|
EDI_002800 | EDI_002800A | 1 | 1 | 1 | | | forward | protein coding | No | 1005 | EDI_002800 | hypothetical protein, conserved | hypothetical protein, conserved | 5883366 | B0EJA8 | Not Assigned | DS549550:82,234..83,238(+) | DS549550:82234..83238(+) | DS549550 | Entamoeba dispar SAW760 | 11 | OG6_100562 | 0 | 334 | 1005 | 37477 | 7.62 | 7 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | 3.4.21.- (Serine endopeptidases.) | 3.4.21.- (Serine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_002800ORhypothetical protein, conservedANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_002800 OR hypothetical protein, conserved AND Entamoeba dispar SAW760 |
|
EDI_002840 | EDI_002840A | 1 | 1 | 1 | | | forward | protein coding | No | 975 | EDI_002840 | cysteine proteinase 2 precursor, putative | cysteine proteinase 2 precursor, putative | 5883369 | B0EJB1 | Not Assigned | DS549550:85,886..86,860(+) | DS549550:85886..86860(+) | DS549550 | Entamoeba dispar SAW760 | 11 | OG6_139514 | 0 | 324 | 975 | 36876 | 6.87 | 0 | HMM: MFLFLVFLLCEINAI, NN: MFLFLVFLLCEINAI | NN Sum: 3, NN D: .63, HMM Prob: .96 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.22.16 (Cathepsin H) | 3.4.22.16 (Cathepsin H) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_002840ORcysteine proteinase 2 precursor, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_002840 OR cysteine proteinase 2 precursor, putative AND Entamoeba dispar SAW760 |
|
EDI_004700 | EDI_004700A | 1 | 1 | 1 | | | reverse | protein coding | No | 738 | EDI_004700 | proteasome subunit alpha type-7, putative | proteasome subunit alpha type-7, putative | 5879752 | | Not Assigned | DS548247:18,410..19,147(-) | DS548247:18410..19147(-) | DS548247 | Entamoeba dispar SAW760 | 11 | OG6_101207 | 1 | 245 | 738 | 27469 | 6.30 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_004700ORproteasome subunit alpha type-7, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_004700 OR proteasome subunit alpha type-7, putative AND Entamoeba dispar SAW760 |
|
EDI_011760 | EDI_011760A | 1 | 1 | 1 | | | forward | protein coding | No | 405 | EDI_011760 | hypothetical protein, conserved | hypothetical protein, conserved | 5880783 | B0EBY4 | Not Assigned | DS548645:18,853..19,257(+) | DS548645:18853..19257(+) | DS548645 | Entamoeba dispar SAW760 | 11 | OG6_100707 | 1 | 134 | 405 | 15401 | 4.77 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_011760ORhypothetical protein, conservedANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_011760 OR hypothetical protein, conserved AND Entamoeba dispar SAW760 |
|
EDI_012640 | EDI_012640A | 2 | 2 | 1 | | | reverse | protein coding | No | 903 | EDI_012640 | cysteine proteinase ACP1 precursor, putative | cysteine proteinase ACP1 precursor, putative | 5879388 | B0E7Y2 | Not Assigned | DS548090:34,428..35,379(-) | DS548090:34428..35379(-) | DS548090 | Entamoeba dispar SAW760 | 57 | OG6_123941 | 5 | 300 | 903 | 34314 | 8.63 | 0 | HMM: MNLILLIVLCKSFSQ, NN: MNLILLIVLCKSFSQESPTF | NN Sum: 1, NN D: .44, HMM Prob: .93 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.22.16 (Cathepsin H) | 3.4.22.16 (Cathepsin H) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_012640ORcysteine proteinase ACP1 precursor, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_012640 OR cysteine proteinase ACP1 precursor, putative AND Entamoeba dispar SAW760 |
|
EDI_014170 | EDI_014170A | 1 | 1 | 1 | | | forward | protein coding | No | 1041 | EDI_014170 | hypothetical protein | hypothetical protein | 5882727 | B0EHH1 | Not Assigned | DS549306:48,615..49,655(+) | DS549306:48615..49655(+) | DS549306 | Entamoeba dispar SAW760 | 31 | OG6_139788 | 3 | 346 | 1041 | 39535 | 6.70 | 0 | | | | | | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_014170ORhypothetical proteinANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_014170 OR hypothetical protein AND Entamoeba dispar SAW760 |
|
EDI_016640 | EDI_016640A | 1 | 1 | 1 | | | reverse | protein coding | No | 1140 | EDI_016640 | peptidase T, putative | peptidase T, putative | 5884904 | B0ENP5 | Not Assigned | DS550125:49,530..50,669(-) | DS550125:49530..50669(-) | DS550125 | Entamoeba dispar SAW760 | 18 | OG6_111055 | 1 | 379 | 1140 | 42774 | 6.12 | 0 | | | | | GO:0016787 | hydrolase activity | GO:0008152 | metabolic process | | | | | | | 3.4.11.4 (Tripeptide aminopeptidase) | 3.4.11.4 (Tripeptide aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_016640ORpeptidase T, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_016640 OR peptidase T, putative AND Entamoeba dispar SAW760 |
|
EDI_020520 | EDI_020520A | 1 | 1 | 1 | | | reverse | protein coding | No | 2139 | EDI_020520 | hypothetical protein, conserved | hypothetical protein, conserved | 5914237 | B0EU09 | Not Assigned | DS550836:17,837..19,975(-) | DS550836:17837..19975(-) | DS550836 | Entamoeba dispar SAW760 | 11 | OG6_101380 | 0 | 712 | 2139 | 83278 | 5.36 | 0 | | | | | GO:0005515;GO:0036459;GO:0008270 | protein binding;thiol-dependent ubiquitinyl hydrolase activity;zinc ion binding | GO:0016579 | protein deubiquitination | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_020520ORhypothetical protein, conservedANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_020520 OR hypothetical protein, conserved AND Entamoeba dispar SAW760 |
|
EDI_020670 | EDI_020670A | 1 | 1 | 1 | | | forward | protein coding | No | 819 | EDI_020670 | protein bem46, putative | protein bem46, putative | 5914242 | B0EU14 | Not Assigned | DS550836:31,371..32,189(+) | DS550836:31371..32189(+) | DS550836 | Entamoeba dispar SAW760 | 17 | OG6_101827 | 1 | 272 | 819 | 31442 | 9.21 | 0 | HMM: MLKYILFILSFIILNSYAL, NN: MLKYILFILSFIILNSYAL | NN Sum: 4, NN D: .91, HMM Prob: .98 | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_020670ORprotein bem46, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_020670 OR protein bem46, putative AND Entamoeba dispar SAW760 |
|
EDI_020730 | EDI_020730A | 1 | 1 | 1 | | | reverse | protein coding | No | 759 | EDI_020730 | proteasome subunit beta type-5 precursor, putative | proteasome subunit beta type-5 precursor, putative | 5914249 | B0EU20 | Not Assigned | DS550836:38,911..39,669(-) | DS550836:38911..39669(-) | DS550836 | Entamoeba dispar SAW760 | 10 | OG6_100897 | 0 | 252 | 759 | 28389 | 7.59 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_020730ORproteasome subunit beta type-5 precursor, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_020730 OR proteasome subunit beta type-5 precursor, putative AND Entamoeba dispar SAW760 |
|
EDI_021380 | EDI_021380A | 1 | 1 | 1 | | | forward | protein coding | No | 966 | EDI_021380 | signal peptide peptidase, putative | signal peptide peptidase, putative | 5885847 | B0ERE9 | Not Assigned | DS550491:4,463..5,428(+) | DS550491:4463..5428(+) | DS550491 | Entamoeba dispar SAW760 | 14 | OG6_184292 | 1 | 321 | 966 | 36837 | 8.42 | 9 | HMM: MLELIQLITLTVIIHYLSCK, NN: MLELIQLITLTVIIHYLSCK | NN Sum: 3, NN D: .58, HMM Prob: .13 | GO:0016021 | integral component of membrane | GO:0004190 | aspartic-type endopeptidase activity | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_021380ORsignal peptide peptidase, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_021380 OR signal peptide peptidase, putative AND Entamoeba dispar SAW760 |
|
EDI_022270 | EDI_022270A | 1 | 1 | 1 | | | reverse | protein coding | No | 744 | EDI_022270 | proteasome subunit alpha type-5 | proteasome subunit alpha type-5 | 5880766 | B0EBW1 | Not Assigned | DS548639:10,161..10,904(-) | DS548639:10161..10904(-) | DS548639 | Entamoeba dispar SAW760 | 6 | OG6_101621 | 1 | 247 | 744 | 27234 | 4.86 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_022270ORproteasome subunit alpha type-5ANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_022270 OR proteasome subunit alpha type-5 AND Entamoeba dispar SAW760 |
|
EDI_023410 | EDI_023410A | 1 | 1 | 1 | | | reverse | protein coding | No | 3888 | EDI_023410 | ubiquitin specific protease, putative | ubiquitin specific protease, putative | 5882676 | B0EH85 | Not Assigned | DS549293:353..4,240(-) | DS549293:353..4240(-) | DS549293 | Entamoeba dispar SAW760 | 9 | OG6_104647 | 0 | 1295 | 3888 | 149391 | 7.53 | 0 | | | | | GO:0004843;GO:0036459 | thiol-dependent ubiquitin-specific protease activity;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | 1.3.1.74 (2-alkenal reductase (NAD(P)(+)));3.1.2.15 (Deleted entry) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_023410ORubiquitin specific protease, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_023410 OR ubiquitin specific protease, putative AND Entamoeba dispar SAW760 |
|
EDI_023860 | EDI_023860A | 2 | 2 | 1 | | | reverse | protein coding | No | 2826 | EDI_023860 | protein hypA, putative | protein hypA, putative | 5882641 | B0EHA9 | Not Assigned | DS549293:45,290..48,200(-) | DS549293:45290..48200(-) | DS549293 | Entamoeba dispar SAW760 | 16 | OG6_101809 | 0 | 941 | 2826 | 108524 | 5.18 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | GO:0006508 | proteolysis | | | | | | | 3.4.24.64 (Mitochondrial processing peptidase) | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_023860ORprotein hypA, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_023860 OR protein hypA, putative AND Entamoeba dispar SAW760 |
|
EDI_025110 | EDI_025110A | 1 | 1 | 1 | | | forward | protein coding | No | 999 | EDI_025110 | cysteine protease atg4, putative | cysteine protease atg4, putative | 5885810 | B0ERB2 | Not Assigned | DS550467:4,706..5,704(+) | DS550467:4706..5704(+) | DS550467 | Entamoeba dispar SAW760 | 12 | OG6_100501 | 1 | 332 | 999 | 38143 | 6.43 | 0 | | | | | | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_025110ORcysteine protease atg4, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_025110 OR cysteine protease atg4, putative AND Entamoeba dispar SAW760 |
|
EDI_025400 | EDI_025400A | 2 | 2 | 1 | | | reverse | protein coding | No | 1224 | EDI_025400 | 1-O-acylceramide synthase precursor, putative | 1-O-acylceramide synthase precursor, putative | 5880666 | B0EBI2 | Not Assigned | DS548604:4,259..5,578(-) | DS548604:4259..5578(-) | DS548604 | Entamoeba dispar SAW760 | 86 | OG6_101376 | 11 | 407 | 1224 | 46584 | 5.81 | 0 | HMM: MNILFLCLLLSITIAE, NN: MNILFLCLLLSITIAE | NN Sum: 4, NN D: .83, HMM Prob: 1 | | | GO:0008374 | O-acyltransferase activity | GO:0006629 | lipid metabolic process | | | | | | | 2.3.1.43 (Phosphatidylcholine--sterol O-acyltransferase) | 2.3.1.43 (Phosphatidylcholine--sterol O-acyltransferase) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_025400OR1-O-acylceramide synthase precursor, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_025400 OR 1-O-acylceramide synthase precursor, putative AND Entamoeba dispar SAW760 |
|
EDI_027650 | EDI_027650A | 1 | 1 | 1 | | | forward | protein coding | No | 1758 | EDI_027650 | ubiquitin carboxyl-terminal hydrolase DUB-1, putative | ubiquitin carboxyl-terminal hydrolase DUB-1, putative | 5883319 | B0EJ62 | Not Assigned | DS549535:10,946..12,703(+) | DS549535:10946..12703(+) | DS549535 | Entamoeba dispar SAW760 | 18 | OG6_101457 | 1 | 585 | 1758 | 69248 | 9.64 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | 3.1.2.15 (Deleted entry) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_027650ORubiquitin carboxyl-terminal hydrolase DUB-1, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_027650 OR ubiquitin carboxyl-terminal hydrolase DUB-1, putative AND Entamoeba dispar SAW760 |
|
EDI_028230 | EDI_028230A | 1 | 1 | 1 | | | forward | protein coding | No | 897 | EDI_028230 | 26S proteasome non-ATPase regulatory subunit, putative | 26S proteasome non-ATPase regulatory subunit, putative | 5880899 | B0EC93 | Not Assigned | DS548694:16,154..17,050(+) | DS548694:16154..17050(+) | DS548694 | Entamoeba dispar SAW760 | 10 | OG6_101835 | 0 | 298 | 897 | 33533 | 6.80 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_028230OR26S proteasome non-ATPase regulatory subunit, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_028230 OR 26S proteasome non-ATPase regulatory subunit, putative AND Entamoeba dispar SAW760 |
|
EDI_028590 | EDI_028590A | 1 | 1 | 1 | | | reverse | protein coding | No | 858 | EDI_028590 | monoglyceride lipase, putative | monoglyceride lipase, putative | 5886109 | B0ES59 | Not Assigned | DS550595:13,151..14,008(-) | DS550595:13151..14008(-) | DS550595 | Entamoeba dispar SAW760 | 38 | OG6_100231 | 2 | 285 | 858 | 32633 | 6.90 | 2 | | | | | | | | | | | | | | | 3.1.1.23 (Acylglycerol lipase) | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_028590ORmonoglyceride lipase, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_028590 OR monoglyceride lipase, putative AND Entamoeba dispar SAW760 |
|
EDI_029570 | EDI_029570A | 1 | 1 | 1 | | | reverse | protein coding | No | 1296 | EDI_029570 | Gut-specific cysteine proteinase precursor, putative | Gut-specific cysteine proteinase precursor, putative | 5914378 | B0EV45 | Not Assigned | DS551013:14,435..15,730(-) | DS551013:14435..15730(-) | DS551013 | Entamoeba dispar SAW760 | 57 | OG6_123941 | 5 | 431 | 1296 | 48467 | 4.64 | 0 | HMM: MIGVVLVLLVLGSEGSSF, NN: MIGVVLVLLVLGSEGS | NN Sum: 4, NN D: .72, HMM Prob: 1 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.22.16 (Cathepsin H) | 3.4.22.16 (Cathepsin H) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_029570ORGut-specific cysteine proteinase precursor, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_029570 OR Gut-specific cysteine proteinase precursor, putative AND Entamoeba dispar SAW760 |
|
EDI_036650 | EDI_036650A | 1 | 1 | 1 | | | reverse | protein coding | No | 3897 | EDI_036650 | hypothetical protein | hypothetical protein | 5884591 | B0EMS6 | Not Assigned | DS550039:4,414..8,310(-) | DS550039:4414..8310(-) | DS550039 | Entamoeba dispar SAW760 | 8 | OG6_502009 | 0 | 1298 | 3897 | 153655 | 5.24 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_036650ORhypothetical proteinANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_036650 OR hypothetical protein AND Entamoeba dispar SAW760 |
|
EDI_037980 | EDI_037980A | 2 | 2 | 1 | | | reverse | protein coding | No | 1989 | EDI_037980 | hypothetical protein, conserved | hypothetical protein, conserved | 5885896 | B0ERK0 | Not Assigned | DS550522:37,456..39,494(-) | DS550522:37456..39494(-) | DS550522 | Entamoeba dispar SAW760 | 17 | OG6_101754 | 0 | 662 | 1989 | 75701 | 6.73 | 1 | | | GO:0016020 | membrane | GO:0004222 | metalloendopeptidase activity | GO:0007155;GO:0006508 | cell adhesion;proteolysis | | | | | | | | 3.4.24.36 (Leishmanolysin) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_037980ORhypothetical protein, conservedANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_037980 OR hypothetical protein, conserved AND Entamoeba dispar SAW760 |
|
EDI_038020 | EDI_038020A | 1 | 1 | 1 | | | reverse | protein coding | No | 849 | EDI_038020 | monoglyceride lipase, putative | monoglyceride lipase, putative | 5885900 | B0ERK4 | Not Assigned | DS550522:45,234..46,082(-) | DS550522:45234..46082(-) | DS550522 | Entamoeba dispar SAW760 | 38 | OG6_100231 | 2 | 282 | 849 | 33036 | 8.95 | 2 | | | | | | | | | | | | | | | 3.1.1.23 (Acylglycerol lipase) | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_038020ORmonoglyceride lipase, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_038020 OR monoglyceride lipase, putative AND Entamoeba dispar SAW760 |
|
EDI_038430 | EDI_038430A | 2 | 2 | 1 | | | forward | protein coding | No | 1284 | EDI_038430 | pre-mRNA-splicing factor SAD1, putative | pre-mRNA-splicing factor SAD1, putative | 5883814 | B0EKL4 | Not Assigned | DS549761:15,910..17,240(+) | DS549761:15910..17240(+) | DS549761 | Entamoeba dispar SAW760 | 10 | OG6_102786 | 0 | 427 | 1284 | 49865 | 7.81 | 0 | | | | | GO:0036459;GO:0008270 | thiol-dependent ubiquitinyl hydrolase activity;zinc ion binding | GO:0016579 | protein deubiquitination | | | | | | | 3.1.2.15 (Deleted entry) | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_038430ORpre-mRNA-splicing factor SAD1, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_038430 OR pre-mRNA-splicing factor SAD1, putative AND Entamoeba dispar SAW760 |
|
EDI_038440 | EDI_038440A | 1 | 1 | 1 | | | forward | protein coding | No | 636 | EDI_038440 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | 5883815 | B0EKK3 | Not Assigned | DS549761:19,392..20,027(+) | DS549761:19392..20027(+) | DS549761 | Entamoeba dispar SAW760 | 9 | OG6_101218 | 0 | 211 | 636 | 24221 | 5.04 | 0 | | | GO:0005622 | intracellular | GO:0004843 | thiol-dependent ubiquitin-specific protease activity | GO:0006511 | ubiquitin-dependent protein catabolic process | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_038440ORubiquitin carboxyl-terminal hydrolase, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_038440 OR ubiquitin carboxyl-terminal hydrolase, putative AND Entamoeba dispar SAW760 |
|
EDI_039310 | EDI_039310A | 1 | 1 | 1 | | | forward | protein coding | No | 927 | EDI_039310 | cysteine proteinase ACP1 precursor, putative | cysteine proteinase ACP1 precursor, putative | 5886290 | B0ESM6 | Not Assigned | DS550700:1,663..2,589(+) | DS550700:1663..2589(+) | DS550700 | Entamoeba dispar SAW760 | 94 | OG6_100116 | 6 | 308 | 927 | 33759 | 7.31 | 0 | HMM: MFALILFVSLACANEAA, NN: MFALILFVSLACANEAA | NN Sum: 3, NN D: .58, HMM Prob: .99 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.22.16 (Cathepsin H) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_039310ORcysteine proteinase ACP1 precursor, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_039310 OR cysteine proteinase ACP1 precursor, putative AND Entamoeba dispar SAW760 |
|
EDI_043410 | EDI_043410A | 1 | 1 | 1 | | | forward | protein coding | No | 1413 | EDI_043410 | cathepsin Q precursor, putative | cathepsin Q precursor, putative | 5886185 | B0ESD9 | Not Assigned | DS550638:28,511..29,923(+) | DS550638:28511..29923(+) | DS550638 | Entamoeba dispar SAW760 | 57 | OG6_123941 | 5 | 470 | 1413 | 53201 | 6.07 | 1 | HMM: MSYLIIITTLIICSFSL, NN: MSYLIIITTLIICSFSL | NN Sum: 3, NN D: .69, HMM Prob: .68 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.22.16 (Cathepsin H) | 3.4.22.16 (Cathepsin H) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_043410ORcathepsin Q precursor, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_043410 OR cathepsin Q precursor, putative AND Entamoeba dispar SAW760 |
|
EDI_044770 | EDI_044770A | 1 | 1 | 1 | | | forward | protein coding | No | 576 | EDI_044770 | 26S proteasome non-ATPase regulatory subunit, putative | 26S proteasome non-ATPase regulatory subunit, putative | 5882884 | B0EHX7 | Not Assigned | DS549356:160,963..161,538(+) | DS549356:160963..161538(+) | DS549356 | Entamoeba dispar SAW760 | 10 | OG6_102356 | 0 | 191 | 576 | 22266 | 5.04 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_044770OR26S proteasome non-ATPase regulatory subunit, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_044770 OR 26S proteasome non-ATPase regulatory subunit, putative AND Entamoeba dispar SAW760 |
|
EDI_044950 | EDI_044950A | 1 | 1 | 1 | | | forward | protein coding | No | 1170 | EDI_044950 | 26S protease regulatory subunit 6B, putative | 26S protease regulatory subunit 6B, putative | 5882902 | B0EHZ5 | Not Assigned | DS549356:187,438..188,607(+) | DS549356:187438..188607(+) | DS549356 | Entamoeba dispar SAW760 | 10 | OG6_101965 | 0 | 389 | 1170 | 43781 | 7.71 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | | | | | | | 3.6.4.3 (Transferred entry: 5.6.1.1) | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_044950OR26S protease regulatory subunit 6B, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_044950 OR 26S protease regulatory subunit 6B, putative AND Entamoeba dispar SAW760 |
|
EDI_049440 | EDI_049440A | 1 | 1 | 1 | | 27 | forward | protein coding | No | 4437 | EDI_049440 | ubiquitin specific protease, putative | ubiquitin specific protease, putative | 5882009 | B0EFF4 | Not Assigned | DS549038:15,205..19,641(+) | DS549038:15232..19641(+) | DS549038 | Entamoeba dispar SAW760 | 9 | OG6_136986 | 0 | 1469 | 4410 | 170998 | 5.32 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | 3.1.2.15 (Deleted entry) | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_049440ORubiquitin specific protease, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_049440 OR ubiquitin specific protease, putative AND Entamoeba dispar SAW760 |
|
EDI_049560 | EDI_049560A | 1 | 1 | 1 | | | forward | protein coding | No | 2277 | EDI_049560 | hypothetical protein, conserved | hypothetical protein, conserved | 5882021 | B0EFG6 | Not Assigned | DS549038:38,236..40,512(+) | DS549038:38236..40512(+) | DS549038 | Entamoeba dispar SAW760 | 16 | OG6_113142 | 1 | 758 | 2277 | 88050 | 7.97 | 3 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_049560ORhypothetical protein, conservedANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_049560 OR hypothetical protein, conserved AND Entamoeba dispar SAW760 |
|
EDI_057770 | EDI_057770A | 1 | 1 | 1 | | | reverse | protein coding | No | 1356 | EDI_057770 | cysteine protease, putative | cysteine protease, putative | 5886652 | B0EUF5 | Not Assigned | DS550856:11,439..12,794(-) | DS550856:11439..12794(-) | DS550856 | Entamoeba dispar SAW760 | 41 | OG6_159415 | 2 | 451 | 1356 | 50723 | 5.28 | 0 | HMM: MVLLILILTVLCKAE, NN: MVLLILILTVLCKAE | NN Sum: 3, NN D: .62, HMM Prob: .98 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.22.50 (V-cath endopeptidase) | 3.4.22.50 (V-cath endopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_057770ORcysteine protease, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_057770 OR cysteine protease, putative AND Entamoeba dispar SAW760 |
|
EDI_060940 | EDI_060940A | 3 | 3 | 1 | | | forward | protein coding | No | 3948 | EDI_060940 | hypothetical protein | hypothetical protein | 5881388 | B0EDM7 | Not Assigned | DS548818:5,886..9,943(+) | DS548818:5886..9943(+) | DS548818 | Entamoeba dispar SAW760 | 8 | OG6_163742 | 0 | 1315 | 3948 | 152533 | 6.75 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_060940ORhypothetical proteinANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_060940 OR hypothetical protein AND Entamoeba dispar SAW760 |
|
EDI_061590 | EDI_061590A | 1 | 1 | 1 | | | reverse | protein coding | No | 2484 | EDI_061590 | puromycin-sensitive aminopeptidase, putative | puromycin-sensitive aminopeptidase, putative | 5878957 | B0E6Q0 | Not Assigned | DS547922:17,066..19,549(-) | DS547922:17066..19549(-) | DS547922 | Entamoeba dispar SAW760 | 11 | OG6_100948 | 0 | 827 | 2484 | 94663 | 5.28 | 0 | | | | | GO:0008237;GO:0008270 | metallopeptidase activity;zinc ion binding | | | | | | | | | 3.4.11.- (Aminopeptidases.) | 3.4.11.- (Aminopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_061590ORpuromycin-sensitive aminopeptidase, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_061590 OR puromycin-sensitive aminopeptidase, putative AND Entamoeba dispar SAW760 |
|
EDI_063900 | EDI_063900A | 3 | 3 | 1 | | | forward | protein coding | No | 666 | EDI_063900 | proteasome subunit beta type-1, putative | proteasome subunit beta type-1, putative | 5885617 | B0EQR0 | Not Assigned | DS550398:11,314..12,074(+) | DS550398:11314..12074(+) | DS550398 | Entamoeba dispar SAW760 | 9 | OG6_101631 | 0 | 221 | 666 | 24975 | 5.17 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_063900ORproteasome subunit beta type-1, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_063900 OR proteasome subunit beta type-1, putative AND Entamoeba dispar SAW760 |
|
EDI_064860 | EDI_064860A | 2 | 2 | 1 | | | forward | protein coding | No | 1689 | EDI_064860 | hypothetical protein, conserved | hypothetical protein, conserved | 5881369 | B0EDL0 | Not Assigned | DS548810:2,478..4,214(+) | DS548810:2478..4214(+) | DS548810 | Entamoeba dispar SAW760 | 32 | OG6_159401 | 3 | 562 | 1689 | 64378 | 5.25 | 1 | HMM: MMQSNILFPRQGKDFLFFILLFVSLVTLVLAS, NN: MMQSNILFPRQGKDFLFFILLFVSLVTLVLAS | NN Sum: 4, NN D: .76, HMM Prob: .1 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_064860ORhypothetical protein, conservedANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_064860 OR hypothetical protein, conserved AND Entamoeba dispar SAW760 |
|
EDI_065030 | EDI_065030A | 1 | 1 | 1 | | | reverse | protein coding | No | 1038 | EDI_065030 | hypothetical protein, conserved | hypothetical protein, conserved | 5881374 | B0EDL7 | Not Assigned | DS548810:13,500..14,537(-) | DS548810:13500..14537(-) | DS548810 | Entamoeba dispar SAW760 | 24 | OG6_102905 | 2 | 345 | 1038 | 40798 | 4.55 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_065030ORhypothetical protein, conservedANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_065030 OR hypothetical protein, conserved AND Entamoeba dispar SAW760 |
|
EDI_067040 | EDI_067040A | 1 | 1 | 1 | | | reverse | protein coding | No | 1047 | EDI_067040 | hypothetical protein, conserved | hypothetical protein, conserved | 5882205 | B0EFZ5 | Not Assigned | DS549134:5,363..6,409(-) | DS549134:5363..6409(-) | DS549134 | Entamoeba dispar SAW760 | 31 | OG6_139788 | 3 | 348 | 1047 | 40120 | 6.67 | 0 | | | | | | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_067040ORhypothetical protein, conservedANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_067040 OR hypothetical protein, conserved AND Entamoeba dispar SAW760 |
|
EDI_069970 | EDI_069970A | 1 | 1 | 1 | | | forward | protein coding | No | 2601 | EDI_069970 | heat shock protein, putative | heat shock protein, putative | 5882962 | B0EI52 | Not Assigned | DS549398:1,842..4,442(+) | DS549398:1842..4442(+) | DS549398 | Entamoeba dispar SAW760 | 33 | OG6_100223 | 26 | 866 | 2601 | 98179 | 6.06 | 0 | | | | | GO:0005524 | ATP binding | GO:0019538 | protein metabolic process | | | | | | | 3.4.21.53 (Endopeptidase La) | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_069970ORheat shock protein, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_069970 OR heat shock protein, putative AND Entamoeba dispar SAW760 |
|
EDI_070460 | EDI_070460A | 1 | 1 | 1 | | | reverse | protein coding | No | 1407 | EDI_070460 | sentrin/sumo-specific protease, putative | sentrin/sumo-specific protease, putative | 5884393 | B0EM86 | Not Assigned | DS549985:11,860..13,266(-) | DS549985:11860..13266(-) | DS549985 | Entamoeba dispar SAW760 | 8 | OG6_133048 | 0 | 468 | 1407 | 54562 | 8.39 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | 3.6.1.5 (Apyrase) | 3.6.1.5 (Apyrase) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_070460ORsentrin/sumo-specific protease, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_070460 OR sentrin/sumo-specific protease, putative AND Entamoeba dispar SAW760 |
|
EDI_071650 | EDI_071650A | 1 | 1 | 1 | | | reverse | protein coding | No | 858 | EDI_071650 | sentrin-specific protease, putative | sentrin-specific protease, putative | 5879422 | B0E816 | Not Assigned | DS548095:27,788..28,645(-) | DS548095:27788..28645(-) | DS548095 | Entamoeba dispar SAW760 | 8 | OG6_101235 | 0 | 285 | 858 | 32564 | 4.95 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | 3.6.1.5 (Apyrase) | 3.4.22.68 (Ulp1 peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_071650ORsentrin-specific protease, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_071650 OR sentrin-specific protease, putative AND Entamoeba dispar SAW760 |
|
EDI_072190 | EDI_072190A | 1 | 1 | 1 | | | reverse | protein coding | No | 1131 | EDI_072190 | 26S protease regulatory subunit, putative | 26S protease regulatory subunit, putative | 5879814 | B0E957 | Not Assigned | DS548292:1,827..2,957(-) | DS548292:1827..2957(-) | DS548292 | Entamoeba dispar SAW760 | 8 | OG6_101513 | 1 | 376 | 1131 | 42118 | 8.89 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | | | | | | | 3.6.4.3 (Transferred entry: 5.6.1.1) | 3.6.4.3 (Transferred entry: 5.6.1.1) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_072190OR26S protease regulatory subunit, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_072190 OR 26S protease regulatory subunit, putative AND Entamoeba dispar SAW760 |
|
EDI_072420 | EDI_072420A | 1 | 1 | 1 | | | reverse | protein coding | No | 2133 | EDI_072420 | oligopeptidase A, putative | oligopeptidase A, putative | 5879815 | B0E960 | Not Assigned | DS548292:8,208..10,340(-) | DS548292:8208..10340(-) | DS548292 | Entamoeba dispar SAW760 | 21 | OG6_100561 | 1 | 710 | 2133 | 83787 | 5.47 | 0 | HMM: MLLIIEVFICCVVAQLCNTN, NN: MLLIIEVFICCVVAQLCNTN | NN Sum: 4, NN D: .66, HMM Prob: .94 | | | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.24.70 (Oligopeptidase A) | 3.4.24.15 (Thimet oligopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_072420ORoligopeptidase A, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_072420 OR oligopeptidase A, putative AND Entamoeba dispar SAW760 |
|
EDI_073840 | EDI_073840A | 2 | 2 | 1 | | | forward | protein coding | No | 681 | EDI_073840 | hypothetical protein | hypothetical protein | 5883843 | B0EKN3 | Not Assigned | DS549764:3..736(+) | DS549764:3..736(+) | DS549764 | Entamoeba dispar SAW760 | 10 | OG6_101672 | 0 | 226 | 681 | 26968 | 4.60 | 3 | HMM: LILIISLFVLMKVRLI, NN: LILIISLFVLMKVRLI | NN Sum: 4, NN D: .67, HMM Prob: .66 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_073840ORhypothetical proteinANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_073840 OR hypothetical protein AND Entamoeba dispar SAW760 |
|
EDI_076230 | EDI_076230A | 1 | 1 | 1 | | | reverse | protein coding | No | 1014 | EDI_076230 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | 5882549 | B0EGZ2 | Not Assigned | DS549261:34,278..35,291(-) | DS549261:34278..35291(-) | DS549261 | Entamoeba dispar SAW760 | 10 | OG6_103260 | 0 | 337 | 1014 | 39210 | 8.80 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | 3.1.2.15 (Deleted entry) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_076230ORubiquitin carboxyl-terminal hydrolase, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_076230 OR ubiquitin carboxyl-terminal hydrolase, putative AND Entamoeba dispar SAW760 |
|
EDI_076460 | EDI_076460A | 1 | 1 | 1 | | 1 | forward | protein coding | No | 1060 | EDI_076460 | chaperone protein ClpB, putative | chaperone protein ClpB, putative | 5882600 | B0EH42 | Not Assigned | DS549289:9..1,068(+) | DS549289:10..1068(+) | DS549289 | Entamoeba dispar SAW760 | 33 | OG6_100223 | 26 | 353 | 1059 | 40130 | 5.04 | 0 | | | | | GO:0005524 | ATP binding | | | | | | | | | 3.4.21.53 (Endopeptidase La) | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_076460ORchaperone protein ClpB, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_076460 OR chaperone protein ClpB, putative AND Entamoeba dispar SAW760 |
|
EDI_077050 | EDI_077050A | 2 | 2 | 1 | | | forward | protein coding | No | 1251 | EDI_077050 | caax prenyl protease ste24, putative | caax prenyl protease ste24, putative | 5883204 | B0EIU4 | Not Assigned | DS549500:4,697..6,026(+) | DS549500:4697..6026(+) | DS549500 | Entamoeba dispar SAW760 | 13 | OG6_101632 | 0 | 416 | 1251 | 48578 | 6.74 | 7 | HMM: MFPYWTSIIVLTILTTLF, NN: MFPYWTSIIVLTILTTLFELY | NN Sum: 2, NN D: .57, HMM Prob: .19 | | | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.24.84 (Ste24 endopeptidase) | 3.4.24.84 (Ste24 endopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_077050ORcaax prenyl protease ste24, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_077050 OR caax prenyl protease ste24, putative AND Entamoeba dispar SAW760 |
|
EDI_077850 | EDI_077850A | 1 | 1 | 1 | | | reverse | protein coding | No | 1617 | EDI_077850 | hypothetical protein, conserved | hypothetical protein, conserved | 5881554 | B0EE47 | Not Assigned | DS548901:10,692..12,308(-) | DS548901:10692..12308(-) | DS548901 | Entamoeba dispar SAW760 | 11 | OG6_204729 | 0 | 538 | 1617 | 61962 | 6.81 | 1 | HMM: MEQPTKKAVIPFWILWSGLIVLNLFILIVTITSAC, NN: MEQPTKKAVIPFWILWSGLIVLNLFILIVTITSAC | NN Sum: 4, NN D: .82, HMM Prob: .42 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_077850ORhypothetical protein, conservedANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_077850 OR hypothetical protein, conserved AND Entamoeba dispar SAW760 |
|
EDI_079160 | EDI_079160A | 1 | 1 | 1 | | | forward | protein coding | No | 1401 | EDI_079160 | hypothetical protein, conserved | hypothetical protein, conserved | 5881636 | B0EED0 | Not Assigned | DS548942:12,797..14,197(+) | DS548942:12797..14197(+) | DS548942 | Entamoeba dispar SAW760 | 24 | OG6_100644 | 2 | 466 | 1401 | 52749 | 4.94 | 0 | HMM: MFLFLLLTTSLGFRFQNIRFGR, NN: MFLFLLLTTSLGF | NN Sum: 2, NN D: .56, HMM Prob: .73 | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.16.2 (Lysosomal Pro-Xaa carboxypeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_079160ORhypothetical protein, conservedANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_079160 OR hypothetical protein, conserved AND Entamoeba dispar SAW760 |
|
EDI_082600 | EDI_082600A | 2 | 2 | 1 | | | forward | protein coding | No | 1332 | EDI_082600 | cysteine protease, putative | cysteine protease, putative | 5885920 | B0ERM4 | Not Assigned | DS550524:28,125..29,508(+) | DS550524:28125..29508(+) | DS550524 | Entamoeba dispar SAW760 | 57 | OG6_123941 | 5 | 443 | 1332 | 50309 | 7.22 | 1 | HMM: MSVLFITAFLITFSLSK, NN: MSVLFITAFLITFSLSK | NN Sum: 4, NN D: .83, HMM Prob: .99 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.22.16 (Cathepsin H) | 3.4.22.16 (Cathepsin H) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_082600ORcysteine protease, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_082600 OR cysteine protease, putative AND Entamoeba dispar SAW760 |
|
EDI_091030 | EDI_091030A | 1 | 1 | 1 | | | reverse | protein coding | No | 498 | EDI_091030 | hypothetical protein | hypothetical protein | 5881362 | B0EDK3 | Not Assigned | DS548805:20,828..21,325(-) | DS548805:20828..21325(-) | DS548805 | Entamoeba dispar SAW760 | 5 | OG6_187453 | 0 | 165 | 498 | 19455 | 8.69 | 2 | | | GO:0016021;GO:0005787 | integral component of membrane;signal peptidase complex | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_091030ORhypothetical proteinANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_091030 OR hypothetical protein AND Entamoeba dispar SAW760 |
|
EDI_092710 | EDI_092710A | 1 | 1 | 1 | | | reverse | protein coding | No | 309 | EDI_092710 | acylamino-acid-releasing enzyme, putative | acylamino-acid-releasing enzyme, putative | 5881221 | B0ED63 | Not Assigned | DS548800:135,438..135,746(-) | DS548800:135438..135746(-) | DS548800 | Entamoeba dispar SAW760 | 23 | OG6_104931 | 2 | 102 | 309 | 12295 | 9.12 | 0 | | | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.19.1 (Acylaminoacyl-peptidase) | 3.4.19.1 (Acylaminoacyl-peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_092710ORacylamino-acid-releasing enzyme, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_092710 OR acylamino-acid-releasing enzyme, putative AND Entamoeba dispar SAW760 |
|
EDI_092720 | EDI_092720A | 1 | 1 | 1 | | | forward | protein coding | No | 984 | EDI_092720 | cysteine proteinase 2 precursor, putative | cysteine proteinase 2 precursor, putative | 5881222 | B0ED64 | Not Assigned | DS548800:135,943..136,926(+) | DS548800:135943..136926(+) | DS548800 | Entamoeba dispar SAW760 | 94 | OG6_100116 | 6 | 327 | 984 | 37767 | 7.17 | 0 | HMM: MYRNNLFFLIVVNFSFAI, NN: MYRNNLFFLIVVNFSFAI | NN Sum: 3, NN D: .68, HMM Prob: .69 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.22.16 (Cathepsin H) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_092720ORcysteine proteinase 2 precursor, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_092720 OR cysteine proteinase 2 precursor, putative AND Entamoeba dispar SAW760 |
|
EDI_093370 | EDI_093370A | 3 | 3 | 1 | | | forward | protein coding | No | 729 | EDI_093370 | proteasome subunit alpha type-6-A, putative | proteasome subunit alpha type-6-A, putative | 5881287 | B0EDC9 | Not Assigned | DS548800:258,927..259,760(+) | DS548800:258927..259760(+) | DS548800 | Entamoeba dispar SAW760 | 10 | OG6_102240 | 0 | 242 | 729 | 26812 | 6.24 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_093370ORproteasome subunit alpha type-6-A, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_093370 OR proteasome subunit alpha type-6-A, putative AND Entamoeba dispar SAW760 |
|
EDI_093520 | EDI_093520A | 1 | 1 | 1 | | | forward | protein coding | No | 2043 | EDI_093520 | dipeptidyl-peptidase 5 precursor, putative | dipeptidyl-peptidase 5 precursor, putative | 5881302 | B0EDE4 | Not Assigned | DS548800:281,862..283,904(+) | DS548800:281862..283904(+) | DS548800 | Entamoeba dispar SAW760 | 23 | OG6_104931 | 2 | 680 | 2043 | 79407 | 5.68 | 0 | | | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.19.1 (Acylaminoacyl-peptidase) | 3.4.19.1 (Acylaminoacyl-peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_093520ORdipeptidyl-peptidase 5 precursor, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_093520 OR dipeptidyl-peptidase 5 precursor, putative AND Entamoeba dispar SAW760 |
|
EDI_093590 | EDI_093590A | 2 | 2 | 1 | | | forward | protein coding | No | 4416 | EDI_093590 | hypothetical protein | hypothetical protein | 5881309 | B0EDF1 | Not Assigned | DS548800:292,601..297,111(+) | DS548800:292601..297111(+) | DS548800 | Entamoeba dispar SAW760 | 16 | OG6_204261 | 1 | 1471 | 4416 | 168606 | 6.19 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_093590ORhypothetical proteinANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_093590 OR hypothetical protein AND Entamoeba dispar SAW760 |
|
EDI_096060 | EDI_096060A | 1 | 1 | 1 | | | reverse | protein coding | No | 1998 | EDI_096060 | dipeptidyl-peptidase 5 precursor, putative | dipeptidyl-peptidase 5 precursor, putative | 5885252 | B0EPP4 | Not Assigned | DS550300:10,013..12,010(-) | DS550300:10013..12010(-) | DS550300 | Entamoeba dispar SAW760 | 23 | OG6_104931 | 2 | 665 | 1998 | 77008 | 5.03 | 0 | HMM: MRIILLVTFIAFCYAK, NN: MRIILLVTFIAFCYAK | NN Sum: 4, NN D: .89, HMM Prob: 1 | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.14.5 (Dipeptidyl-peptidase IV) | 3.4.19.1 (Acylaminoacyl-peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_096060ORdipeptidyl-peptidase 5 precursor, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_096060 OR dipeptidyl-peptidase 5 precursor, putative AND Entamoeba dispar SAW760 |
|
EDI_096160 | EDI_096160A | 1 | 1 | 1 | | | reverse | protein coding | No | 1254 | EDI_096160 | 26S protease regulatory subunit, putative | 26S protease regulatory subunit, putative | 5885263 | B0EPQ3 | Not Assigned | DS550300:30,278..31,531(-) | DS550300:30278..31531(-) | DS550300 | Entamoeba dispar SAW760 | 10 | OG6_101899 | 1 | 417 | 1254 | 46897 | 5.70 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | | | | | | | 3.6.4.3 (Transferred entry: 5.6.1.1) | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_096160OR26S protease regulatory subunit, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_096160 OR 26S protease regulatory subunit, putative AND Entamoeba dispar SAW760 |
|
EDI_096250 | EDI_096250A | 1 | 1 | 1 | | | reverse | protein coding | No | 711 | EDI_096250 | proteasome subunit alpha type-2-A, putative | proteasome subunit alpha type-2-A, putative | 5885272 | B0EPR2 | Not Assigned | DS550300:41,227..41,937(-) | DS550300:41227..41937(-) | DS550300 | Entamoeba dispar SAW760 | 11 | OG6_101969 | 0 | 236 | 711 | 26122 | 5.40 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_096250ORproteasome subunit alpha type-2-A, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_096250 OR proteasome subunit alpha type-2-A, putative AND Entamoeba dispar SAW760 |
|
EDI_096820 | EDI_096820A | 3 | 3 | 1 | | | forward | protein coding | No | 444 | EDI_096820 | protein DJ-1, putative | protein DJ-1, putative | 5880578 | B0EBB8 | Not Assigned | DS548574:15,433..16,059(+) | DS548574:15433..16059(+) | DS548574 | Entamoeba dispar SAW760 | 10 | OG6_101257 | 0 | 147 | 444 | 15861 | 5.21 | 0 | | | | | | | | | | | | | | | | 2.7.1.50 (Hydroxyethylthiazole kinase) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_096820ORprotein DJ-1, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_096820 OR protein DJ-1, putative AND Entamoeba dispar SAW760 |
|
EDI_097640 | EDI_097640A | 1 | 1 | 1 | | | reverse | protein coding | No | 350 | EDI_097640 | signal peptidase complex catalytic subunit SEC11A, putative | signal peptidase complex catalytic subunit SEC11A, putative | 5878546 | B0E5I7 | Not Assigned | DS547799:1..350(-) | DS547799:1..350(-) | DS547799 | Entamoeba dispar SAW760 | 10 | OG6_100807 | 1 | 116 | 350 | 12821 | 9.91 | 1 | | | GO:0016020 | membrane | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | | | | | | | 3.4.21.89 (Signal peptidase I) | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_097640ORsignal peptidase complex catalytic subunit SEC11A, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_097640 OR signal peptidase complex catalytic subunit SEC11A, putative AND Entamoeba dispar SAW760 |
|
EDI_099290 | EDI_099290A | 1 | 1 | 1 | | | forward | protein coding | No | 1341 | EDI_099290 | cysteine proteinase precursor, putative | cysteine proteinase precursor, putative | 5875639 | B0EQW6 | Not Assigned | DS550423:14,842..16,182(+) | DS550423:14842..16182(+) | DS550423 | Entamoeba dispar SAW760 | 41 | OG6_159415 | 2 | 446 | 1341 | 50246 | 8.32 | 0 | HMM: MIAIIVAFLLFVSNQKMQSIAF, NN: MIAIIVAFLLFVSNQKMQSIAF | NN Sum: 3, NN D: .56, HMM Prob: .88 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | 1.3.1.74 (2-alkenal reductase (NAD(P)(+))) | 3.4.22.50 (V-cath endopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_099290ORcysteine proteinase precursor, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_099290 OR cysteine proteinase precursor, putative AND Entamoeba dispar SAW760 |
|
EDI_107330 | EDI_107330A | 1 | 1 | 1 | | | reverse | protein coding | No | 1416 | EDI_107330 | Xaa-Pro dipeptidase, putative | Xaa-Pro dipeptidase, putative | 5881605 | B0EEA4 | Not Assigned | DS548931:14,816..16,231(-) | DS548931:14816..16231(-) | DS548931 | Entamoeba dispar SAW760 | 10 | OG6_102295 | 0 | 471 | 1416 | 53854 | 6.04 | 0 | | | | | GO:0004177;GO:0030145 | aminopeptidase activity;manganese ion binding | | | | | | | | | 3.4.13.9 (Xaa-Pro dipeptidase) | 3.4.11.9 (Xaa-Pro aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_107330ORXaa-Pro dipeptidase, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_107330 OR Xaa-Pro dipeptidase, putative AND Entamoeba dispar SAW760 |
|
EDI_110210 | EDI_110210A | 2 | 2 | 1 | | | reverse | protein coding | No | 903 | EDI_110210 | 26S proteasome non-ATPase regulatory subunit, putative | 26S proteasome non-ATPase regulatory subunit, putative | 5883642 | B0EK31 | Not Assigned | DS549661:8,157..9,135(-) | DS549661:8157..9135(-) | DS549661 | Entamoeba dispar SAW760 | 10 | OG6_102002 | 0 | 300 | 903 | 33159 | 4.44 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_110210OR26S proteasome non-ATPase regulatory subunit, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_110210 OR 26S proteasome non-ATPase regulatory subunit, putative AND Entamoeba dispar SAW760 |
|
EDI_110700 | EDI_110700A | 1 | 1 | 1 | | | reverse | protein coding | No | 1113 | EDI_110700 | hypothetical protein | hypothetical protein | 5883659 | B0EK50 | Not Assigned | DS549661:47,986..49,098(-) | DS549661:47986..49098(-) | DS549661 | Entamoeba dispar SAW760 | 12 | OG6_101756 | 0 | 370 | 1113 | 41017 | 4.66 | 0 | | | GO:0005643 | nuclear pore | GO:0017056 | structural constituent of nuclear pore | GO:0006913 | nucleocytoplasmic transport | | | | | | | | 3.4.21.- (Serine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_110700ORhypothetical proteinANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_110700 OR hypothetical protein AND Entamoeba dispar SAW760 |
|
EDI_111860 | EDI_111860A | 1 | 1 | 1 | | | forward | protein coding | No | 654 | EDI_111860 | hypothetical protein, conserved | hypothetical protein, conserved | 5878851 | B0E6E6 | Not Assigned | DS547885:18,341..18,994(+) | DS547885:18341..18994(+) | DS547885 | Entamoeba dispar SAW760 | 86 | OG6_101376 | 11 | 217 | 654 | 24820 | 5.77 | 0 | | | | | GO:0008374 | O-acyltransferase activity | GO:0006629 | lipid metabolic process | | | | | | | | 2.3.1.43 (Phosphatidylcholine--sterol O-acyltransferase) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_111860ORhypothetical protein, conservedANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_111860 OR hypothetical protein, conserved AND Entamoeba dispar SAW760 |
|
EDI_113060 | EDI_113060A | 2 | 2 | 1 | | | reverse | protein coding | No | 888 | EDI_113060 | cysteine proteinase ACP1 precursor, putative | cysteine proteinase ACP1 precursor, putative | 5878660 | B0E5V3 | Not Assigned | DS547839:26,857..27,809(-) | DS547839:26857..27809(-) | DS547839 | Entamoeba dispar SAW760 | 94 | OG6_100116 | 6 | 295 | 888 | 32647 | 8.59 | 0 | HMM: MFAVILLGLCANAI, NN: MFAVILLGLCANAITF | NN Sum: 2, NN D: .48, HMM Prob: .95 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | 1.3.1.74 (2-alkenal reductase (NAD(P)(+))) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_113060ORcysteine proteinase ACP1 precursor, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_113060 OR cysteine proteinase ACP1 precursor, putative AND Entamoeba dispar SAW760 |
|
EDI_113090 | EDI_113090A | 1 | 1 | 1 | | | reverse | protein coding | No | 963 | EDI_113090 | cysteine proteinase 3 precursor, putative | cysteine proteinase 3 precursor, putative | 5878663 | B0E5V6 | Not Assigned | DS547839:34,650..35,612(-) | DS547839:34650..35612(-) | DS547839 | Entamoeba dispar SAW760 | 94 | OG6_100116 | 6 | 320 | 963 | 35492 | 8.66 | 0 | HMM: MFGLLFVTLISLSNAI, NN: MFGLLFVTLISLSNAI | NN Sum: 4, NN D: .84, HMM Prob: .99 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | 1.3.1.74 (2-alkenal reductase (NAD(P)(+))) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_113090ORcysteine proteinase 3 precursor, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_113090 OR cysteine proteinase 3 precursor, putative AND Entamoeba dispar SAW760 |
|
EDI_114500 | EDI_114500A | 1 | 1 | 1 | | | forward | protein coding | No | 2601 | EDI_114500 | heat shock protein, putative | heat shock protein, putative | 5884266 | B0ELV7 | Not Assigned | DS549930:21,403..24,003(+) | DS549930:21403..24003(+) | DS549930 | Entamoeba dispar SAW760 | 33 | OG6_100223 | 26 | 866 | 2601 | 98111 | 5.80 | 0 | | | | | GO:0005524 | ATP binding | GO:0019538 | protein metabolic process | | | | | | | 3.4.21.53 (Endopeptidase La) | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_114500ORheat shock protein, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_114500 OR heat shock protein, putative AND Entamoeba dispar SAW760 |
|
EDI_114810 | EDI_114810A | 1 | 1 | 1 | | | forward | protein coding | No | 488 | EDI_114810 | chaperone Clpb, putative | chaperone Clpb, putative | 5885833 | B0ERD6 | Not Assigned | DS550470:2,804..3,291(+) | DS550470:2804..3291(+) | DS550470 | Entamoeba dispar SAW760 | 33 | OG6_100223 | 26 | 162 | 488 | 18601 | 5.88 | 0 | | | | | | | GO:0019538 | protein metabolic process | | | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_114810ORchaperone Clpb, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_114810 OR chaperone Clpb, putative AND Entamoeba dispar SAW760 |
|
EDI_114910 | EDI_114910A | 1 | 1 | 1 | | | reverse | protein coding | No | 382 | EDI_114910 | hypothetical protein | hypothetical protein | 5886125 | B0ES70 | Not Assigned | DS550600:1..382(-) | DS550600:1..382(-) | DS550600 | Entamoeba dispar SAW760 | 9 | OG6_143303 | 1 | 127 | 382 | 14421 | 4.29 | 1 | | | | | | | | | | | | | | | | 3.4.21.- (Serine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_114910ORhypothetical proteinANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_114910 OR hypothetical protein AND Entamoeba dispar SAW760 |
|
EDI_119180 | EDI_119180A | 1 | 1 | 1 | | | forward | protein coding | No | 601 | EDI_119180 | hypothetical protein, conserved | hypothetical protein, conserved | 5886227 | B0ESI2 | Not Assigned | DS550685:1,817..2,417(+) | DS550685:1817..2417(+) | DS550685 | Entamoeba dispar SAW760 | 12 | OG6_100501 | 1 | 200 | 601 | 22705 | 6.94 | 0 | | | | | | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_119180ORhypothetical protein, conservedANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_119180 OR hypothetical protein, conserved AND Entamoeba dispar SAW760 |
|
EDI_120220 | EDI_120220A | 1 | 1 | 1 | | | reverse | protein coding | No | 2421 | EDI_120220 | FACT complex subunit SPT16, putative | FACT complex subunit SPT16, putative | 5880334 | B0EAM2 | Not Assigned | DS548477:7,894..10,314(-) | DS548477:7894..10314(-) | DS548477 | Entamoeba dispar SAW760 | 10 | OG6_102309 | 0 | 806 | 2421 | 92960 | 5.98 | 0 | | | | | | | | | | | | | | | 1.1.1.27 (L-lactate dehydrogenase) | 1.1.1.27 (L-lactate dehydrogenase) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_120220ORFACT complex subunit SPT16, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_120220 OR FACT complex subunit SPT16, putative AND Entamoeba dispar SAW760 |
|
EDI_121940 | EDI_121940A | 1 | 1 | 1 | | | reverse | protein coding | No | 537 | EDI_121940 | signal peptidase complex catalytic subunit SEC11A, putative | signal peptidase complex catalytic subunit SEC11A, putative | 5885487 | B0EQD2 | Not Assigned | DS550371:15,950..16,486(-) | DS550371:15950..16486(-) | DS550371 | Entamoeba dispar SAW760 | 10 | OG6_100807 | 1 | 178 | 537 | 19804 | 9.41 | 3 | | | GO:0016020 | membrane | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | | | | | | | 3.4.21.89 (Signal peptidase I) | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_121940ORsignal peptidase complex catalytic subunit SEC11A, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_121940 OR signal peptidase complex catalytic subunit SEC11A, putative AND Entamoeba dispar SAW760 |
|
EDI_123560 | EDI_123560A | 3 | 3 | 1 | | | reverse | protein coding | No | 507 | EDI_123560 | microsomal signal peptidase 23 kD subunit, putative | microsomal signal peptidase 23 kD subunit, putative | 5885706 | B0ER12 | Not Assigned | DS550441:15,845..16,463(-) | DS550441:15845..16463(-) | DS550441 | Entamoeba dispar SAW760 | 9 | OG6_102447 | 0 | 168 | 507 | 19675 | 7.18 | 1 | HMM: MYHTFERMYNIIYYAFQWLGIAVFFLYLTSLILYVPPITSV, NN: MYHTFERMYNIIYYAFQWLGIAVFFLYLTSLILYVPPITSV | NN Sum: 2, NN D: .5, HMM Prob: 0 | GO:0016021;GO:0005787 | integral component of membrane;signal peptidase complex | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_123560ORmicrosomal signal peptidase 23 kD subunit, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_123560 OR microsomal signal peptidase 23 kD subunit, putative AND Entamoeba dispar SAW760 |
|
EDI_127290 | EDI_127290A | 1 | 1 | 1 | | | forward | protein coding | No | 1221 | EDI_127290 | 1-O-acylceramide synthase precursor, putative | 1-O-acylceramide synthase precursor, putative | 5879615 | B0E8I2 | Not Assigned | DS548161:69,615..70,835(+) | DS548161:69615..70835(+) | DS548161 | Entamoeba dispar SAW760 | 86 | OG6_101376 | 11 | 406 | 1221 | 45755 | 6.78 | 0 | HMM: MLVIVLLCIICSTQAQ, NN: MLVIVLLCIICSTQAQ | NN Sum: 4, NN D: .7, HMM Prob: 1 | | | GO:0008374 | O-acyltransferase activity | GO:0006629 | lipid metabolic process | | | | | | | 2.3.1.43 (Phosphatidylcholine--sterol O-acyltransferase) | 2.3.1.43 (Phosphatidylcholine--sterol O-acyltransferase) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_127290OR1-O-acylceramide synthase precursor, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_127290 OR 1-O-acylceramide synthase precursor, putative AND Entamoeba dispar SAW760 |
|
EDI_128700 | EDI_128700A | 1 | 1 | 1 | | | forward | protein coding | No | 2601 | EDI_128700 | heat shock protein, putative | heat shock protein, putative | 5914162 | B0ETD2 | Not Assigned | DS550801:2,731..5,331(+) | DS550801:2731..5331(+) | DS550801 | Entamoeba dispar SAW760 | 33 | OG6_100223 | 26 | 866 | 2601 | 98169 | 5.92 | 0 | | | | | GO:0005524 | ATP binding | GO:0019538 | protein metabolic process | | | | | | | 3.4.21.53 (Endopeptidase La) | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_128700ORheat shock protein, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_128700 OR heat shock protein, putative AND Entamoeba dispar SAW760 |
|
EDI_129450 | EDI_129450A | 1 | 1 | 1 | | | forward | protein coding | No | 900 | EDI_129450 | minor histocompatibility antigen H13, putative | minor histocompatibility antigen H13, putative | 5914139 | B0ETK7 | Not Assigned | DS550801:177,115..178,014(+) | DS550801:177115..178014(+) | DS550801 | Entamoeba dispar SAW760 | 10 | OG6_102328 | 0 | 299 | 900 | 34035 | 4.35 | 7 | HMM: MDLKNAASMPVIGSLVLFGLYVIIKFISAD, NN: MDLKNAASMPVIGSLVLFGLYVIIKFISAD | NN Sum: 4, NN D: .64, HMM Prob: .37 | GO:0016021 | integral component of membrane | GO:0004190 | aspartic-type endopeptidase activity | | | | | | | | | | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_129450ORminor histocompatibility antigen H13, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_129450 OR minor histocompatibility antigen H13, putative AND Entamoeba dispar SAW760 |
|
EDI_134080 | EDI_134080A | 2 | 2 | 1 | | | reverse | protein coding | No | 678 | EDI_134080 | proteasome subunit beta type-4 precursor, putative | proteasome subunit beta type-4 precursor, putative | 5883764 | | Not Assigned | DS549727:31,796..32,523(-) | DS549727:31796..32523(-) | DS549727 | Entamoeba dispar SAW760 | 11 | OG6_101718 | 1 | 225 | 678 | 24982 | 4.84 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_134080ORproteasome subunit beta type-4 precursor, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_134080 OR proteasome subunit beta type-4 precursor, putative AND Entamoeba dispar SAW760 |
|
EDI_139430 | EDI_139430A | 1 | 1 | 1 | | | forward | protein coding | No | 1116 | EDI_139430 | proliferation-associated protein 2G4, putative | proliferation-associated protein 2G4, putative | 5884735 | B0EN76 | Not Assigned | DS550064:21,199..22,314(+) | DS550064:21199..22314(+) | DS550064 | Entamoeba dispar SAW760 | 10 | OG6_101895 | 0 | 371 | 1116 | 41590 | 5.63 | 0 | | | | | | | | | | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_139430ORproliferation-associated protein 2G4, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_139430 OR proliferation-associated protein 2G4, putative AND Entamoeba dispar SAW760 |
|
EDI_144390 | EDI_144390A | 1 | 1 | 1 | | | forward | protein coding | No | 1443 | EDI_144390 | hypothetical protein, conserved | hypothetical protein, conserved | 5884321 | B0EM15 | Not Assigned | DS549954:9,894..11,336(+) | DS549954:9894..11336(+) | DS549954 | Entamoeba dispar SAW760 | 24 | OG6_100644 | 2 | 480 | 1443 | 53975 | 4.54 | 0 | HMM: MLLLALCVICSYAKLS, NN: MLLLALCVICSYAKLSLNQ | NN Sum: 3, NN D: .54, HMM Prob: .94 | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.16.2 (Lysosomal Pro-Xaa carboxypeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_144390ORhypothetical protein, conservedANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_144390 OR hypothetical protein, conserved AND Entamoeba dispar SAW760 |
|
EDI_144600 | EDI_144600A | 1 | 1 | 1 | | | reverse | protein coding | No | 783 | EDI_144600 | hypothetical protein, conserved | hypothetical protein, conserved | 5884345 | B0EM36 | Not Assigned | DS549954:61,427..62,209(-) | DS549954:61427..62209(-) | DS549954 | Entamoeba dispar SAW760 | 14 | OG6_100915 | 0 | 260 | 783 | 29383 | 6.41 | 0 | | | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_144600ORhypothetical protein, conservedANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_144600 OR hypothetical protein, conserved AND Entamoeba dispar SAW760 |
|
EDI_144890 | EDI_144890A | 1 | 1 | 1 | | | forward | protein coding | No | 1608 | EDI_144890 | sentrin/sumo-specific protease, putative | sentrin/sumo-specific protease, putative | 5880343 | B0EAN8 | Not Assigned | DS548486:7,157..8,764(+) | DS548486:7157..8764(+) | DS548486 | Entamoeba dispar SAW760 | 24 | OG6_102905 | 2 | 535 | 1608 | 63823 | 6.01 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | 3.6.1.5 (Apyrase) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_144890ORsentrin/sumo-specific protease, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_144890 OR sentrin/sumo-specific protease, putative AND Entamoeba dispar SAW760 |
|
EDI_146070 | EDI_146070A | 1 | 1 | 1 | | | reverse | protein coding | No | 1788 | EDI_146070 | hypothetical protein, conserved | hypothetical protein, conserved | 5886611 | B0EUB0 | Not Assigned | DS550852:29,607..31,394(-) | DS550852:29607..31394(-) | DS550852 | Entamoeba dispar SAW760 | 36 | OG6_113471 | 6 | 595 | 1788 | 68881 | 4.85 | 1 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_146070ORhypothetical protein, conservedANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_146070 OR hypothetical protein, conserved AND Entamoeba dispar SAW760 |
|
EDI_149140 | EDI_149140A | 2 | 2 | 1 | | | reverse | protein coding | No | 1044 | EDI_149140 | hypothetical protein, conserved | hypothetical protein, conserved | 5881451 | B0EDU5 | Not Assigned | DS548867:24,687..25,812(-) | DS548867:24687..25812(-) | DS548867 | Entamoeba dispar SAW760 | 9 | OG6_143303 | 1 | 347 | 1044 | 39394 | 4.62 | 7 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | 3.4.21.- (Serine endopeptidases.) | 3.4.21.- (Serine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_149140ORhypothetical protein, conservedANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_149140 OR hypothetical protein, conserved AND Entamoeba dispar SAW760 |
|
EDI_150800 | EDI_150800A | 2 | 2 | 1 | | | forward | protein coding | No | 1308 | EDI_150800 | hypothetical protein, conserved | hypothetical protein, conserved | 5885427 | B0EQ43 | Not Assigned | DS550346:3,485..4,835(+) | DS550346:3485..4835(+) | DS550346 | Entamoeba dispar SAW760 | 18 | OG6_102047 | 1 | 435 | 1308 | 48546 | 5.13 | 0 | | | | | GO:0004177;GO:0008270 | aminopeptidase activity;zinc ion binding | GO:0006508 | proteolysis | | | | | | | | 3.4.11.21 (Aspartyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_150800ORhypothetical protein, conservedANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_150800 OR hypothetical protein, conserved AND Entamoeba dispar SAW760 |
|
EDI_155340 | EDI_155340A | 1 | 1 | 1 | | | reverse | protein coding | No | 1365 | EDI_155340 | hypothetical protein, conserved | hypothetical protein, conserved | 5886331 | B0EST1 | Not Assigned | DS550715:616..1,980(-) | DS550715:616..1980(-) | DS550715 | Entamoeba dispar SAW760 | 18 | OG6_102047 | 1 | 454 | 1365 | 50665 | 8.65 | 0 | | | | | GO:0004177;GO:0008270 | aminopeptidase activity;zinc ion binding | GO:0006508 | proteolysis | | | | | | | | 3.4.11.21 (Aspartyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_155340ORhypothetical protein, conservedANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_155340 OR hypothetical protein, conserved AND Entamoeba dispar SAW760 |
|
EDI_156850 | EDI_156850A | 1 | 1 | 1 | | | forward | protein coding | No | 936 | EDI_156850 | cysteine proteinase 3 precursor, putative | cysteine proteinase 3 precursor, putative | 5883177 | B0EIS2 | Not Assigned | DS549491:13,564..14,499(+) | DS549491:13564..14499(+) | DS549491 | Entamoeba dispar SAW760 | 94 | OG6_100116 | 6 | 311 | 936 | 33644 | 7.72 | 0 | HMM: MFGLLLFVAAATAIDFKSWAA, NN: MFGLLLFVAAATAI | NN Sum: 3, NN D: .62, HMM Prob: .98 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.22.16 (Cathepsin H) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_156850ORcysteine proteinase 3 precursor, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_156850 OR cysteine proteinase 3 precursor, putative AND Entamoeba dispar SAW760 |
|
EDI_158600 | EDI_158600A | 2 | 2 | 1 | | | reverse | protein coding | No | 702 | EDI_158600 | presenilin hop-1, putative | presenilin hop-1, putative | 5880032 | B0E9S5 | Not Assigned | DS548377:37,446..38,201(-) | DS548377:37446..38201(-) | DS548377 | Entamoeba dispar SAW760 | 9 | OG6_101989 | 0 | 233 | 702 | 25675 | 7.12 | 5 | HMM: MLFGGSIMKSLLSVFNWPIDWISFAFLLFNFGILGVVSI, NN: MLFGGSIMKSLLSVFNWPIDWISFAFLLFNFGILGV | NN Sum: 2, NN D: .51, HMM Prob: .15 | GO:0016021 | integral component of membrane | GO:0004190 | aspartic-type endopeptidase activity | GO:0016485 | protein processing | | | | | | | 3.4.23.- (Aspartic endopeptidases.) | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_158600ORpresenilin hop-1, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_158600 OR presenilin hop-1, putative AND Entamoeba dispar SAW760 |
|
EDI_158830 | EDI_158830A | 1 | 1 | 1 | | | forward | protein coding | No | 654 | EDI_158830 | hypothetical protein | hypothetical protein | 5884828 | B0ENG8 | Not Assigned | DS550095:865..1,518(+) | DS550095:865..1518(+) | DS550095 | Entamoeba dispar SAW760 | 36 | OG6_113471 | 6 | 218 | 654 | 24527 | 4.75 | 1 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_158830ORhypothetical proteinANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_158830 OR hypothetical protein AND Entamoeba dispar SAW760 |
|
EDI_162620 | EDI_162620A | 3 | 3 | 1 | | | reverse | protein coding | No | 2427 | EDI_162620 | heat shock protein, putative | heat shock protein, putative | 5882980 | B0EI70 | Not Assigned | DS549404:6,789..9,383(-) | DS549404:6789..9383(-) | DS549404 | Entamoeba dispar SAW760 | 33 | OG6_100223 | 26 | 808 | 2427 | 91363 | 8.73 | 0 | | | | | GO:0005524 | ATP binding | GO:0019538 | protein metabolic process | | | | | | | 3.4.21.53 (Endopeptidase La);3.6.4.3 (Transferred entry: 5.6.1.1) | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_162620ORheat shock protein, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_162620 OR heat shock protein, putative AND Entamoeba dispar SAW760 |
|
EDI_163010 | EDI_163010A | 2 | 2 | 1 | | | forward | protein coding | No | 678 | EDI_163010 | proteasome subunit beta type-4 precursor, putative | proteasome subunit beta type-4 precursor, putative | 5881058 | | Not Assigned | DS548793:12,189..12,916(+) | DS548793:12189..12916(+) | DS548793 | Entamoeba dispar SAW760 | 11 | OG6_101718 | 1 | 225 | 678 | 24982 | 4.84 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_163010ORproteasome subunit beta type-4 precursor, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_163010 OR proteasome subunit beta type-4 precursor, putative AND Entamoeba dispar SAW760 |
|
EDI_165730 | EDI_165730A | 1 | 1 | 1 | | | forward | protein coding | No | 750 | EDI_165730 | proteasome subunit alpha type-4, putative | proteasome subunit alpha type-4, putative | 5883446 | | Not Assigned | DS549565:50,495..51,244(+) | DS549565:50495..51244(+) | DS549565 | Entamoeba dispar SAW760 | 9 | OG6_101968 | 1 | 249 | 750 | 28190 | 6.29 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_165730ORproteasome subunit alpha type-4, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_165730 OR proteasome subunit alpha type-4, putative AND Entamoeba dispar SAW760 |
|
EDI_165910 | EDI_165910A | 1 | 1 | 1 | | | forward | protein coding | No | 1551 | EDI_165910 | aminoacyl-histidine dipeptidase, putative | aminoacyl-histidine dipeptidase, putative | 5883464 | B0EJK7 | Not Assigned | DS549565:86,277..87,827(+) | DS549565:86277..87827(+) | DS549565 | Entamoeba dispar SAW760 | 19 | OG6_112555 | 1 | 516 | 1551 | 57105 | 6.06 | 0 | | | | | GO:0016787 | hydrolase activity | GO:0008152;GO:0006508 | metabolic process;proteolysis | | | | | | | 3.4.13.3 (Transferred entry: 3.4.13.18 and 3.4.13.20) | 3.4.13.3 (Transferred entry: 3.4.13.18 and 3.4.13.20) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_165910ORaminoacyl-histidine dipeptidase, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_165910 OR aminoacyl-histidine dipeptidase, putative AND Entamoeba dispar SAW760 |
|
EDI_167820 | EDI_167820A | 2 | 2 | 1 | | 1 | forward | protein coding | No | 796 | EDI_167820 | hypothetical protein, conserved | hypothetical protein, conserved | 5885056 | B0EP47 | Not Assigned | DS550192:53,091..53,934(+) | DS550192:53092..53934(+) | DS550192 | Entamoeba dispar SAW760 | 9 | OG6_114754 | 1 | 264 | 795 | 30878 | 4.91 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_167820ORhypothetical protein, conservedANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_167820 OR hypothetical protein, conserved AND Entamoeba dispar SAW760 |
|
EDI_168350 | EDI_168350A | 1 | 1 | 1 | | | forward | protein coding | No | 1509 | EDI_168350 | hypothetical protein, conserved | hypothetical protein, conserved | 5879897 | B0E9E1 | Not Assigned | DS548337:8,487..9,995(+) | DS548337:8487..9995(+) | DS548337 | Entamoeba dispar SAW760 | 36 | OG6_113471 | 6 | 502 | 1509 | 58058 | 4.78 | 0 | HMM: MRLGYLLLFILIVYGK, NN: MRLGYLLLFILIVYGKLPNKWAY | NN Sum: 4, NN D: .78, HMM Prob: .99 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_168350ORhypothetical protein, conservedANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_168350 OR hypothetical protein, conserved AND Entamoeba dispar SAW760 |
|
EDI_175060 | EDI_175060A | 1 | 1 | 1 | | | reverse | protein coding | No | 4893 | EDI_175060 | ubiquitin specific protease, putative | ubiquitin specific protease, putative | 5884535 | B0EMM7 | Not Assigned | DS550011:14,449..19,341(-) | DS550011:14449..19341(-) | DS550011 | Entamoeba dispar SAW760 | 16 | OG6_204261 | 1 | 1630 | 4893 | 190557 | 7.04 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | 3.1.2.15 (Deleted entry);3.1.4.17 (3',5'-cyclic-nucleotide phosphodiesterase) | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_175060ORubiquitin specific protease, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_175060 OR ubiquitin specific protease, putative AND Entamoeba dispar SAW760 |
|
EDI_184800 | EDI_184800A | 2 | 2 | 1 | | | reverse | protein coding | No | 819 | EDI_184800 | hypothetical protein, conserved | hypothetical protein, conserved | 5885765 | B0ER62 | Not Assigned | DS550455:7,664..8,526(-) | DS550455:7664..8526(-) | DS550455 | Entamoeba dispar SAW760 | 8 | OG6_144711 | 1 | 272 | 819 | 31169 | 4.71 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_184800ORhypothetical protein, conservedANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_184800 OR hypothetical protein, conserved AND Entamoeba dispar SAW760 |
|
EDI_187610 | EDI_187610A | 3 | 3 | 1 | | | reverse | protein coding | No | 2154 | EDI_187610 | hypothetical protein | hypothetical protein | 5885371 | B0EQ02 | Not Assigned | DS550329:145..2,441(-) | DS550329:145..2441(-) | DS550329 | Entamoeba dispar SAW760 | 8 | OG6_501693 | 0 | 717 | 2154 | 85980 | 8.67 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_187610ORhypothetical proteinANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_187610 OR hypothetical protein AND Entamoeba dispar SAW760 |
|
EDI_188550 | EDI_188550A | 1 | 1 | 1 | | | reverse | protein coding | No | 1197 | EDI_188550 | acetylornithine deacetylase, putative | acetylornithine deacetylase, putative | 5885856 | B0ERF8 | Not Assigned | DS550511:8,481..9,677(-) | DS550511:8481..9677(-) | DS550511 | Entamoeba dispar SAW760 | 20 | OG6_100626 | 1 | 398 | 1197 | 44930 | 4.93 | 0 | | | | | GO:0016787 | hydrolase activity | GO:0008152 | metabolic process | | | | | | | 3.5.1.18 (Succinyl-diaminopimelate desuccinylase) | 3.5.1.16 (Acetylornithine deacetylase) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_188550ORacetylornithine deacetylase, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_188550 OR acetylornithine deacetylase, putative AND Entamoeba dispar SAW760 |
|
EDI_190570 | EDI_190570A | 1 | 1 | 1 | | | forward | protein coding | No | 1653 | EDI_190570 | hypothetical protein, conserved | hypothetical protein, conserved | 5878732 | B0E625 | Not Assigned | DS547850:18,445..20,097(+) | DS547850:18445..20097(+) | DS547850 | Entamoeba dispar SAW760 | 36 | OG6_113471 | 6 | 550 | 1653 | 63082 | 5.43 | 1 | HMM: MGCSRITQKLFFTVLEWAVLIATIVSIILIITSVISF, NN: MGCSRITQKLFFTVLEWAVLIATIVSIILIITSVISF | NN Sum: 4, NN D: .73, HMM Prob: 0 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_190570ORhypothetical protein, conservedANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_190570 OR hypothetical protein, conserved AND Entamoeba dispar SAW760 |
|
EDI_190630 | EDI_190630A | 1 | 1 | 1 | | | forward | protein coding | No | 1518 | EDI_190630 | aminoacyl-histidine dipeptidase, putative | aminoacyl-histidine dipeptidase, putative | 5878738 | B0E631 | Not Assigned | DS547850:31,939..33,456(+) | DS547850:31939..33456(+) | DS547850 | Entamoeba dispar SAW760 | 19 | OG6_112555 | 1 | 505 | 1518 | 56184 | 5.07 | 0 | | | | | GO:0016787 | hydrolase activity | GO:0008152;GO:0006508 | metabolic process;proteolysis | | | | | | | 3.4.13.3 (Transferred entry: 3.4.13.18 and 3.4.13.20) | 3.4.13.3 (Transferred entry: 3.4.13.18 and 3.4.13.20) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_190630ORaminoacyl-histidine dipeptidase, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_190630 OR aminoacyl-histidine dipeptidase, putative AND Entamoeba dispar SAW760 |
|
EDI_191970 | EDI_191970A | 1 | 1 | 1 | | | forward | protein coding | No | 1197 | EDI_191970 | 26S protease regulatory subunit, putative | 26S protease regulatory subunit, putative | 5879722 | B0E8W6 | Not Assigned | DS548225:11,248..12,444(+) | DS548225:11248..12444(+) | DS548225 | Entamoeba dispar SAW760 | 8 | OG6_101513 | 1 | 398 | 1197 | 44797 | 8.65 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | | | | | | | 3.6.4.3 (Transferred entry: 5.6.1.1) | 3.6.4.3 (Transferred entry: 5.6.1.1) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_191970OR26S protease regulatory subunit, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_191970 OR 26S protease regulatory subunit, putative AND Entamoeba dispar SAW760 |
|
EDI_192220 | EDI_192220A | 1 | 1 | 1 | | | forward | protein coding | No | 948 | EDI_192220 | minor histocompatibility antigen H13, putative | minor histocompatibility antigen H13, putative | 5882912 | B0EI00 | Not Assigned | DS549357:3,299..4,246(+) | DS549357:3299..4246(+) | DS549357 | Entamoeba dispar SAW760 | 14 | OG6_184292 | 1 | 315 | 948 | 36045 | 8.43 | 7 | HMM: MDELLYLIVTLVVIHYLSSK, NN: MDELLYLIVTLVVIHYLSSK | NN Sum: 3, NN D: .59, HMM Prob: .48 | GO:0016021 | integral component of membrane | GO:0004190 | aspartic-type endopeptidase activity | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_192220ORminor histocompatibility antigen H13, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_192220 OR minor histocompatibility antigen H13, putative AND Entamoeba dispar SAW760 |
|
EDI_198000 | EDI_198000A | 1 | 1 | 1 | | | forward | protein coding | No | 2421 | EDI_198000 | hypothetical protein | hypothetical protein | 5885176 | B0EPG6 | Not Assigned | DS550270:20,778..23,198(+) | DS550270:20778..23198(+) | DS550270 | Entamoeba dispar SAW760 | 18 | OG6_101457 | 1 | 806 | 2421 | 93571 | 5.11 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_198000ORhypothetical proteinANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_198000 OR hypothetical protein AND Entamoeba dispar SAW760 |
|
EDI_201400 | EDI_201400A | 1 | 1 | 1 | | | forward | protein coding | No | 1188 | EDI_201400 | 1-O-acylceramide synthase precursor, putative | 1-O-acylceramide synthase precursor, putative | 5914187 | B0ETU8 | Not Assigned | DS550832:39,566..40,753(+) | DS550832:39566..40753(+) | DS550832 | Entamoeba dispar SAW760 | 86 | OG6_101376 | 11 | 395 | 1188 | 45489 | 8.58 | 0 | HMM: MIAPLFIFIWFDFTIACSS, NN: MIAPLFIFIWFDFTIAC | NN Sum: 4, NN D: .72, HMM Prob: .88 | | | GO:0008374 | O-acyltransferase activity | GO:0006629 | lipid metabolic process | | | | | | | 2.3.1.43 (Phosphatidylcholine--sterol O-acyltransferase) | 2.3.1.43 (Phosphatidylcholine--sterol O-acyltransferase) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_201400OR1-O-acylceramide synthase precursor, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_201400 OR 1-O-acylceramide synthase precursor, putative AND Entamoeba dispar SAW760 |
|
EDI_201690 | EDI_201690A | 2 | 2 | 1 | | | forward | protein coding | No | 921 | EDI_201690 | acetylornithine deacetylase, putative | acetylornithine deacetylase, putative | 5914216 | B0ETW5 | Not Assigned | DS550832:94,944..95,912(+) | DS550832:94944..95912(+) | DS550832 | Entamoeba dispar SAW760 | 20 | OG6_100626 | 1 | 306 | 921 | 34416 | 4.48 | 0 | | | | | GO:0016787 | hydrolase activity | GO:0008152 | metabolic process | | | | | | | 3.5.1.16 (Acetylornithine deacetylase) | 3.5.1.16 (Acetylornithine deacetylase) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_201690ORacetylornithine deacetylase, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_201690 OR acetylornithine deacetylase, putative AND Entamoeba dispar SAW760 |
|
EDI_201800 | EDI_201800A | 2 | 2 | 1 | | | forward | protein coding | No | 882 | EDI_201800 | hypothetical protein | hypothetical protein | 5914226 | B0ETX5 | Not Assigned | DS550832:111,777..112,708(+) | DS550832:111777..112708(+) | DS550832 | Entamoeba dispar SAW760 | 8 | OG6_501753 | 0 | 293 | 882 | 34047 | 5.18 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_201800ORhypothetical proteinANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_201800 OR hypothetical protein AND Entamoeba dispar SAW760 |
|
EDI_203900 | EDI_203900A | 1 | 1 | 1 | | | forward | protein coding | No | 1704 | EDI_203900 | hypothetical protein, conserved | hypothetical protein, conserved | 5886265 | B0ESI4 | Not Assigned | DS550691:3,661..5,364(+) | DS550691:3661..5364(+) | DS550691 | Entamoeba dispar SAW760 | 32 | OG6_159401 | 3 | 567 | 1704 | 64686 | 5.36 | 1 | HMM: , NN: MPSTSEIEDPLINDGEMKEKKPVKQKWLWSLYIILTVMSIITLAL | NN Sum: 3, NN D: .46, HMM Prob: 0 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_203900ORhypothetical protein, conservedANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_203900 OR hypothetical protein, conserved AND Entamoeba dispar SAW760 |
|
EDI_204080 | EDI_204080A | 2 | 2 | 1 | | | forward | protein coding | No | 936 | EDI_204080 | ubiquitin carboxyl-terminal hydrolase isozyme L5, putative | ubiquitin carboxyl-terminal hydrolase isozyme L5, putative | 5886233 | B0ESJ2 | Not Assigned | DS550691:19,151..20,134(+) | DS550691:19151..20134(+) | DS550691 | Entamoeba dispar SAW760 | 10 | OG6_102753 | 0 | 311 | 936 | 36027 | 4.96 | 0 | | | GO:0005622 | intracellular | GO:0004843 | thiol-dependent ubiquitin-specific protease activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_204080ORubiquitin carboxyl-terminal hydrolase isozyme L5, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_204080 OR ubiquitin carboxyl-terminal hydrolase isozyme L5, putative AND Entamoeba dispar SAW760 |
|
EDI_204310 | EDI_204310A | 1 | 1 | 1 | | | reverse | protein coding | No | 1734 | EDI_204310 | xaa-pro aminopeptidase, putative | xaa-pro aminopeptidase, putative | 5886251 | B0ESK5 | Not Assigned | DS550691:36,570..38,303(-) | DS550691:36570..38303(-) | DS550691 | Entamoeba dispar SAW760 | 20 | OG6_100896 | 1 | 577 | 1734 | 67314 | 6.55 | 0 | | | | | | | | | | | | | | | 3.4.11.9 (Xaa-Pro aminopeptidase) | 3.4.11.9 (Xaa-Pro aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_204310ORxaa-pro aminopeptidase, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_204310 OR xaa-pro aminopeptidase, putative AND Entamoeba dispar SAW760 |
|
EDI_213650 | EDI_213650A | 1 | 1 | 1 | | | forward | protein coding | No | 2676 | EDI_213650 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | 5879448 | B0E842 | Not Assigned | DS548107:17,806..20,481(+) | DS548107:17806..20481(+) | DS548107 | Entamoeba dispar SAW760 | 14 | OG6_100913 | 0 | 891 | 2676 | 104480 | 5.09 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | 2.4.1.11 (Glycogen(starch) synthase);2.7.7.47 (Streptomycin 3''-adenylyltransferase);3.1.2.15 (Deleted entry) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_213650ORubiquitin carboxyl-terminal hydrolase, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_213650 OR ubiquitin carboxyl-terminal hydrolase, putative AND Entamoeba dispar SAW760 |
|
EDI_216570 | EDI_216570A | 1 | 1 | 1 | | | forward | protein coding | No | 1206 | EDI_216570 | peptidase T, putative | peptidase T, putative | 5883887 | B0EKS8 | Not Assigned | DS549789:16,227..17,432(+) | DS549789:16227..17432(+) | DS549789 | Entamoeba dispar SAW760 | 18 | OG6_111055 | 1 | 401 | 1206 | 44905 | 5.09 | 0 | | | | | GO:0016787 | hydrolase activity | GO:0008152 | metabolic process | | | | | | | 3.4.11.4 (Tripeptide aminopeptidase) | 3.4.11.4 (Tripeptide aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_216570ORpeptidase T, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_216570 OR peptidase T, putative AND Entamoeba dispar SAW760 |
|
EDI_217900 | EDI_217900A | 2 | 2 | 1 | | | reverse | protein coding | No | 1953 | EDI_217900 | cysteine proteinase 2 precursor, putative | cysteine proteinase 2 precursor, putative | 5884862 | B0ENK4 | Not Assigned | DS550122:16,195..18,208(-) | DS550122:16195..18208(-) | DS550122 | Entamoeba dispar SAW760 | 41 | OG6_159415 | 2 | 650 | 1953 | 73713 | 5.23 | 1 | HMM: MKGITIKVVLLFAIYTLAQ, NN: MKGITIKVVLLFAIYTLAQ | NN Sum: 4, NN D: .81, HMM Prob: .97 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.22.16 (Cathepsin H) | 3.4.22.50 (V-cath endopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_217900ORcysteine proteinase 2 precursor, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_217900 OR cysteine proteinase 2 precursor, putative AND Entamoeba dispar SAW760 |
|
EDI_220270 | EDI_220270A | 1 | 1 | 1 | | | forward | protein coding | No | 615 | EDI_220270 | hypothetical protein | hypothetical protein | 5883051 | B0EIE3 | Not Assigned | DS549438:219..833(+) | DS549438:219..833(+) | DS549438 | Entamoeba dispar SAW760 | 36 | OG6_113471 | 6 | 204 | 615 | 23977 | 4.64 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_220270ORhypothetical proteinANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_220270 OR hypothetical protein AND Entamoeba dispar SAW760 |
|
EDI_220380 | EDI_220380A | 1 | 1 | 1 | | | reverse | protein coding | No | 393 | EDI_220380 | proteasome subunit alpha type-3, putative | proteasome subunit alpha type-3, putative | 5879305 | B0E7P1 | Not Assigned | DS548059:1,423..1,815(-) | DS548059:1423..1815(-) | DS548059 | Entamoeba dispar SAW760 | 10 | OG6_102011 | 1 | 130 | 393 | 15053 | 7.45 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_220380ORproteasome subunit alpha type-3, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_220380 OR proteasome subunit alpha type-3, putative AND Entamoeba dispar SAW760 |
|
EDI_221540 | EDI_221540A | 1 | 1 | 1 | | | forward | protein coding | No | 583 | EDI_221540 | chaperone Clpb, putative | chaperone Clpb, putative | 5884080 | B0ELC0 | Not Assigned | DS549820:1,004..1,586(+) | DS549820:1004..1586(+) | DS549820 | Entamoeba dispar SAW760 | 33 | OG6_100223 | 26 | 194 | 583 | 22142 | 5.48 | 0 | | | | | | | GO:0019538 | protein metabolic process | | | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_221540ORchaperone Clpb, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_221540 OR chaperone Clpb, putative AND Entamoeba dispar SAW760 |
|
EDI_223400 | EDI_223400A | 1 | 1 | 1 | | | forward | protein coding | No | 989 | EDI_223400 | chaperone Clpb, putative | chaperone Clpb, putative | 5886414 | B0ET17 | Not Assigned | DS550757:66..1,054(+) | DS550757:66..1054(+) | DS550757 | Entamoeba dispar SAW760 | 33 | OG6_100223 | 26 | 329 | 989 | 36783 | 6.35 | 0 | | | | | GO:0005524 | ATP binding | GO:0019538 | protein metabolic process | | | | | | | 3.6.4.3 (Transferred entry: 5.6.1.1) | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_223400ORchaperone Clpb, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_223400 OR chaperone Clpb, putative AND Entamoeba dispar SAW760 |
|
EDI_223610 | EDI_223610A | 1 | 1 | 1 | | | reverse | protein coding | No | 408 | EDI_223610 | 26S protease regulatory subunit, putative | 26S protease regulatory subunit, putative | 5884581 | B0EMS1 | Not Assigned | DS550036:808..1,215(-) | DS550036:808..1215(-) | DS550036 | Entamoeba dispar SAW760 | 10 | OG6_101899 | 1 | 135 | 408 | 15313 | 9.75 | 0 | | | | | GO:0005524 | ATP binding | | | | | | | | | 3.6.4.6 (Vesicle-fusing ATPase) | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_223610OR26S protease regulatory subunit, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_223610 OR 26S protease regulatory subunit, putative AND Entamoeba dispar SAW760 |
|
EDI_225370 | EDI_225370A | 1 | 1 | 1 | | | reverse | protein coding | No | 2601 | EDI_225370 | heat shock protein, putative | heat shock protein, putative | 5881779 | B0EES1 | Not Assigned | DS548963:1,323..3,923(-) | DS548963:1323..3923(-) | DS548963 | Entamoeba dispar SAW760 | 33 | OG6_100223 | 26 | 866 | 2601 | 98251 | 6.34 | 0 | | | | | GO:0005524 | ATP binding | GO:0019538 | protein metabolic process | | | | | | | 3.4.21.53 (Endopeptidase La) | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_225370ORheat shock protein, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_225370 OR heat shock protein, putative AND Entamoeba dispar SAW760 |
|
EDI_226130 | EDI_226130A | 1 | 1 | 1 | | | forward | protein coding | No | 702 | EDI_226130 | hypothetical protein, conserved | hypothetical protein, conserved | 5882338 | B0EGD1 | Not Assigned | DS549197:13,482..14,183(+) | DS549197:13482..14183(+) | DS549197 | Entamoeba dispar SAW760 | 8 | OG6_144711 | 1 | 233 | 702 | 26776 | 4.61 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_226130ORhypothetical protein, conservedANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_226130 OR hypothetical protein, conserved AND Entamoeba dispar SAW760 |
|
EDI_233520 | EDI_233520A | 2 | 2 | 1 | | | forward | protein coding | No | 2289 | EDI_233520 | hypothetical protein | hypothetical protein | 5878836 | B0E6B2 | Not Assigned | DS547873:3,561..5,902(+) | DS547873:3561..5902(+) | DS547873 | Entamoeba dispar SAW760 | 8 | OG6_502871 | 0 | 762 | 2289 | 88533 | 5.24 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_233520ORhypothetical proteinANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_233520 OR hypothetical protein AND Entamoeba dispar SAW760 |
|
EDI_235000 | EDI_235000A | 1 | 1 | 1 | | | reverse | protein coding | No | 744 | EDI_235000 | proteasome subunit alpha type-5 | proteasome subunit alpha type-5 | 5884052 | B0EL94 | Not Assigned | DS549815:22,073..22,816(-) | DS549815:22073..22816(-) | DS549815 | Entamoeba dispar SAW760 | 6 | OG6_101621 | 1 | 247 | 744 | 27287 | 4.96 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_235000ORproteasome subunit alpha type-5ANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_235000 OR proteasome subunit alpha type-5 AND Entamoeba dispar SAW760 |
|
EDI_238810 | EDI_238810A | 1 | 1 | 1 | | | forward | protein coding | No | 3345 | EDI_238810 | antigenic protein NP1, putative | antigenic protein NP1, putative | 5882757 | B0EHJ4 | Not Assigned | DS549328:5,746..9,090(+) | DS549328:5746..9090(+) | DS549328 | Entamoeba dispar SAW760 | 19 | OG6_114489 | 0 | 1114 | 3345 | 125747 | 5.25 | 1 | HMM: MLGTKGIIAIVAIASAIVTGV, NN: MLGTKGIIAIVAIASAIVTGVIIIVVVVTLSV | NN Sum: 3, NN D: .64, HMM Prob: 0 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_238810ORantigenic protein NP1, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_238810 OR antigenic protein NP1, putative AND Entamoeba dispar SAW760 |
|
EDI_243160 | EDI_243160A | 1 | 1 | 1 | | | reverse | protein coding | No | 954 | EDI_243160 | cathepsin H precursor, putative | cathepsin H precursor, putative | 5885484 | B0EQC1 | Not Assigned | DS550368:10,192..11,145(-) | DS550368:10192..11145(-) | DS550368 | Entamoeba dispar SAW760 | 6 | OG6_501781 | 0 | 317 | 954 | 37083 | 8.05 | 0 | HMM: MLFILLFTLSFAFTF, NN: MLFILLFTLSFAFTFDD | NN Sum: 2, NN D: .57, HMM Prob: .89 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.22.16 (Cathepsin H) | 3.4.22.16 (Cathepsin H) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_243160ORcathepsin H precursor, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_243160 OR cathepsin H precursor, putative AND Entamoeba dispar SAW760 |
|
EDI_245360 | EDI_245360A | 2 | 2 | 1 | | | reverse | protein coding | No | 1329 | EDI_245360 | calpain, putative | calpain, putative | 5881578 | B0EE72 | Not Assigned | DS548917:38,089..39,513(-) | DS548917:38089..39513(-) | DS548917 | Entamoeba dispar SAW760 | 10 | OG6_104309 | 0 | 442 | 1329 | 49733 | 6.73 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | 2.7.11.1 (Non-specific serine/threonine protein kinase);3.4.22.53 (Calpain-2) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_245360ORcalpain, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_245360 OR calpain, putative AND Entamoeba dispar SAW760 |
|
EDI_249350 | EDI_249350A | 1 | 1 | 1 | | | forward | protein coding | No | 750 | EDI_249350 | proteasome subunit alpha type-1, putative | proteasome subunit alpha type-1, putative | 5879843 | B0E986 | Not Assigned | DS548293:28,915..29,664(+) | DS548293:28915..29664(+) | DS548293 | Entamoeba dispar SAW760 | 10 | OG6_102143 | 0 | 249 | 750 | 28136 | 5.39 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_249350ORproteasome subunit alpha type-1, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_249350 OR proteasome subunit alpha type-1, putative AND Entamoeba dispar SAW760 |
|
EDI_251610 | EDI_251610A | 1 | 1 | 1 | | | reverse | protein coding | No | 1884 | EDI_251610 | hypothetical protein | hypothetical protein | 5879040 | B0E6Y3 | Not Assigned | DS547933:78,096..79,979(-) | DS547933:78096..79979(-) | DS547933 | Entamoeba dispar SAW760 | 32 | OG6_159401 | 3 | 627 | 1884 | 72289 | 5.03 | 1 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_251610ORhypothetical proteinANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_251610 OR hypothetical protein AND Entamoeba dispar SAW760 |
|
EDI_251670 | EDI_251670A | 1 | 1 | 1 | | | reverse | protein coding | No | 2010 | EDI_251670 | dipeptidyl-peptidase 5 precursor, putative | dipeptidyl-peptidase 5 precursor, putative | 5879046 | B0E6Y9 | Not Assigned | DS547933:87,425..89,434(-) | DS547933:87425..89434(-) | DS547933 | Entamoeba dispar SAW760 | 8 | OG6_108070 | 0 | 669 | 2010 | 76045 | 4.95 | 0 | HMM: MISLLWLTIGIVSALTAN, NN: MISLLWLTIGIVSALTA | NN Sum: 3, NN D: .71, HMM Prob: .99 | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.19.1 (Acylaminoacyl-peptidase) | 1.11.1.10 (Chloride peroxidase) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_251670ORdipeptidyl-peptidase 5 precursor, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_251670 OR dipeptidyl-peptidase 5 precursor, putative AND Entamoeba dispar SAW760 |
|
EDI_251750 | EDI_251750A | 1 | 1 | 1 | | | reverse | protein coding | No | 516 | EDI_251750 | hypothetical protein, conserved | hypothetical protein, conserved | 5879054 | B0E6Z7 | Not Assigned | DS547933:99,759..100,274(-) | DS547933:99759..100274(-) | DS547933 | Entamoeba dispar SAW760 | 10 | OG6_101256 | 0 | 171 | 516 | 19648 | 8.45 | 0 | | | | | | | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_251750ORhypothetical protein, conservedANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_251750 OR hypothetical protein, conserved AND Entamoeba dispar SAW760 |
|
EDI_252380 | EDI_252380A | 1 | 1 | 1 | | | forward | protein coding | No | 1260 | EDI_252380 | cathepsin L, putative | cathepsin L, putative | 5881908 | B0EF53 | Not Assigned | DS549025:4,339..5,598(+) | DS549025:4339..5598(+) | DS549025 | Entamoeba dispar SAW760 | 8 | OG6_502820 | 0 | 419 | 1260 | 49459 | 8.55 | 0 | HMM: MNIINVVILMLFVNCFGD, NN: MNIINVVILMLFVNCFGD | NN Sum: 4, NN D: .75, HMM Prob: .73 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | 1.3.1.74 (2-alkenal reductase (NAD(P)(+))) | | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_252380ORcathepsin L, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_252380 OR cathepsin L, putative AND Entamoeba dispar SAW760 |
|
EDI_253820 | EDI_253820A | 1 | 1 | 1 | | | forward | protein coding | No | 738 | EDI_253820 | serine-rich 25 kDa antigen protein, putative | serine-rich 25 kDa antigen protein, putative | 5880601 | B0EBE4 | Not Assigned | DS548582:7,103..7,840(+) | DS548582:7103..7840(+) | DS548582 | Entamoeba dispar SAW760 | 12 | OG6_110485 | 0 | 245 | 738 | 26290 | 3.97 | 0 | HMM: MFTFLLFIAFTTAT, NN: MFTFLLFIAFTTAT | NN Sum: 4, NN D: .73, HMM Prob: .9 | | | | | | | | | | | | | 3.2.1.52 (Beta-N-acetylhexosaminidase) | | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_253820ORserine-rich 25 kDa antigen protein, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_253820 OR serine-rich 25 kDa antigen protein, putative AND Entamoeba dispar SAW760 |
|
EDI_255230 | EDI_255230A | 1 | 1 | 1 | | | forward | protein coding | No | 1665 | EDI_255230 | hypothetical protein, conserved | hypothetical protein, conserved | 5885536 | B0EQH6 | Not Assigned | DS550383:43,089..44,753(+) | DS550383:43089..44753(+) | DS550383 | Entamoeba dispar SAW760 | 36 | OG6_113471 | 6 | 554 | 1665 | 63973 | 4.69 | 1 | HMM: MFLSKLSAFPITQKVAVILIFLVLMIQFGVMLY, NN: MFLSKLSAFPITQKVAVILIFLVLMIQFGVMLY | NN Sum: 3, NN D: .58, HMM Prob: .06 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_255230ORhypothetical protein, conservedANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_255230 OR hypothetical protein, conserved AND Entamoeba dispar SAW760 |
|
EDI_258920 | EDI_258920A | 1 | 1 | 1 | | | reverse | protein coding | No | 1749 | EDI_258920 | xaa-pro aminopeptidase, putative | xaa-pro aminopeptidase, putative | 5882958 | B0EI50 | Not Assigned | DS549397:642..2,390(-) | DS549397:642..2390(-) | DS549397 | Entamoeba dispar SAW760 | 20 | OG6_100896 | 1 | 582 | 1749 | 67613 | 5.32 | 0 | | | | | GO:0016787 | hydrolase activity | | | | | | | | | 3.4.11.9 (Xaa-Pro aminopeptidase) | 3.4.11.9 (Xaa-Pro aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_258920ORxaa-pro aminopeptidase, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_258920 OR xaa-pro aminopeptidase, putative AND Entamoeba dispar SAW760 |
|
EDI_259240 | EDI_259240A | 1 | 1 | 1 | | | forward | protein coding | No | 684 | EDI_259240 | chaperone Clpb, putative | chaperone Clpb, putative | 5885155 | B0EPE4 | Not Assigned | DS550241:30..713(+) | DS550241:30..713(+) | DS550241 | Entamoeba dispar SAW760 | 33 | OG6_100223 | 26 | 227 | 684 | 25813 | 9.56 | 0 | | | | | GO:0005524 | ATP binding | | | | | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_259240ORchaperone Clpb, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_259240 OR chaperone Clpb, putative AND Entamoeba dispar SAW760 |
|
EDI_273000 | EDI_273000A | 1 | 1 | 1 | | | reverse | protein coding | No | 738 | EDI_273000 | proteasome subunit alpha type-7, putative | proteasome subunit alpha type-7, putative | 5914272 | | Not Assigned | DS550842:45,793..46,530(-) | DS550842:45793..46530(-) | DS550842 | Entamoeba dispar SAW760 | 11 | OG6_101207 | 1 | 245 | 738 | 27469 | 6.30 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_273000ORproteasome subunit alpha type-7, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_273000 OR proteasome subunit alpha type-7, putative AND Entamoeba dispar SAW760 |
|
EDI_276390 | EDI_276390A | 2 | 2 | 1 | | | forward | protein coding | No | 1122 | EDI_276390 | hypothetical protein | hypothetical protein | 5881418 | B0EDR5 | Not Assigned | DS548835:11,300..12,476(+) | DS548835:11300..12476(+) | DS548835 | Entamoeba dispar SAW760 | 32 | OG6_159401 | 3 | 373 | 1122 | 42894 | 7.96 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_276390ORhypothetical proteinANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_276390 OR hypothetical protein AND Entamoeba dispar SAW760 |
|
EDI_276460 | EDI_276460A | 1 | 1 | 1 | | | reverse | protein coding | No | 1239 | EDI_276460 | hypothetical protein | hypothetical protein | 5881426 | B0EDS2 | Not Assigned | DS548835:23,727..24,965(-) | DS548835:23727..24965(-) | DS548835 | Entamoeba dispar SAW760 | 8 | OG6_502768 | 0 | 412 | 1239 | 47059 | 5.48 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_276460ORhypothetical proteinANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_276460 OR hypothetical protein AND Entamoeba dispar SAW760 |
|
EDI_276880 | EDI_276880A | 3 | 3 | 1 | | | reverse | protein coding | No | 1815 | EDI_276880 | hypothetical protein | hypothetical protein | 5882963 | B0EI62 | Not Assigned | DS549403:21,397..23,477(-) | DS549403:21397..23477(-) | DS549403 | Entamoeba dispar SAW760 | 9 | OG6_503175 | 0 | 604 | 1815 | 69989 | 8.03 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_276880ORhypothetical proteinANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_276880 OR hypothetical protein AND Entamoeba dispar SAW760 |
|
EDI_277000 | EDI_277000A | 2 | 2 | 1 | | | reverse | protein coding | No | 1512 | EDI_277000 | hypothetical protein | hypothetical protein | 5882965 | B0EI64 | Not Assigned | DS549403:24,763..26,414(-) | DS549403:24763..26414(-) | DS549403 | Entamoeba dispar SAW760 | 13 | OG6_101924 | 1 | 503 | 1512 | 58001 | 8.23 | 0 | | | | | | | | | | | | | | | | 3.6.3.14 (Transferred entry: 7.1.2.2) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_277000ORhypothetical proteinANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_277000 OR hypothetical protein AND Entamoeba dispar SAW760 |
|
EDI_277850 | EDI_277850A | 1 | 1 | 1 | | | forward | protein coding | No | 597 | EDI_277850 | proteasome subunit beta type, putative | proteasome subunit beta type, putative | 5881073 | B0ECS2 | Not Assigned | DS548795:16,025..16,621(+) | DS548795:16025..16621(+) | DS548795 | Entamoeba dispar SAW760 | 11 | OG6_102061 | 0 | 198 | 597 | 22302 | 6.12 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_277850ORproteasome subunit beta type, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_277850 OR proteasome subunit beta type, putative AND Entamoeba dispar SAW760 |
|
EDI_278410 | EDI_278410A | 1 | 1 | 1 | | | reverse | protein coding | No | 594 | EDI_278410 | sentrin-specific protease, putative | sentrin-specific protease, putative | 5881134 | B0ECX8 | Not Assigned | DS548795:131,714..132,307(-) | DS548795:131714..132307(-) | DS548795 | Entamoeba dispar SAW760 | 11 | OG6_103852 | 0 | 197 | 594 | 22515 | 5.43 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | 3.6.1.5 (Apyrase) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_278410ORsentrin-specific protease, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_278410 OR sentrin-specific protease, putative AND Entamoeba dispar SAW760 |
|
EDI_278440 | EDI_278440A | 2 | 2 | 1 | | | forward | protein coding | No | 750 | EDI_278440 | proteasome subunit alpha type-4, putative | proteasome subunit alpha type-4, putative | 5881137 | | Not Assigned | DS548795:134,987..135,791(+) | DS548795:134987..135791(+) | DS548795 | Entamoeba dispar SAW760 | 9 | OG6_101968 | 1 | 249 | 750 | 28190 | 6.29 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_278440ORproteasome subunit alpha type-4, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_278440 OR proteasome subunit alpha type-4, putative AND Entamoeba dispar SAW760 |
|
EDI_280180 | EDI_280180A | 1 | 1 | 1 | | | reverse | protein coding | No | 900 | EDI_280180 | GPI-anchor transamidase precursor, putative | GPI-anchor transamidase precursor, putative | 5886786 | B0EV08 | Not Assigned | DS551005:29,462..30,361(-) | DS551005:29462..30361(-) | DS551005 | Entamoeba dispar SAW760 | 10 | OG6_101767 | 0 | 299 | 900 | 34899 | 6.51 | 0 | HMM: MNIIITLLLCFCFGIEQPQQNQAV, NN: MNIIITLLLCFCFGIEQPQQNQAV | NN Sum: 4, NN D: .59, HMM Prob: .97 | | | GO:0008233 | peptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.22.34 (Legumain) | 3.-.-.- (Hydrolases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_280180ORGPI-anchor transamidase precursor, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_280180 OR GPI-anchor transamidase precursor, putative AND Entamoeba dispar SAW760 |
|
EDI_281600 | EDI_281600A | 2 | 2 | 1 | | | forward | protein coding | No | 978 | EDI_281600 | hypothetical protein, conserved | hypothetical protein, conserved | 5885063 | B0EP54 | Not Assigned | DS550196:7,238..8,290(+) | DS550196:7238..8290(+) | DS550196 | Entamoeba dispar SAW760 | 31 | OG6_139788 | 3 | 325 | 978 | 37171 | 5.83 | 0 | | | | | | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_281600ORhypothetical protein, conservedANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_281600 OR hypothetical protein, conserved AND Entamoeba dispar SAW760 |
|
EDI_284230 | EDI_284230A | 1 | 1 | 1 | | | reverse | protein coding | No | 1443 | EDI_284230 | hypothetical protein, conserved | hypothetical protein, conserved | 5878517 | B0E5G2 | Not Assigned | DS547786:56,521..57,963(-) | DS547786:56521..57963(-) | DS547786 | Entamoeba dispar SAW760 | 24 | OG6_100644 | 2 | 480 | 1443 | 54202 | 4.61 | 0 | HMM: MFLFVLLFLSAYASLT, NN: MFLFVLLFLSAYASLT | NN Sum: 3, NN D: .64, HMM Prob: 1 | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.16.2 (Lysosomal Pro-Xaa carboxypeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_284230ORhypothetical protein, conservedANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_284230 OR hypothetical protein, conserved AND Entamoeba dispar SAW760 |
|
EDI_284250 | EDI_284250A | 1 | 1 | 1 | | | reverse | protein coding | No | 894 | EDI_284250 | protein bem46, putative | protein bem46, putative | 5878524 | B0E5G4 | Not Assigned | DS547786:59,672..60,565(-) | DS547786:59672..60565(-) | DS547786 | Entamoeba dispar SAW760 | 17 | OG6_101827 | 1 | 297 | 894 | 34139 | 4.99 | 1 | HMM: MIWEIIAGATALIMVLSGIYLF, NN: MIWEIIAGATALIMVLSGI | NN Sum: 3, NN D: .67, HMM Prob: .63 | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | 3.1.1.2 (Arylesterase) | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_284250ORprotein bem46, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_284250 OR protein bem46, putative AND Entamoeba dispar SAW760 |
|
EDI_284390 | EDI_284390A | 1 | 1 | 1 | | | forward | protein coding | No | 929 | EDI_284390 | chaperone Clpb, putative | chaperone Clpb, putative | 5879189 | B0E7D1 | Not Assigned | DS547982:1,104..2,032(+) | DS547982:1104..2032(+) | DS547982 | Entamoeba dispar SAW760 | 33 | OG6_100223 | 26 | 309 | 929 | 35738 | 5.45 | 0 | | | | | | | | | | | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_284390ORchaperone Clpb, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_284390 OR chaperone Clpb, putative AND Entamoeba dispar SAW760 |
|
EDI_285880 | EDI_285880A | 1 | 1 | 1 | | | forward | protein coding | No | 1483 | EDI_285880 | heat shock protein, putative | heat shock protein, putative | 5886522 | B0ETC9 | Not Assigned | DS550794:3,350..4,832(+) | DS550794:3350..4832(+) | DS550794 | Entamoeba dispar SAW760 | 33 | OG6_100223 | 26 | 494 | 1483 | 56111 | 5.90 | 0 | | | | | GO:0005524 | ATP binding | GO:0019538 | protein metabolic process | | | | | | | 3.6.4.3 (Transferred entry: 5.6.1.1) | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_285880ORheat shock protein, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_285880 OR heat shock protein, putative AND Entamoeba dispar SAW760 |
|
EDI_288920 | EDI_288920A | 1 | 1 | 1 | | | forward | protein coding | No | 792 | EDI_288920 | chaperone Clpb, putative | chaperone Clpb, putative | 5885951 | B0ERQ4 | Not Assigned | DS550534:122..913(+) | DS550534:122..913(+) | DS550534 | Entamoeba dispar SAW760 | 33 | OG6_100223 | 26 | 263 | 792 | 29774 | 8.64 | 0 | | | | | GO:0005524 | ATP binding | | | | | | | | | 3.4.21.53 (Endopeptidase La) | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_288920ORchaperone Clpb, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_288920 OR chaperone Clpb, putative AND Entamoeba dispar SAW760 |
|
EDI_289450 | EDI_289450A | 1 | 1 | 1 | | | reverse | protein coding | No | 852 | EDI_289450 | hypothetical protein | hypothetical protein | 5886866 | B0EV99 | Not Assigned | DS551057:5,291..6,142(-) | DS551057:5291..6142(-) | DS551057 | Entamoeba dispar SAW760 | 8 | OG6_204853 | 1 | 283 | 852 | 32664 | 8.19 | 7 | | | GO:0016020 | membrane | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_289450ORhypothetical proteinANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_289450 OR hypothetical protein AND Entamoeba dispar SAW760 |
|
EDI_289460 | EDI_289460A | 1 | 1 | 1 | | | reverse | protein coding | No | 1176 | EDI_289460 | 26S protease regulatory subunit S10B, putative | 26S protease regulatory subunit S10B, putative | 5886867 | B0EVA0 | Not Assigned | DS551057:6,230..7,405(-) | DS551057:6230..7405(-) | DS551057 | Entamoeba dispar SAW760 | 10 | OG6_101751 | 0 | 391 | 1176 | 44140 | 8.53 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | | | | | | | 3.6.4.3 (Transferred entry: 5.6.1.1) | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_289460OR26S protease regulatory subunit S10B, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_289460 OR 26S protease regulatory subunit S10B, putative AND Entamoeba dispar SAW760 |
|
EDI_290730 | EDI_290730A | 1 | 1 | 1 | | | forward | protein coding | No | 492 | EDI_290730 | hypothetical protein | hypothetical protein | 5880407 | B0EAU9 | Not Assigned | DS548512:93..584(+) | DS548512:93..584(+) | DS548512 | Entamoeba dispar SAW760 | 36 | OG6_113471 | 6 | 163 | 492 | 19372 | 5.15 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_290730ORhypothetical proteinANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_290730 OR hypothetical protein AND Entamoeba dispar SAW760 |
|
EDI_294750 | EDI_294750A | 1 | 1 | 1 | | | forward | protein coding | No | 1233 | EDI_294750 | 26S protease regulatory subunit, putative | 26S protease regulatory subunit, putative | 5884814 | B0ENF2 | Not Assigned | DS550083:3,510..4,742(+) | DS550083:3510..4742(+) | DS550083 | Entamoeba dispar SAW760 | 10 | OG6_101477 | 0 | 410 | 1233 | 46364 | 6.45 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | | | | | | | 3.6.4.3 (Transferred entry: 5.6.1.1) | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_294750OR26S protease regulatory subunit, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_294750 OR 26S protease regulatory subunit, putative AND Entamoeba dispar SAW760 |
|
EDI_295350 | EDI_295350A | 1 | 1 | 1 | | | forward | protein coding | No | 1011 | EDI_295350 | metalloprotease, putative | metalloprotease, putative | 5883011 | B0EIA4 | Not Assigned | DS549420:31,880..32,890(+) | DS549420:31880..32890(+) | DS549420 | Entamoeba dispar SAW760 | 10 | OG6_100777 | 0 | 336 | 1011 | 39618 | 9.67 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | 3.4.24.64 (Mitochondrial processing peptidase) | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_295350ORmetalloprotease, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_295350 OR metalloprotease, putative AND Entamoeba dispar SAW760 |
|
EDI_299030 | EDI_299030A | 1 | 1 | 1 | | | forward | protein coding | No | 933 | EDI_299030 | hypothetical protein | hypothetical protein | 5881507 | B0EDZ9 | Not Assigned | DS548882:193..1,125(+) | DS548882:193..1125(+) | DS548882 | Entamoeba dispar SAW760 | 6 | OG6_501759 | 0 | 310 | 933 | 35687 | 8.33 | 8 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | 3.4.21.- (Serine endopeptidases.) | 3.4.21.- (Serine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_299030ORhypothetical proteinANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_299030 OR hypothetical protein AND Entamoeba dispar SAW760 |
|
EDI_300750 | EDI_300750A | 1 | 1 | 1 | | | forward | protein coding | No | 744 | EDI_300750 | proteasome subunit alpha type-3, putative | proteasome subunit alpha type-3, putative | 5879086 | B0E727 | Not Assigned | DS547938:3,336..4,079(+) | DS547938:3336..4079(+) | DS547938 | Entamoeba dispar SAW760 | 10 | OG6_102011 | 1 | 247 | 744 | 27664 | 7.76 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_300750ORproteasome subunit alpha type-3, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_300750 OR proteasome subunit alpha type-3, putative AND Entamoeba dispar SAW760 |
|
EDI_300760 | EDI_300760A | 3 | 3 | 1 | | | forward | protein coding | No | 801 | EDI_300760 | hypothetical protein, conserved | hypothetical protein, conserved | 5879083 | B0E728 | Not Assigned | DS547938:4,167..5,074(+) | DS547938:4167..5074(+) | DS547938 | Entamoeba dispar SAW760 | 12 | OG6_103838 | 0 | 266 | 801 | 30129 | 7.95 | 6 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_300760ORhypothetical protein, conservedANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_300760 OR hypothetical protein, conserved AND Entamoeba dispar SAW760 |
|
EDI_304650 | EDI_304650A | 2 | 2 | 1 | | | reverse | protein coding | No | 5319 | EDI_304650 | hypothetical protein | hypothetical protein | 5880831 | B0EC22 | Not Assigned | DS548668:756..6,232(-) | DS548668:756..6232(-) | DS548668 | Entamoeba dispar SAW760 | 16 | OG6_204818 | 1 | 1772 | 5319 | 206228 | 5.67 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_304650ORhypothetical proteinANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_304650 OR hypothetical protein AND Entamoeba dispar SAW760 |
|
EDI_305430 | EDI_305430A | 1 | 1 | 1 | | | reverse | protein coding | No | 930 | EDI_305430 | hypothetical protein, conserved | hypothetical protein, conserved | 5884579 | B0EMR9 | Not Assigned | DS550035:13,146..14,075(-) | DS550035:13146..14075(-) | DS550035 | Entamoeba dispar SAW760 | 11 | OG6_104384 | 0 | 309 | 930 | 36754 | 7.36 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_305430ORhypothetical protein, conservedANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_305430 OR hypothetical protein, conserved AND Entamoeba dispar SAW760 |
|
EDI_307680 | EDI_307680A | 1 | 1 | 1 | | | forward | protein coding | No | 948 | EDI_307680 | 26S proteasome regulatory subunit 7, psd7, putative | 26S proteasome regulatory subunit 7, psd7, putative | 5882986 | B0EI82 | Not Assigned | DS549413:12,525..13,472(+) | DS549413:12525..13472(+) | DS549413 | Entamoeba dispar SAW760 | 9 | OG6_102054 | 0 | 315 | 948 | 36053 | 6.29 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 3.1.3.16 (Protein-serine/threonine phosphatase) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_307680OR26S proteasome regulatory subunit 7, psd7, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_307680 OR 26S proteasome regulatory subunit 7, psd7, putative AND Entamoeba dispar SAW760 |
|
EDI_308620 | EDI_308620A | 1 | 1 | 1 | | | forward | protein coding | No | 831 | EDI_308620 | monoglyceride lipase, putative | monoglyceride lipase, putative | 5885010 | B0EP01 | Not Assigned | DS550176:24,176..25,006(+) | DS550176:24176..25006(+) | DS550176 | Entamoeba dispar SAW760 | 38 | OG6_100231 | 2 | 276 | 831 | 31954 | 8.40 | 2 | | | | | | | | | | | | | | | 3.1.1.23 (Acylglycerol lipase) | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_308620ORmonoglyceride lipase, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_308620 OR monoglyceride lipase, putative AND Entamoeba dispar SAW760 |
|
EDI_308990 | EDI_308990A | 1 | 1 | 1 | | | reverse | protein coding | No | 390 | EDI_308990 | hypothetical protein, conserved | hypothetical protein, conserved | 5881041 | B0ECN3 | Not Assigned | DS548782:3,989..4,378(-) | DS548782:3989..4378(-) | DS548782 | Entamoeba dispar SAW760 | 11 | OG6_100707 | 1 | 129 | 390 | 14846 | 4.78 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_308990ORhypothetical protein, conservedANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_308990 OR hypothetical protein, conserved AND Entamoeba dispar SAW760 |
|
EDI_312870 | EDI_312870A | 2 | 2 | 1 | | | forward | protein coding | No | 2535 | EDI_312870 | chaperone protein ClpB, putative | chaperone protein ClpB, putative | 5884189 | B0ELM4 | Not Assigned | DS549894:4,359..7,038(+) | DS549894:4359..7038(+) | DS549894 | Entamoeba dispar SAW760 | 33 | OG6_100223 | 26 | 844 | 2535 | 95547 | 6.34 | 0 | | | | | GO:0005524 | ATP binding | GO:0019538 | protein metabolic process | | | | | | | 3.4.21.53 (Endopeptidase La) | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_312870ORchaperone protein ClpB, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_312870 OR chaperone protein ClpB, putative AND Entamoeba dispar SAW760 |
|
EDI_313240 | EDI_313240A | 1 | 1 | 1 | | | forward | protein coding | No | 1023 | EDI_313240 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | 5884188 | B0ELN1 | Not Assigned | DS549894:22,915..23,937(+) | DS549894:22915..23937(+) | DS549894 | Entamoeba dispar SAW760 | 8 | OG6_101021 | 0 | 340 | 1023 | 39559 | 6.91 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | 3.1.2.15 (Deleted entry) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_313240ORubiquitin carboxyl-terminal hydrolase, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_313240 OR ubiquitin carboxyl-terminal hydrolase, putative AND Entamoeba dispar SAW760 |
|
EDI_313300 | EDI_313300A | 4 | 4 | 1 | | | forward | protein coding | No | 1365 | EDI_313300 | hypothetical protein, conserved | hypothetical protein, conserved | 5884196 | B0ELN7 | Not Assigned | DS549894:34,243..35,771(+) | DS549894:34243..35771(+) | DS549894 | Entamoeba dispar SAW760 | 3 | OG6_162146 | 0 | 454 | 1365 | 49495 | 4.49 | 1 | HMM: MTVLLFILISLCLAI, NN: MTVLLFILISLCLAI | NN Sum: 4, NN D: .78, HMM Prob: 1 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_313300ORhypothetical protein, conservedANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_313300 OR hypothetical protein, conserved AND Entamoeba dispar SAW760 |
|
EDI_313350 | EDI_313350A | 1 | 1 | 1 | | | reverse | protein coding | No | 1776 | EDI_313350 | hypothetical protein, conserved | hypothetical protein, conserved | 5884201 | B0ELP2 | Not Assigned | DS549894:49,260..51,035(-) | DS549894:49260..51035(-) | DS549894 | Entamoeba dispar SAW760 | 8 | OG6_203074 | 0 | 591 | 1776 | 67896 | 5.10 | 0 | | | | | | | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_313350ORhypothetical protein, conservedANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_313350 OR hypothetical protein, conserved AND Entamoeba dispar SAW760 |
|
EDI_313840 | EDI_313840A | 1 | 1 | 1 | | | reverse | protein coding | No | 1995 | EDI_313840 | eukaryotic translation initiation factor 3 subunit, putative | eukaryotic translation initiation factor 3 subunit, putative | 5882609 | B0EH46 | Not Assigned | DS549290:5,010..7,004(-) | DS549290:5010..7004(-) | DS549290 | Entamoeba dispar SAW760 | 13 | OG6_101924 | 1 | 664 | 1995 | 76465 | 8.59 | 0 | | | | | | | | | | | | | | | 3.6.3.14 (Transferred entry: 7.1.2.2) | 3.6.3.14 (Transferred entry: 7.1.2.2) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_313840OReukaryotic translation initiation factor 3 subunit, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_313840 OR eukaryotic translation initiation factor 3 subunit, putative AND Entamoeba dispar SAW760 |
|
EDI_315330 | EDI_315330A | 2 | 2 | 1 | | | forward | protein coding | No | 1308 | EDI_315330 | cathepsin W precursor, putative | cathepsin W precursor, putative | 5878984 | B0E6S6 | Not Assigned | DS547932:13,485..14,865(+) | DS547932:13485..14865(+) | DS547932 | Entamoeba dispar SAW760 | 57 | OG6_123941 | 5 | 435 | 1308 | 48520 | 6.72 | 0 | HMM: MILFILISVVLGVDTS, NN: MILFILISVVLGVDTS | NN Sum: 4, NN D: .66, HMM Prob: .95 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.22.16 (Cathepsin H) | 3.4.22.16 (Cathepsin H) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_315330ORcathepsin W precursor, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_315330 OR cathepsin W precursor, putative AND Entamoeba dispar SAW760 |
|
EDI_315480 | EDI_315480A | 3 | 3 | 1 | | | reverse | protein coding | No | 6249 | EDI_315480 | hypothetical protein | hypothetical protein | 5878997 | B0E6U0 | Not Assigned | DS547932:35,413..41,917(-) | DS547932:35413..41917(-) | DS547932 | Entamoeba dispar SAW760 | 16 | OG6_204818 | 1 | 2082 | 6249 | 242779 | 4.89 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_315480ORhypothetical proteinANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_315480 OR hypothetical protein AND Entamoeba dispar SAW760 |
|
EDI_316190 | EDI_316190A | 1 | 1 | 1 | | | forward | protein coding | No | 1728 | EDI_316190 | heat shock protein, putative | heat shock protein, putative | 5880149 | B0EA41 | Not Assigned | DS548424:29..1,756(+) | DS548424:29..1756(+) | DS548424 | Entamoeba dispar SAW760 | 33 | OG6_100223 | 26 | 575 | 1728 | 65844 | 5.94 | 0 | | | | | GO:0005524 | ATP binding | | | | | | | | | 3.4.21.53 (Endopeptidase La) | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_316190ORheat shock protein, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_316190 OR heat shock protein, putative AND Entamoeba dispar SAW760 |
|
EDI_316920 | EDI_316920A | 1 | 1 | 1 | | | reverse | protein coding | No | 1269 | EDI_316920 | 26S protease regulatory subunit 6A, putative | 26S protease regulatory subunit 6A, putative | 5883778 | B0EKH1 | Not Assigned | DS549739:3,685..4,953(-) | DS549739:3685..4953(-) | DS549739 | Entamoeba dispar SAW760 | 11 | OG6_101915 | 0 | 422 | 1269 | 47444 | 5.14 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | | | | | | | 3.6.4.3 (Transferred entry: 5.6.1.1) | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_316920OR26S protease regulatory subunit 6A, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_316920 OR 26S protease regulatory subunit 6A, putative AND Entamoeba dispar SAW760 |
|
EDI_319300 | EDI_319300A | 1 | 1 | 1 | | | reverse | protein coding | No | 2028 | EDI_319300 | oligopeptidase A, putative | oligopeptidase A, putative | 5880873 | B0EC70 | Not Assigned | DS548675:8,488..10,515(-) | DS548675:8488..10515(-) | DS548675 | Entamoeba dispar SAW760 | 21 | OG6_100561 | 1 | 675 | 2028 | 79822 | 7.08 | 0 | | | | | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.24.70 (Oligopeptidase A) | 3.4.24.15 (Thimet oligopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_319300ORoligopeptidase A, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_319300 OR oligopeptidase A, putative AND Entamoeba dispar SAW760 |
|
EDI_326260 | EDI_326260A | 2 | 2 | 1 | | | forward | protein coding | No | 618 | EDI_326260 | proteasome subunit beta type-3, putative | proteasome subunit beta type-3, putative | 5885747 | B0ER51 | Not Assigned | DS550449:26,598..27,276(+) | DS550449:26598..27276(+) | DS550449 | Entamoeba dispar SAW760 | 10 | OG6_101970 | 0 | 205 | 618 | 22741 | 5.03 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_326260ORproteasome subunit beta type-3, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_326260 OR proteasome subunit beta type-3, putative AND Entamoeba dispar SAW760 |
|
EDI_334860 | EDI_334860A | 2 | 2 | 1 | | | reverse | protein coding | No | 543 | EDI_334860 | proteasome subunit beta type 7 | proteasome subunit beta type 7 | 5886404 | B0ESX7 | Not Assigned | DS550750:5,564..6,214(-) | DS550750:5564..6214(-) | DS550750 | Entamoeba dispar SAW760 | 9 | OG6_101382 | 0 | 180 | 543 | 20044 | 8.14 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_334860ORproteasome subunit beta type 7ANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_334860 OR proteasome subunit beta type 7 AND Entamoeba dispar SAW760 |
|
EDI_335240 | EDI_335240A | 1 | 1 | 1 | | | reverse | protein coding | No | 1242 | EDI_335240 | methionine aminopeptidase, putative | methionine aminopeptidase, putative | 5886399 | B0ET04 | Not Assigned | DS550750:48,019..49,260(-) | DS550750:48019..49260(-) | DS550750 | Entamoeba dispar SAW760 | 11 | OG6_100815 | 0 | 413 | 1242 | 46180 | 6.67 | 0 | | | | | GO:0004177;GO:0008235 | aminopeptidase activity;metalloexopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_335240ORmethionine aminopeptidase, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_335240 OR methionine aminopeptidase, putative AND Entamoeba dispar SAW760 |
|
EDI_336410 | EDI_336410A | 1 | 1 | 1 | | | forward | protein coding | No | 1185 | EDI_336410 | hypothetical protein | hypothetical protein | 5885993 | B0ERU7 | Not Assigned | DS550549:66,881..68,065(+) | DS550549:66881..68065(+) | DS550549 | Entamoeba dispar SAW760 | 7 | OG6_175840 | 0 | 394 | 1185 | 45921 | 6.60 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_336410ORhypothetical proteinANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_336410 OR hypothetical protein AND Entamoeba dispar SAW760 |
|
EDI_336440 | EDI_336440A | 1 | 1 | 1 | | | forward | protein coding | No | 780 | EDI_336440 | ubiquitin thioesterase OTU1, putative | ubiquitin thioesterase OTU1, putative | 5885996 | B0ERV0 | Not Assigned | DS550549:74,937..75,716(+) | DS550549:74937..75716(+) | DS550549 | Entamoeba dispar SAW760 | 12 | OG6_102949 | 0 | 259 | 780 | 30222 | 5.98 | 0 | | | | | | | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_336440ORubiquitin thioesterase OTU1, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_336440 OR ubiquitin thioesterase OTU1, putative AND Entamoeba dispar SAW760 |
|
EDI_336480 | EDI_336480A | 2 | 2 | 1 | | | forward | protein coding | No | 1140 | EDI_336480 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | 5886000 | B0ERV4 | Not Assigned | DS550549:81,580..82,767(+) | DS550549:81580..82767(+) | DS550549 | Entamoeba dispar SAW760 | 9 | OG6_114754 | 1 | 379 | 1140 | 43984 | 6.93 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | 3.1.2.15 (Deleted entry) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_336480ORubiquitin carboxyl-terminal hydrolase, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_336480 OR ubiquitin carboxyl-terminal hydrolase, putative AND Entamoeba dispar SAW760 |
|
EDI_337130 | EDI_337130A | 1 | 1 | 1 | | | forward | protein coding | No | 723 | EDI_337130 | DNA-damage inducible protein ddi1, putative | DNA-damage inducible protein ddi1, putative | 5881341 | B0EDI1 | Not Assigned | DS548801:753..1,475(+) | DS548801:753..1475(+) | DS548801 | Entamoeba dispar SAW760 | 8 | OG6_101685 | 0 | 240 | 723 | 27155 | 6.05 | 1 | | | | | GO:0004190 | aspartic-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.23.16 (HIV-1 retropepsin) | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_337130ORDNA-damage inducible protein ddi1, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_337130 OR DNA-damage inducible protein ddi1, putative AND Entamoeba dispar SAW760 |
|
EDI_340680 | EDI_340680A | 1 | 1 | 1 | | | reverse | protein coding | No | 1938 | EDI_340680 | dipeptidyl peptidase III, putative | dipeptidyl peptidase III, putative | 5883389 | B0EJD2 | Not Assigned | DS549551:27,991..29,928(-) | DS549551:27991..29928(-) | DS549551 | Entamoeba dispar SAW760 | 9 | OG6_103290 | 0 | 645 | 1938 | 74224 | 5.11 | 0 | | | GO:0005737 | cytoplasm | GO:0008239 | dipeptidyl-peptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.14.4 (Dipeptidyl-peptidase III) | 3.4.14.4 (Dipeptidyl-peptidase III) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_340680ORdipeptidyl peptidase III, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_340680 OR dipeptidyl peptidase III, putative AND Entamoeba dispar SAW760 |
|
EDI_341920 | EDI_341920A | 1 | 1 | 1 | | | forward | protein coding | No | 642 | EDI_341920 | proteasome subunit beta type-6 precursor, putative | proteasome subunit beta type-6 precursor, putative | 5879981 | B0E9M4 | Not Assigned | DS548370:8,031..8,672(+) | DS548370:8031..8672(+) | DS548370 | Entamoeba dispar SAW760 | 10 | OG6_101390 | 0 | 213 | 642 | 22878 | 7.01 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_341920ORproteasome subunit beta type-6 precursor, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_341920 OR proteasome subunit beta type-6 precursor, putative AND Entamoeba dispar SAW760 |
|
EDI_342200 | EDI_342200A | 1 | 1 | 1 | | | forward | protein coding | No | 1008 | EDI_342200 | O-sialoglycoprotein endopeptidase, putative | O-sialoglycoprotein endopeptidase, putative | 5880009 | B0E9Q2 | Not Assigned | DS548370:59,341..60,348(+) | DS548370:59341..60348(+) | DS548370 | Entamoeba dispar SAW760 | 12 | OG6_100288 | 0 | 335 | 1008 | 36816 | 7.74 | 0 | | | GO:0000408 | EKC/KEOPS complex | | | GO:0002949 | tRNA threonylcarbamoyladenosine modification | | | | | | | 2.3.1.234 (N(6)-L-threonylcarbamoyladenine synthase) | 2.3.1.234 (N(6)-L-threonylcarbamoyladenine synthase) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_342200ORO-sialoglycoprotein endopeptidase, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_342200 OR O-sialoglycoprotein endopeptidase, putative AND Entamoeba dispar SAW760 |
|
EDI_342370 | EDI_342370A | 2 | 2 | 1 | | | forward | protein coding | No | 1080 | EDI_342370 | hypothetical protein, conserved | hypothetical protein, conserved | 5880750 | B0EBU2 | Not Assigned | DS548631:1,545..2,668(+) | DS548631:1545..2668(+) | DS548631 | Entamoeba dispar SAW760 | 31 | OG6_139788 | 3 | 359 | 1080 | 40957 | 7.62 | 0 | | | | | | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_342370ORhypothetical protein, conservedANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_342370 OR hypothetical protein, conserved AND Entamoeba dispar SAW760 |
|
EDI_344750 | EDI_344750A | 1 | 1 | 1 | | | forward | protein coding | No | 2601 | EDI_344750 | heat shock protein, putative | heat shock protein, putative | 5881489 | B0EDZ0 | Not Assigned | DS548877:26,263..28,863(+) | DS548877:26263..28863(+) | DS548877 | Entamoeba dispar SAW760 | 33 | OG6_100223 | 26 | 866 | 2601 | 98178 | 6.06 | 0 | | | | | GO:0005524 | ATP binding | GO:0019538 | protein metabolic process | | | | | | | 3.4.21.53 (Endopeptidase La) | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_344750ORheat shock protein, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_344750 OR heat shock protein, putative AND Entamoeba dispar SAW760 |
|
EDI_347310 | EDI_347310A | 2 | 2 | 1 | | 2 | reverse | protein coding | No | 1451 | EDI_347310 | heat shock protein, putative | heat shock protein, putative | 5883863 | B0EKQ3 | Not Assigned | DS549781:1,391..2,937(-) | DS549781:1391..2935(-) | DS549781 | Entamoeba dispar SAW760 | 33 | OG6_100223 | 26 | 482 | 1449 | 54618 | 7.54 | 0 | | | | | GO:0005524 | ATP binding | GO:0019538 | protein metabolic process | | | | | | | 3.6.4.3 (Transferred entry: 5.6.1.1) | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_347310ORheat shock protein, putativeANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_347310 OR heat shock protein, putative AND Entamoeba dispar SAW760 |
|
EDI_348450 | EDI_348450A | 1 | 1 | 1 | | | forward | protein coding | No | 402 | EDI_348450 | hypothetical protein | hypothetical protein | 5878871 | B0E6H0 | Not Assigned | DS547905:17,871..18,272(+) | DS547905:17871..18272(+) | DS547905 | Entamoeba dispar SAW760 | 24 | OG6_102905 | 2 | 133 | 402 | 16321 | 7.43 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EDI_348450ORhypothetical proteinANDEntamoeba dispar SAW760 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EDI_348450 OR hypothetical protein AND Entamoeba dispar SAW760 |