND Cryptosporidium hominis TU502 |
|
Chro.50116 | Chro.50116-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1575 | Chro.50116 | leucine aminopeptidase | leucine aminopeptidase | 3412281 | | Not Assigned | AAEL01000032:6,014..7,588(-) | AAEL01000032:6014..7588(-) | AAEL01000032 | Cryptosporidium hominis TU502 | 15 | OG6_100682 | 0 | 524 | 1575 | 58041 | 6.14 | 0 | | | GO:0005622 | intracellular | GO:0004177 | aminopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.11.1 (Leucyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.50116ORleucine aminopeptidaseANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.50116 OR leucine aminopeptidase AND Cryptosporidium hominis TU502 |
|
Chro.50128 | Chro.50128-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 2577 | Chro.50128 | USP31 protein | USP31 protein | 3415335 | | Not Assigned | AAEL01000070:16,592..19,168(+) | AAEL01000070:16592..19168(+) | AAEL01000070 | Cryptosporidium hominis TU502 | 14 | OG6_104835 | 0 | 858 | 2577 | 96387 | 7.96 | 0 | | | | | | | | | | | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.50128ORUSP31 proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.50128 OR USP31 protein AND Cryptosporidium hominis TU502 |
|
Chro.50137 | Chro.50137-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1851 | Chro.50137 | hypothetical protein | hypothetical protein | 3412856 | | Not Assigned | AAEL01000275:5,392..7,242(-) | AAEL01000275:5392..7242(-) | AAEL01000275 | Cryptosporidium hominis TU502 | 8 | OG6_109557 | 0 | 616 | 1851 | 71853 | 8.19 | 1 | HMM: MKSRQINDLNLMDCWPNDIIYFVRILLLLRGICAE, NN: MKSRQINDLNLMDCWPNDIIYFVRILLLLRGICAE | NN Sum: 3, NN D: .56, HMM Prob: .01 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.50137ORhypothetical proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.50137 OR hypothetical protein AND Cryptosporidium hominis TU502 |
|
Chro.50138 | Chro.50138-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 969 | Chro.50138 | hypothetical protein | hypothetical protein | 3412855 | | Not Assigned | AAEL01000275:7,603..8,571(-) | AAEL01000275:7603..8571(-) | AAEL01000275 | Cryptosporidium hominis TU502 | 10 | OG6_112296 | 0 | 322 | 969 | 38569 | 7.02 | 0 | | | | | GO:0005524;GO:0004672 | ATP binding;protein kinase activity | GO:0006468 | protein phosphorylation | | | | | | | | 1.14.13.- (With NADH or NADPH as one donor, and incorporation of one atom of oxygen.) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.50138ORhypothetical proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.50138 OR hypothetical protein AND Cryptosporidium hominis TU502 |
|
Chro.50142 | Chro.50142-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 714 | Chro.50142 | proteasome (prosome, macropain) 26S subunit, non-ATPase, 9 | proteasome (prosome, macropain) 26S subunit, non-ATPase, 9 | 3414964 | | Not Assigned | AAEL01000134:12,190..12,903(+) | AAEL01000134:12190..12903(+) | AAEL01000134 | Cryptosporidium hominis TU502 | 13 | OG6_102356 | 0 | 237 | 714 | 26993 | 5.12 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.50142ORproteasome (prosome, macropain) 26S subunit, non-ATPase, 9ANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.50142 OR proteasome (prosome, macropain) 26S subunit, non-ATPase, 9 AND Cryptosporidium hominis TU502 |
|
Chro.50143 | Chro.50143-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1278 | Chro.50143 | hypothetical protein | hypothetical protein | 3412743 | | Not Assigned | AAEL01000134:10,325..11,602(+) | AAEL01000134:10325..11602(+) | AAEL01000134 | Cryptosporidium hominis TU502 | 13 | OG6_102786 | 0 | 425 | 1278 | 48595 | 8.77 | 0 | | | | | GO:0036459;GO:0008270 | thiol-dependent ubiquitinyl hydrolase activity;zinc ion binding | GO:0016579 | protein deubiquitination | | | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.50143ORhypothetical proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.50143 OR hypothetical protein AND Cryptosporidium hominis TU502 |
|
Chro.50180 | Chro.50180-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2334 | Chro.50180 | hypothetical protein | hypothetical protein | 3413419 | | Not Assigned | AAEL01000019:8,219..10,552(-) | AAEL01000019:8219..10552(-) | AAEL01000019 | Cryptosporidium hominis TU502 | 14 | OG6_106179 | 1 | 777 | 2334 | 90897 | 6.67 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.50180ORhypothetical proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.50180 OR hypothetical protein AND Cryptosporidium hominis TU502 |
|
Chro.50181 | Chro.50181-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 588 | Chro.50181 | hypothetical protein | hypothetical protein | 3413424 | | Not Assigned | AAEL01000019:7,428..8,015(-) | AAEL01000019:7428..8015(-) | AAEL01000019 | Cryptosporidium hominis TU502 | 14 | OG6_106179 | 1 | 195 | 588 | 23202 | 5.29 | 2 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.50181ORhypothetical proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.50181 OR hypothetical protein AND Cryptosporidium hominis TU502 |
|
Chro.50185 | Chro.50185-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 879 | Chro.50185 | hypothetical protein | hypothetical protein | 3413432 | | Not Assigned | AAEL01000019:1,402..2,280(+) | AAEL01000019:1402..2280(+) | AAEL01000019 | Cryptosporidium hominis TU502 | 12 | OG6_158735 | 0 | 292 | 879 | 33664 | 7.73 | 5 | HMM: MISFIFKNKQFVKIVIIALLPCLNALFWLFFISNGWLA, NN: MISFIFKNKQFVKIVIIALLPCLNALFWLFFISNGWLAM | NN Sum: 4, NN D: .57, HMM Prob: .47 | GO:0016020 | membrane | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.50185ORhypothetical proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.50185 OR hypothetical protein AND Cryptosporidium hominis TU502 |
|
Chro.50200 | Chro.50200-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 567 | Chro.50200 | proteasome subunit alpha type 5 | proteasome subunit alpha type 5 | 3414202 | | Not Assigned | AAEL01000013:24,491..25,057(+) | AAEL01000013:24491..25057(+) | AAEL01000013 | Cryptosporidium hominis TU502 | 13 | OG6_101621 | 0 | 188 | 567 | 20737 | 4.73 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.50200ORproteasome subunit alpha type 5ANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.50200 OR proteasome subunit alpha type 5 AND Cryptosporidium hominis TU502 |
|
Chro.50218 | Chro.50218-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 558 | Chro.50218 | CG1349 gene product | CG1349 gene product | 3413595 | | Not Assigned | AAEL01000179:9,592..10,149(-) | AAEL01000179:9592..10149(-) | AAEL01000179 | Cryptosporidium hominis TU502 | 14 | OG6_101257 | 0 | 185 | 558 | 19563 | 4.71 | 0 | | | | | | | | | | | | | | | | 2.7.1.50 (Hydroxyethylthiazole kinase) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.50218ORCG1349 gene productANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.50218 OR CG1349 gene product AND Cryptosporidium hominis TU502 |
|
Chro.50269 | Chro.50269-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1290 | Chro.50269 | hypothetical protein | hypothetical protein | 3414467 | | Not Assigned | AAEL01000007:9,587..10,876(-) | AAEL01000007:9587..10876(-) | AAEL01000007 | Cryptosporidium hominis TU502 | 11 | OG6_134110 | 0 | 429 | 1290 | 48768 | 5.05 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.50269ORhypothetical proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.50269 OR hypothetical protein AND Cryptosporidium hominis TU502 |
|
Chro.50310 | Chro.50310-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 828 | Chro.50310 | hypothetical protein | hypothetical protein | 3415783 | | Not Assigned | AAEL01000301:2,700..3,527(-) | AAEL01000301:2700..3527(-) | AAEL01000301 | Cryptosporidium hominis TU502 | 4 | OG6_594254 | 0 | 275 | 828 | 32454 | 5.74 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.50310ORhypothetical proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.50310 OR hypothetical protein AND Cryptosporidium hominis TU502 |
|
Chro.50311 | Chro.50311-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 864 | Chro.50311 | hypothetical protein | hypothetical protein | 3412692 | | Not Assigned | AAEL01000332:40..903(+) | AAEL01000332:40..903(+) | AAEL01000332 | Cryptosporidium hominis TU502 | 12 | OG6_126374 | 0 | 287 | 864 | 33810 | 4.69 | 0 | | | | | | | | | | | | | | | | 1.3.-.- (Acting on the CH-CH group of donors.) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.50311ORhypothetical proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.50311 OR hypothetical protein AND Cryptosporidium hominis TU502 |
|
Chro.50347 | Chro.50347-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 639 | Chro.50347 | hypothetical protein | hypothetical protein | 3413059 | | Not Assigned | AAEL01000596:22..660(+) | AAEL01000596:22..660(+) | AAEL01000596 | Cryptosporidium hominis TU502 | 10 | OG6_132884 | 0 | 212 | 639 | 24730 | 7.49 | 0 | | | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.50347ORhypothetical proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.50347 OR hypothetical protein AND Cryptosporidium hominis TU502 |
|
Chro.50405 | Chro.50405-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2433 | Chro.50405 | acylamino acid-releasing enzyme | acylamino acid-releasing enzyme | 3414913 | | Not Assigned | AAEL01000141:4,284..6,716(-) | AAEL01000141:4284..6716(-) | AAEL01000141 | Cryptosporidium hominis TU502 | 14 | OG6_102438 | 0 | 810 | 2433 | 90207 | 6.46 | 0 | | | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.19.1 (Acylaminoacyl-peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.50405ORacylamino acid-releasing enzymeANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.50405 OR acylamino acid-releasing enzyme AND Cryptosporidium hominis TU502 |
|
Chro.50424 | Chro.50424-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 873 | Chro.50424 | hypothetical protein | hypothetical protein | 3413913 | | Not Assigned | AAEL01000548:2,799..3,671(-) | AAEL01000548:2799..3671(-) | AAEL01000548 | Cryptosporidium hominis TU502 | 13 | OG6_100897 | 0 | 290 | 873 | 32522 | 5.73 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.50424ORhypothetical proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.50424 OR hypothetical protein AND Cryptosporidium hominis TU502 |
|
Chro.50454 | Chro.50454-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1101 | Chro.50454 | hydrolase, alpha/beta hydrolase fold family | hydrolase, alpha/beta hydrolase fold family | 3413155 | | Not Assigned | AAEL01000428:1,260..2,360(+) | AAEL01000428:1260..2360(+) | AAEL01000428 | Cryptosporidium hominis TU502 | 10 | OG6_126852 | 0 | 366 | 1101 | 42006 | 8.43 | 0 | HMM: MNLKYVITLICFITLCFYQGSSCV, NN: MNLKYVITLICFITLCFYQGSSCV | NN Sum: 4, NN D: .81, HMM Prob: .95 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.50454ORhydrolase, alpha/beta hydrolase fold familyANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.50454 OR hydrolase, alpha/beta hydrolase fold family AND Cryptosporidium hominis TU502 |
|
Chro.50457 | Chro.50457-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1080 | Chro.50457 | erythrocyte membrane-associated antigen | erythrocyte membrane-associated antigen | 3413156 | | Not Assigned | AAEL01000428:4,390..5,469(-) | AAEL01000428:4390..5469(-) | AAEL01000428 | Cryptosporidium hominis TU502 | 12 | OG6_124535 | 1 | 359 | 1080 | 41661 | 4.51 | 1 | | | | | | | | | | | | | | | | 3.1.3.16 (Protein-serine/threonine phosphatase) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.50457ORerythrocyte membrane-associated antigenANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.50457 OR erythrocyte membrane-associated antigen AND Cryptosporidium hominis TU502 |
|
Chro.60017 | Chro.60017-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1299 | Chro.60017 | CAAX prenyl protease | CAAX prenyl protease | 3413317 | | Not Assigned | AAEL01000052:20,501..21,799(+) | AAEL01000052:20501..21799(+) | AAEL01000052 | Cryptosporidium hominis TU502 | 12 | OG6_101632 | 0 | 432 | 1299 | 50072 | 8.62 | 7 | | | | | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.24.84 (Ste24 endopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.60017ORCAAX prenyl proteaseANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.60017 OR CAAX prenyl protease AND Cryptosporidium hominis TU502 |
|
Chro.60098 | Chro.60098-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2958 | Chro.60098 | hypothetical protein | hypothetical protein | 3414938 | | Not Assigned | AAEL01000137:3,890..6,847(-) | AAEL01000137:3890..6847(-) | AAEL01000137 | Cryptosporidium hominis TU502 | 11 | OG6_126349 | 0 | 985 | 2958 | 108506 | 10.14 | 6 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.60098ORhypothetical proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.60098 OR hypothetical protein AND Cryptosporidium hominis TU502 |
|
Chro.60109 | Chro.60109-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1227 | Chro.60109 | multi-pass transmembrane protein | multi-pass transmembrane protein | 3415848 | | Not Assigned | AAEL01000284:1,039..2,265(+) | AAEL01000284:1039..2265(+) | AAEL01000284 | Cryptosporidium hominis TU502 | 13 | OG6_102328 | 0 | 408 | 1227 | 45932 | 6.61 | 10 | HMM: MGQACCNKSLMAYCLSYLVLALAI, NN: MGQACCNKSLMAYCLSYLVLALAILITNFK | NN Sum: 3, NN D: .59, HMM Prob: .11 | GO:0016021 | integral component of membrane | GO:0004190 | aspartic-type endopeptidase activity | | | | | | | | | | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.60109ORmulti-pass transmembrane proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.60109 OR multi-pass transmembrane protein AND Cryptosporidium hominis TU502 |
|
Chro.60116 | Chro.60116-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 534 | Chro.60116 | CG16979 protein | CG16979 protein | 3414584 | | Not Assigned | AAEL01000743:125..658(+) | AAEL01000743:125..658(+) | AAEL01000743 | Cryptosporidium hominis TU502 | 11 | OG6_102601 | 0 | 177 | 534 | 20539 | 6.51 | 0 | | | | | | | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.60116ORCG16979 proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.60116 OR CG16979 protein AND Cryptosporidium hominis TU502 |
|
Chro.60119 | Chro.60119-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 515 | Chro.60119 | hypothetical protein | hypothetical protein | 3414534 | | Not Assigned | AAEL01001029:636..1,150(+) | AAEL01001029:636..1150(+) | AAEL01001029 | Cryptosporidium hominis TU502 | 13 | OG6_101513 | 0 | 172 | 515 | 19122 | 4.69 | 0 | | | | | GO:0005524 | ATP binding | | | | | | | | | | 3.6.4.3 (Transferred entry: 5.6.1.1) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.60119ORhypothetical proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.60119 OR hypothetical protein AND Cryptosporidium hominis TU502 |
|
Chro.60190 | Chro.60190-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 2208 | Chro.60190 | Rad4-related protein | Rad4-related protein | 3414413 | | Not Assigned | AAEL01000021:4,144..6,351(+) | AAEL01000021:4144..6351(+) | AAEL01000021 | Cryptosporidium hominis TU502 | 13 | OG6_102113 | 0 | 735 | 2208 | 86252 | 9.65 | 0 | | | | | GO:0003677 | DNA binding | | | | | | | | | | 2.1.1.201 (2-methoxy-6-polyprenyl-1,4-benzoquinol methylase) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.60190ORRad4-related proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.60190 OR Rad4-related protein AND Cryptosporidium hominis TU502 |
|
Chro.60317 | Chro.60317-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1200 | Chro.60317 | cysteine protease | cysteine protease | 3412477 | | Not Assigned | AAEL01000037:24,242..25,441(+) | AAEL01000037:24242..25441(+) | AAEL01000037 | Cryptosporidium hominis TU502 | 10 | OG6_129646 | 0 | 399 | 1200 | 46421 | 9.66 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.60317ORcysteine proteaseANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.60317 OR cysteine protease AND Cryptosporidium hominis TU502 |
|
Chro.60380 | Chro.60380-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 948 | Chro.60380 | Mov34/MPN/PAD-1 family proteasome regulatory subunit | Mov34/MPN/PAD-1 family proteasome regulatory subunit | 3415668 | | Not Assigned | AAEL01000092:18,688..19,635(-) | AAEL01000092:18688..19635(-) | AAEL01000092 | Cryptosporidium hominis TU502 | 13 | OG6_101835 | 0 | 315 | 948 | 35200 | 7.01 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.60380ORMov34/MPN/PAD-1 family proteasome regulatory subunitANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.60380 OR Mov34/MPN/PAD-1 family proteasome regulatory subunit AND Cryptosporidium hominis TU502 |
|
Chro.60410 | Chro.60410-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 579 | Chro.60410 | endopeptidase | endopeptidase | 3412961 | | Not Assigned | AAEL01000250:8,723..9,301(-) | AAEL01000250:8723..9301(-) | AAEL01000250 | Cryptosporidium hominis TU502 | 15 | OG6_100288 | 0 | 192 | 579 | 21175 | 7.96 | 0 | HMM: MGAPLAVGALVARMLSMLWSK, NN: MGAPLAVGALVARMLSMLWSK | NN Sum: 4, NN D: .65, HMM Prob: .96 | | | | | | | | | | | | | | 2.3.1.234 (N(6)-L-threonylcarbamoyladenine synthase) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.60410ORendopeptidaseANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.60410 OR endopeptidase AND Cryptosporidium hominis TU502 |
|
Chro.60413 | Chro.60413-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 828 | Chro.60413 | multi-pass transmembrane protein | multi-pass transmembrane protein | 3412963 | | Not Assigned | AAEL01000250:1,895..2,722(-) | AAEL01000250:1895..2722(-) | AAEL01000250 | Cryptosporidium hominis TU502 | 11 | OG6_113960 | 0 | 275 | 828 | 31404 | 9.60 | 3 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.60413ORmulti-pass transmembrane proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.60413 OR multi-pass transmembrane protein AND Cryptosporidium hominis TU502 |
|
Chro.60437 | Chro.60437-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1401 | Chro.60437 | aspartyl protease precursor | aspartyl protease precursor | 3412821 | | Not Assigned | AAEL01000124:7,821..9,221(-) | AAEL01000124:7821..9221(-) | AAEL01000124 | Cryptosporidium hominis TU502 | 18 | OG6_100536 | 0 | 466 | 1401 | 52356 | 7.97 | 1 | HMM: MVFQVFFILMMLKISAF, NN: MVFQVFFILMMLKISAFCE | NN Sum: 4, NN D: .82, HMM Prob: .86 | | | | | | | | | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.60437ORaspartyl protease precursorANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.60437 OR aspartyl protease precursor AND Cryptosporidium hominis TU502 |
|
Chro.60469 | Chro.60469-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 441 | Chro.60469 | hypothetical protein | hypothetical protein | 3414552 | | Not Assigned | AAEL01000990:115..555(+) | AAEL01000990:115..555(+) | AAEL01000990 | Cryptosporidium hominis TU502 | 28 | OG6_100231 | 0 | 146 | 441 | 17042 | 6.50 | 0 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.60469ORhypothetical proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.60469 OR hypothetical protein AND Cryptosporidium hominis TU502 |
|
Chro.60491 | Chro.60491-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 4317 | Chro.60491 | hypothetical protein | hypothetical protein | 3412900 | | Not Assigned | AAEL01000264:5,303..9,619(-) | AAEL01000264:5303..9619(-) | AAEL01000264 | Cryptosporidium hominis TU502 | 10 | OG6_593615 | 0 | 1438 | 4317 | 156275 | 5.67 | 0 | | | | | GO:0005488 | binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.60491ORhypothetical proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.60491 OR hypothetical protein AND Cryptosporidium hominis TU502 |
|
Chro.60498 | Chro.60498-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1299 | Chro.60498 | 26S proteasome ATPase subunit | 26S proteasome ATPase subunit | 3415804 | | Not Assigned | AAEL01000296:4,129..5,427(-) | AAEL01000296:4129..5427(-) | AAEL01000296 | Cryptosporidium hominis TU502 | 13 | OG6_101899 | 0 | 432 | 1299 | 48216 | 8.03 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | | | | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.60498OR26S proteasome ATPase subunitANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.60498 OR 26S proteasome ATPase subunit AND Cryptosporidium hominis TU502 |
|
Chro.60521 | Chro.60521-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2763 | Chro.60521 | ubiquitin-specific protease | ubiquitin-specific protease | 3412435 | | Not Assigned | AAEL01000040:2,424..5,186(-) | AAEL01000040:2424..5186(-) | AAEL01000040 | Cryptosporidium hominis TU502 | 13 | OG6_101380 | 0 | 920 | 2763 | 104481 | 4.91 | 0 | | | | | GO:0004843;GO:0036459;GO:0008270 | thiol-dependent ubiquitin-specific protease activity;thiol-dependent ubiquitinyl hydrolase activity;zinc ion binding | GO:0016579 | protein deubiquitination | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.60521ORubiquitin-specific proteaseANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.60521 OR ubiquitin-specific protease AND Cryptosporidium hominis TU502 |
|
Chro.60558 | Chro.60558-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1539 | Chro.60558 | subtilisin-like serine protease | subtilisin-like serine protease | 3415184 | | Not Assigned | AAEL01000060:172..1,710(+) | AAEL01000060:172..1710(+) | AAEL01000060 | Cryptosporidium hominis TU502 | 30 | OG6_100121 | 0 | 512 | 1539 | 57555 | 8.60 | 0 | | | | | | | | | | | | | | | | 3.4.21.66 (Thermitase) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.60558ORsubtilisin-like serine proteaseANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.60558 OR subtilisin-like serine protease AND Cryptosporidium hominis TU502 |
|
Chro.60563 | Chro.60563-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1206 | Chro.60563 | cryptopain precursor | cryptopain precursor | 3414996 | | Not Assigned | AAEL01000168:8,888..10,093(-) | AAEL01000168:8888..10093(-) | AAEL01000168 | Cryptosporidium hominis TU502 | 21 | OG6_100116 | 0 | 401 | 1206 | 45416 | 4.84 | 1 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.60563ORcryptopain precursorANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.60563 OR cryptopain precursor AND Cryptosporidium hominis TU502 |
|
Chro.60574 | Chro.60574-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1158 | Chro.60574 | similar to CGI-67 protein | similar to CGI-67 protein | 3413350 | | Not Assigned | AAEL01000050:18,302..19,459(+) | AAEL01000050:18302..19459(+) | AAEL01000050 | Cryptosporidium hominis TU502 | 30 | OG6_100915 | 1 | 385 | 1158 | 43075 | 9.77 | 0 | | | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.60574ORsimilar to CGI-67 proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.60574 OR similar to CGI-67 protein AND Cryptosporidium hominis TU502 |
|
Chro.70027 | Chro.70027-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1797 | Chro.70027 | hypothetical protein | hypothetical protein | 3412284 | | Not Assigned | AAEL01000031:31,533..33,329(+) | AAEL01000031:31533..33329(+) | AAEL01000031 | Cryptosporidium hominis TU502 | 13 | OG6_105344 | 0 | 598 | 1797 | 69467 | 6.86 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.70027ORhypothetical proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.70027 OR hypothetical protein AND Cryptosporidium hominis TU502 |
|
Chro.70050 | Chro.70050-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1839 | Chro.70050 | random slug cDNA-11 (Fragment) | random slug cDNA-11 (Fragment) | 3415063 | | Not Assigned | AAEL01000011:37,268..39,106(+) | AAEL01000011:37268..39106(+) | AAEL01000011 | Cryptosporidium hominis TU502 | 13 | OG6_105308 | 0 | 612 | 1839 | 67807 | 8.11 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.70050ORrandom slug cDNA-11 (Fragment)ANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.70050 OR random slug cDNA-11 (Fragment) AND Cryptosporidium hominis TU502 |
|
Chro.70094 | Chro.70094-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 4068 | Chro.70094 | hypothetical protein | hypothetical protein | 3415419 | | Not Assigned | AAEL01000380:184..4,251(+) | AAEL01000380:184..4251(+) | AAEL01000380 | Cryptosporidium hominis TU502 | 10 | OG6_593456 | 0 | 1355 | 4068 | 160007 | 9.24 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.70094ORhypothetical proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.70094 OR hypothetical protein AND Cryptosporidium hominis TU502 |
|
Chro.70132 | Chro.70132-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 612 | Chro.70132 | hypothetical protein | hypothetical protein | 3412324 | | Not Assigned | AAEL01000834:1,045..1,656(-) | AAEL01000834:1045..1656(-) | AAEL01000834 | Cryptosporidium hominis TU502 | 13 | OG6_103242 | 0 | 203 | 612 | 22762 | 8.49 | 0 | | | | | | | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.70132ORhypothetical proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.70132 OR hypothetical protein AND Cryptosporidium hominis TU502 |
|
Chro.70222 | Chro.70222-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 2331 | Chro.70222 | DUF140-related | DUF140-related | 3414701 | | Not Assigned | AAEL01000006:29,801..32,131(+) | AAEL01000006:29801..32131(+) | AAEL01000006 | Cryptosporidium hominis TU502 | 14 | OG6_102309 | 0 | 776 | 2331 | 90275 | 4.61 | 0 | | | | | | | | | | | | | | | | 1.1.1.27 (L-lactate dehydrogenase) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.70222ORDUF140-relatedANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.70222 OR DUF140-related AND Cryptosporidium hominis TU502 |
|
Chro.70239 | Chro.70239-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1494 | Chro.70239 | mitochondrial processing peptidase alpha subunit | mitochondrial processing peptidase alpha subunit | 3414703 | | Not Assigned | AAEL01000006:3,015..4,508(-) | AAEL01000006:3015..4508(-) | AAEL01000006 | Cryptosporidium hominis TU502 | 12 | OG6_102381 | 0 | 497 | 1494 | 56233 | 8.61 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.70239ORmitochondrial processing peptidase alpha subunitANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.70239 OR mitochondrial processing peptidase alpha subunit AND Cryptosporidium hominis TU502 |
|
Chro.70291 | Chro.70291-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 582 | Chro.70291 | hypothetical protein | hypothetical protein | 3413871 | | Not Assigned | AAEL01000348:3,335..3,916(-) | AAEL01000348:3335..3916(-) | AAEL01000348 | Cryptosporidium hominis TU502 | 10 | OG6_108842 | 0 | 193 | 582 | 20792 | 8.59 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.70291ORhypothetical proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.70291 OR hypothetical protein AND Cryptosporidium hominis TU502 |
|
Chro.70298 | Chro.70298-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3792 | Chro.70298 | clpB protein | clpB protein | 3415350 | | Not Assigned | AAEL01000069:11,631..15,422(-) | AAEL01000069:11631..15422(-) | AAEL01000069 | Cryptosporidium hominis TU502 | 22 | OG6_100223 | 0 | 1263 | 3792 | 145133 | 8.54 | 1 | HMM: MNTPKFNFIKCFLLILFFNLATFFLVHAVVSE, NN: MNTPKFNFIKCFLLILFFNLATFFLVHAV | NN Sum: 4, NN D: .84, HMM Prob: .97 | | | | | | | | | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.70298ORclpB proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.70298 OR clpB protein AND Cryptosporidium hominis TU502 |
|
Chro.70322 | Chro.70322-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 2022 | Chro.70322 | thiolproteinase SmTP1 | thiolproteinase SmTP1 | 3413846 | | Not Assigned | AAEL01000356:3,213..5,234(+) | AAEL01000356:3213..5234(+) | AAEL01000356 | Cryptosporidium hominis TU502 | 27 | OG6_101151 | 0 | 673 | 2022 | 75223 | 5.42 | 1 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.1 (Cathepsin B) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.70322ORthiolproteinase SmTP1ANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.70322 OR thiolproteinase SmTP1 AND Cryptosporidium hominis TU502 |
|
Chro.70327 | Chro.70327-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 942 | Chro.70327 | 26S proteasome regulatory particle non-ATPase subunit8 | 26S proteasome regulatory particle non-ATPase subunit8 | 3412777 | | Not Assigned | AAEL01000129:10,704..11,645(-) | AAEL01000129:10704..11645(-) | AAEL01000129 | Cryptosporidium hominis TU502 | 13 | OG6_102054 | 0 | 313 | 942 | 35563 | 5.92 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 3.1.3.16 (Protein-serine/threonine phosphatase) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.70327OR26S proteasome regulatory particle non-ATPase subunit8ANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.70327 OR 26S proteasome regulatory particle non-ATPase subunit8 AND Cryptosporidium hominis TU502 |
|
Chro.70339 | Chro.70339-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1395 | Chro.70339 | F6D8.20 | F6D8.20 | 3412593 | | Not Assigned | AAEL01000154:2,655..4,049(-) | AAEL01000154:2655..4049(-) | AAEL01000154 | Cryptosporidium hominis TU502 | 28 | OG6_100562 | 2 | 464 | 1395 | 51883 | 8.01 | 7 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | | 3.4.21.- (Serine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.70339ORF6D8.20ANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.70339 OR F6D8.20 AND Cryptosporidium hominis TU502 |
|
Chro.70408 | Chro.70408-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 711 | Chro.70408 | proteasome subunit alpha type 2 (20S proteasome alpha subunit B) (20S proteasome subunit alpha-2) | proteasome subunit alpha type 2 (20S proteasome alpha subunit B) (20S proteasome subunit alpha-2) | 3413470 | | Not Assigned | AAEL01000017:23,697..24,407(+) | AAEL01000017:23697..24407(+) | AAEL01000017 | Cryptosporidium hominis TU502 | 13 | OG6_101969 | 0 | 236 | 711 | 26086 | 4.77 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.70408ORproteasome subunit alpha type 2 (20S proteasome alpha subunit B) (20S proteasome subunit alpha-2)ANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.70408 OR proteasome subunit alpha type 2 (20S proteasome alpha subunit B) (20S proteasome subunit alpha-2) AND Cryptosporidium hominis TU502 |
|
Chro.70444 | Chro.70444-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 252 | Chro.70444 | autophagy 8i | autophagy 8i | 3414276 | | Not Assigned | AAEL01000028:34,023..34,274(-) | AAEL01000028:34023..34274(-) | AAEL01000028 | Cryptosporidium hominis TU502 | 15 | OG6_100707 | 0 | 83 | 252 | 9515 | 5.51 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.70444ORautophagy 8iANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.70444 OR autophagy 8i AND Cryptosporidium hominis TU502 |
|
Chro.70546 | Chro.70546-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1185 | Chro.70546 | ubiquitin carboxyl-terminal hydrolase | ubiquitin carboxyl-terminal hydrolase | 3415741 | | Not Assigned | AAEL01000405:370..1,554(+) | AAEL01000405:370..1554(+) | AAEL01000405 | Cryptosporidium hominis TU502 | 10 | OG6_593984 | 0 | 394 | 1185 | 46261 | 7.07 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.70546ORubiquitin carboxyl-terminal hydrolaseANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.70546 OR ubiquitin carboxyl-terminal hydrolase AND Cryptosporidium hominis TU502 |
|
Chro.80075 | Chro.80075-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1257 | Chro.80075 | hydrolase, alpha/beta fold family | hydrolase, alpha/beta fold family | 3412528 | | Not Assigned | AAEL01000104:14,432..15,688(+) | AAEL01000104:14432..15688(+) | AAEL01000104 | Cryptosporidium hominis TU502 | 15 | OG6_108070 | 0 | 418 | 1257 | 47658 | 6.29 | 0 | HMM: MWLFKYIFAILSFAYVGIFKVYGE, NN: MWLFKYIFAILSFAYVGIFKVYGE | NN Sum: 4, NN D: .67, HMM Prob: .57 | | | | | | | | | | | | | | 1.11.1.10 (Chloride peroxidase) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.80075ORhydrolase, alpha/beta fold familyANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.80075 OR hydrolase, alpha/beta fold family AND Cryptosporidium hominis TU502 |
|
Chro.80103 | Chro.80103-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1176 | Chro.80103 | 26S proteasome regulatory subunit | 26S proteasome regulatory subunit | 3413760 | | Not Assigned | AAEL01000194:1,549..2,724(-) | AAEL01000194:1549..2724(-) | AAEL01000194 | Cryptosporidium hominis TU502 | 13 | OG6_101751 | 0 | 391 | 1176 | 43909 | 7.43 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | | | | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.80103OR26S proteasome regulatory subunitANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.80103 OR 26S proteasome regulatory subunit AND Cryptosporidium hominis TU502 |
|
Chro.80156 | Chro.80156-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 510 | Chro.80156 | hypothetical protein | hypothetical protein | 3413159 | | Not Assigned | AAEL01000426:134..643(+) | AAEL01000426:134..643(+) | AAEL01000426 | Cryptosporidium hominis TU502 | 14 | OG6_103851 | 0 | 169 | 510 | 20182 | 9.50 | 0 | | | | | | | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.80156ORhypothetical proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.80156 OR hypothetical protein AND Cryptosporidium hominis TU502 |
|
Chro.80181 | Chro.80181-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 4806 | Chro.80181 | ubiquitin carboxyl-terminal hydrolase | ubiquitin carboxyl-terminal hydrolase | 3415058 | | Not Assigned | AAEL01000229:5,652..10,457(+) | AAEL01000229:5652..10457(+) | AAEL01000229 | Cryptosporidium hominis TU502 | 16 | OG6_101317 | 0 | 1601 | 4806 | 181047 | 6.08 | 0 | | | | | GO:0005515;GO:0036459 | protein binding;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.80181ORubiquitin carboxyl-terminal hydrolaseANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.80181 OR ubiquitin carboxyl-terminal hydrolase AND Cryptosporidium hominis TU502 |
|
Chro.80317 | Chro.80317-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 3606 | Chro.80317 | insulinase | insulinase | 3413556 | | Not Assigned | AAEL01000186:5,409..9,014(+) | AAEL01000186:5409..9014(+) | AAEL01000186 | Cryptosporidium hominis TU502 | 12 | OG6_105738 | 0 | 1201 | 3606 | 138501 | 5.90 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.56 (Insulysin) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.80317ORinsulinaseANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.80317 OR insulinase AND Cryptosporidium hominis TU502 |
|
Chro.80372 | Chro.80372-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 768 | Chro.80372 | ubiquitin carboxy-terminal hydrolase L1 | ubiquitin carboxy-terminal hydrolase L1 | 3414724 | | Not Assigned | AAEL01000005:187..954(-) | AAEL01000005:187..954(-) | AAEL01000005 | Cryptosporidium hominis TU502 | 15 | OG6_101218 | 0 | 255 | 768 | 29420 | 7.94 | 0 | | | GO:0005622 | intracellular | GO:0004843 | thiol-dependent ubiquitin-specific protease activity | GO:0006511 | ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.80372ORubiquitin carboxy-terminal hydrolase L1ANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.80372 OR ubiquitin carboxy-terminal hydrolase L1 AND Cryptosporidium hominis TU502 |
|
Chro.80395 | Chro.80395-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 2811 | Chro.80395 | aminopeptidase N | aminopeptidase N | 3414734 | | Not Assigned | AAEL01000005:47,539..50,349(+) | AAEL01000005:47539..50349(+) | AAEL01000005 | Cryptosporidium hominis TU502 | 16 | OG6_106799 | 0 | 936 | 2811 | 105836 | 6.03 | 0 | | | | | GO:0008237;GO:0008270 | metallopeptidase activity;zinc ion binding | | | | | | | | | | 3.4.11.2 (Membrane alanyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.80395ORaminopeptidase NANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.80395 OR aminopeptidase N AND Cryptosporidium hominis TU502 |
|
Chro.80425 | Chro.80425-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 8178 | Chro.80425 | acetyl-CoA carboxylase 2 | acetyl-CoA carboxylase 2 | 3412223 | | Not Assigned | AAEL01000036:2,208..10,385(+) | AAEL01000036:2208..10385(+) | AAEL01000036 | Cryptosporidium hominis TU502 | 17 | OG6_101052 | 0 | 2725 | 8178 | 305954 | 6.38 | 0 | | | | | GO:0005524;GO:0003989;GO:0016874;GO:0046872 | ATP binding;acetyl-CoA carboxylase activity;ligase activity;metal ion binding | GO:0006633 | fatty acid biosynthetic process | | | | | | | | 6.4.1.2 (Acetyl-CoA carboxylase) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.80425ORacetyl-CoA carboxylase 2ANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.80425 OR acetyl-CoA carboxylase 2 AND Cryptosporidium hominis TU502 |
|
Chro.80498 | Chro.80498-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 2014 | Chro.80498 | hypothetical protein | hypothetical protein | 3415403 | | Not Assigned | AAEL01000384:4,872..6,885(+) | AAEL01000384:4872..6885(+) | AAEL01000384 | Cryptosporidium hominis TU502 | 15 | OG6_101457 | 0 | 671 | 2014 | 77432 | 9.15 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.80498ORhypothetical proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.80498 OR hypothetical protein AND Cryptosporidium hominis TU502 |
|
Chro.80562 | Chro.80562-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 5799 | Chro.80562 | 1200014O24Rik protein | 1200014O24Rik protein | 3414090 | | Not Assigned | AAEL01000118:2,305..8,103(+) | AAEL01000118:2305..8103(+) | AAEL01000118 | Cryptosporidium hominis TU502 | 13 | OG6_102772 | 0 | 1932 | 5799 | 212618 | 7.25 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 3.1.13.4 (Poly(A)-specific ribonuclease) | https://pubmed.ncbi.nlm.nih.gov/?term=Chro.80562OR1200014O24Rik proteinANDCryptosporidium hominis TU502 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=Chro.80562 OR 1200014O24Rik protein AND Cryptosporidium hominis TU502 |
