|
EHI_001080 | EHI_001080A | 1 | 1 | 1 | | | forward | protein coding | No | 2028 | EHI_001080 | hypothetical protein | hypothetical protein | 3404172 | C4M1I8 | Not Assigned | DS571210:41,139..43,166(+) | DS571210:41139..43166(+) | DS571210 | Entamoeba histolytica HM-1:IMSS | 21 | OG6_100561 | 1 | 675 | 2028 | 79971 | 6.88 | 0 | | | | | GO:0004222;GO:0008944 | metalloendopeptidase activity;obsolete oligopeptidase A activity | GO:0006508 | proteolysis | | | | | | | | 3.4.24.15 (Thimet oligopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_001080ORhypothetical proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_001080 OR hypothetical protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_004510 | EHI_004510A | 1 | 1 | 1 | 26 | | forward | protein coding | No | 1073 | EHI_004510 | peptidase, C54 family | peptidase, C54 family | 3411050 | C4LYR2 | Not Assigned | DS571181:61,824..62,896(+) | DS571181:61824..62870(+) | DS571181 | Entamoeba histolytica HM-1:IMSS | 31 | OG6_139788 | 3 | 348 | 1047 | 40137 | 6.78 | 0 | | | | | GO:0008233 | peptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_004510ORpeptidase, C54 familyANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_004510 OR peptidase, C54 family AND Entamoeba histolytica HM-1:IMSS |
|
EHI_004620 | EHI_004620A | 1 | 1 | 1 | | | forward | protein coding | No | 783 | EHI_004620 | hypothetical protein, conserved | hypothetical protein, conserved | 3404294 | C4LYS2 | Not Assigned | DS571181:84,250..85,032(+) | DS571181:84250..85032(+) | DS571181 | Entamoeba histolytica HM-1:IMSS | 14 | OG6_100915 | 0 | 260 | 783 | 29344 | 5.77 | 0 | | | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_004620ORhypothetical protein, conservedANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_004620 OR hypothetical protein, conserved AND Entamoeba histolytica HM-1:IMSS |
|
EHI_004760 | EHI_004760A | 1 | 1 | 1 | | | forward | protein coding | No | 744 | EHI_004760 | proteasome subunit alpha type 5, putative | proteasome subunit alpha type 5, putative | 3407810 | | Not Assigned | DS571195:12,432..13,175(+) | DS571195:12432..13175(+) | DS571195 | Entamoeba histolytica HM-1:IMSS | 6 | OG6_101621 | 1 | 247 | 744 | 27247 | 4.86 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_004760ORproteasome subunit alpha type 5, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_004760 OR proteasome subunit alpha type 5, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_005657 | EHI_005657A | 1 | 1 | 1 | | | forward | protein coding | No | 2601 | EHI_005657 | hypothetical protein | hypothetical protein | 6220241 | B1N4V0 | Not Assigned | DS571504:2,171..4,771(+) | DS571504:2171..4771(+) | DS571504 | Entamoeba histolytica HM-1:IMSS | 48 | OG6_100223 | 11 | 866 | 2601 | 97670 | 5.81 | 0 | | | | | GO:0005524;GO:0016887;GO:0005515 | ATP binding;ATPase activity;protein binding | GO:0019538 | protein metabolic process | | | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_005657ORhypothetical proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_005657 OR hypothetical protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_005870 | EHI_005870A | 2 | 2 | 1 | | | forward | protein coding | No | 903 | EHI_005870 | proteasome regulatory subunit, putative | proteasome regulatory subunit, putative | 3407754 | C4M2M2 | Not Assigned | DS571227:7,644..8,628(+) | DS571227:7644..8628(+) | DS571227 | Entamoeba histolytica HM-1:IMSS | 10 | OG6_102002 | 0 | 300 | 903 | 33042 | 4.35 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_005870ORproteasome regulatory subunit, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_005870 OR proteasome regulatory subunit, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_006920 | EHI_006920A | 1 | 1 | 1 | | | forward | protein coding | No | 1716 | EHI_006920 | papain family cysteine protease domain containing protein | papain family cysteine protease domain containing protein | 3408758 | C4M0G5 | Not Assigned | DS571197:49,231..50,946(+) | DS571197:49231..50946(+) | DS571197 | Entamoeba histolytica HM-1:IMSS | 32 | OG6_159401 | 3 | 571 | 1716 | 65841 | 7.88 | 1 | HMM: MGKETTQNLWTLWIILWSFQFLVFAV, NN: MGKETTQNLWTLWIILWSFQFLVFAVVVCS | NN Sum: 4, NN D: .66, HMM Prob: .06 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_006920ORpapain family cysteine protease domain containing proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_006920 OR papain family cysteine protease domain containing protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_006990 | EHI_006990A | 1 | 1 | 1 | | | reverse | protein coding | No | 1239 | EHI_006990 | hypothetical protein | hypothetical protein | 3408796 | C4M0H2 | Not Assigned | DS571197:62,376..63,614(-) | DS571197:62376..63614(-) | DS571197 | Entamoeba histolytica HM-1:IMSS | 8 | OG6_502768 | 0 | 412 | 1239 | 46837 | 5.81 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_006990ORhypothetical proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_006990 OR hypothetical protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_007750 | EHI_007750A | 1 | 1 | 1 | | | forward | protein coding | No | 495 | EHI_007750 | hypothetical protein | hypothetical protein | 6219533 | B1N312 | Not Assigned | DS571178:21,375..21,869(+) | DS571178:21375..21869(+) | DS571178 | Entamoeba histolytica HM-1:IMSS | 37 | OG6_113471 | 5 | 164 | 495 | 19470 | 4.85 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_007750ORhypothetical proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_007750 OR hypothetical protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_008380 | EHI_008380A | 1 | 1 | 1 | | | forward | protein coding | No | 2484 | EHI_008380 | aminopeptidase, putative | aminopeptidase, putative | 3406868 | C4M0L4 | Not Assigned | DS571199:9,912..12,395(+) | DS571199:9912..12395(+) | DS571199 | Entamoeba histolytica HM-1:IMSS | 11 | OG6_100948 | 0 | 827 | 2484 | 94718 | 5.01 | 0 | | | | | GO:0008237;GO:0004179;GO:0008270 | metallopeptidase activity;obsolete membrane alanyl aminopeptidase activity;zinc ion binding | GO:0006508 | proteolysis | | | | | | | 3.4.11.- (Aminopeptidases.) | 3.4.11.- (Aminopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_008380ORaminopeptidase, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_008380 OR aminopeptidase, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_008680 | EHI_008680A | 2 | 2 | 1 | | | forward | protein coding | No | 2277 | EHI_008680 | ubiquitin carboxyl-terminal hydrolase domain containing protein | ubiquitin carboxyl-terminal hydrolase domain containing protein | 3406862 | C4M0N2 | Not Assigned | DS571199:45,939..48,267(+) | DS571199:45939..48267(+) | DS571199 | Entamoeba histolytica HM-1:IMSS | 8 | OG6_502871 | 0 | 758 | 2277 | 87989 | 5.48 | 0 | | | | | GO:0016787;GO:0036459 | hydrolase activity;thiol-dependent ubiquitinyl hydrolase activity | GO:0008152;GO:0016579 | metabolic process;protein deubiquitination | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_008680ORubiquitin carboxyl-terminal hydrolase domain containing proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_008680 OR ubiquitin carboxyl-terminal hydrolase domain containing protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_009430 | EHI_009430A | 3 | 3 | 1 | | | reverse | protein coding | No | 1755 | EHI_009430 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | 3408977 | C4LZ20 | Not Assigned | DS571184:20,669..22,532(-) | DS571184:20669..22532(-) | DS571184 | Entamoeba histolytica HM-1:IMSS | 8 | OG6_105957 | 0 | 584 | 1755 | 67536 | 6.58 | 0 | | | | | GO:0004221;GO:0036459 | obsolete ubiquitin thiolesterase activity;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_009430ORubiquitin carboxyl-terminal hydrolase, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_009430 OR ubiquitin carboxyl-terminal hydrolase, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_010070 | EHI_010070A | 1 | 1 | 1 | | | reverse | protein coding | No | 1416 | EHI_010070 | Xaa-Pro dipeptidase, putative | Xaa-Pro dipeptidase, putative | 3411413 | C4M0S1 | Not Assigned | DS571200:52,216..53,631(-) | DS571200:52216..53631(-) | DS571200 | Entamoeba histolytica HM-1:IMSS | 10 | OG6_102295 | 0 | 471 | 1416 | 53934 | 6.01 | 0 | | | | | GO:0004177;GO:0030145;GO:0008235;GO:0004251;GO:0008233 | aminopeptidase activity;manganese ion binding;metalloexopeptidase activity;obsolete X-Pro dipeptidase activity;peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.11.9 (Xaa-Pro aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_010070ORXaa-Pro dipeptidase, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_010070 OR Xaa-Pro dipeptidase, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_010340 | EHI_010340A | 1 | 1 | 1 | | | reverse | protein coding | No | 1665 | EHI_010340 | hypothetical protein | hypothetical protein | 3409121 | C4LYT1 | Not Assigned | DS571182:15,128..16,792(-) | DS571182:15128..16792(-) | DS571182 | Entamoeba histolytica HM-1:IMSS | 37 | OG6_113471 | 5 | 554 | 1665 | 64060 | 4.58 | 1 | HMM: MFLSKLSAFPITQKIAVILIFLVLMLQFGIMLY, NN: MFLSKLSAFPITQKIAVILIFLVLMLQFGIML | NN Sum: 2, NN D: .55, HMM Prob: .05 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_010340ORhypothetical proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_010340 OR hypothetical protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_010610 | EHI_010610A | 1 | 1 | 1 | | | reverse | protein coding | No | 921 | EHI_010610 | Ulp1 protease family, C-terminal catalytic domain containing protein | Ulp1 protease family, C-terminal catalytic domain containing protein | 3404366 | C4LYU8 | Not Assigned | DS571182:48,873..49,793(-) | DS571182:48873..49793(-) | DS571182 | Entamoeba histolytica HM-1:IMSS | 24 | OG6_102905 | 2 | 306 | 921 | 36860 | 4.82 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_010610ORUlp1 protease family, C-terminal catalytic domain containing proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_010610 OR Ulp1 protease family, C-terminal catalytic domain containing protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_010850 | EHI_010850A | 1 | 1 | 1 | | | forward | protein coding | No | 948 | EHI_010850 | cysteine proteinase, putative | cysteine proteinase, putative | 6220496 | B1N5G3 | Not Assigned | DS571817:1,194..2,141(+) | DS571817:1194..2141(+) | DS571817 | Entamoeba histolytica HM-1:IMSS | 90 | OG6_100116 | 10 | 315 | 948 | 34959 | 5.28 | 0 | HMM: MIVLIYLLSIVNGI, NN: MIVLIYLLSIVNGI | NN Sum: 4, NN D: .71, HMM Prob: .28 | | | GO:0004197;GO:0008234 | cysteine-type endopeptidase activity;cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_010850ORcysteine proteinase, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_010850 OR cysteine proteinase, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_011810 | EHI_011810A | 1 | 1 | 1 | | | forward | protein coding | No | 819 | EHI_011810 | hypothetical protein, conserved | hypothetical protein, conserved | 3408118 | C4LTH7 | Not Assigned | DS571148:15,600..16,418(+) | DS571148:15600..16418(+) | DS571148 | Entamoeba histolytica HM-1:IMSS | 17 | OG6_101827 | 1 | 272 | 819 | 31155 | 9.26 | 1 | HMM: MLKHILFILLFVILNSYAL, NN: MLKHILFILLFVILNSYAL | NN Sum: 4, NN D: .9, HMM Prob: 1 | | | | | | | | | | | | | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_011810ORhypothetical protein, conservedANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_011810 OR hypothetical protein, conserved AND Entamoeba histolytica HM-1:IMSS |
|
EHI_011870 | EHI_011870A | 1 | 1 | 1 | 18 | | reverse | protein coding | No | 777 | EHI_011870 | proteasome subunit beta type 5 precursor, putative | proteasome subunit beta type 5 precursor, putative | 3408113 | C4LTI2 | Not Assigned | DS571148:23,098..23,874(-) | DS571148:23116..23874(-) | DS571148 | Entamoeba histolytica HM-1:IMSS | 10 | OG6_100897 | 0 | 252 | 759 | 28403 | 7.59 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_011870ORproteasome subunit beta type 5 precursor, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_011870 OR proteasome subunit beta type 5 precursor, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_011890 | EHI_011890A | 2 | 2 | 1 | | | forward | protein coding | No | 1080 | EHI_011890 | peptidase, C54 family | peptidase, C54 family | 3408111 | C4LTI3 | Not Assigned | DS571148:25,443..26,571(+) | DS571148:25443..26571(+) | DS571148 | Entamoeba histolytica HM-1:IMSS | 31 | OG6_139788 | 3 | 359 | 1080 | 40851 | 7.62 | 0 | | | | | GO:0008233 | peptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_011890ORpeptidase, C54 familyANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_011890 OR peptidase, C54 family AND Entamoeba histolytica HM-1:IMSS |
|
EHI_012290 | EHI_012290A | 1 | 1 | 1 | | | reverse | protein coding | No | 2643 | EHI_012290 | ubiquitin carboxyl-terminal hydrolase domain containing protein | ubiquitin carboxyl-terminal hydrolase domain containing protein | 3410494 | C4LTM2 | Not Assigned | DS571148:94,488..97,130(-) | DS571148:94488..97130(-) | DS571148 | Entamoeba histolytica HM-1:IMSS | 14 | OG6_100913 | 0 | 880 | 2643 | 102971 | 4.94 | 0 | | | | | GO:0004221;GO:0036459 | obsolete ubiquitin thiolesterase activity;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_012290ORubiquitin carboxyl-terminal hydrolase domain containing proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_012290 OR ubiquitin carboxyl-terminal hydrolase domain containing protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_013550 | EHI_013550A | 1 | 1 | 1 | 2 | | reverse | protein coding | No | 452 | EHI_013550 | heat shock protein 101, putative | heat shock protein 101, putative | 6220620 | B1N5Q7 | Not Assigned | DS572059:1..452(-) | DS572059:3..452(-) | DS572059 | Entamoeba histolytica HM-1:IMSS | 3 | OG6_148837 | 4 | 150 | 450 | 17127 | 5.34 | 0 | | | | | GO:0005515 | protein binding | GO:0019538 | protein metabolic process | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_013550ORheat shock protein 101, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_013550 OR heat shock protein 101, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_015380 | EHI_015380A | 1 | 1 | 1 | | | reverse | protein coding | No | 3342 | EHI_015380 | immuno-dominant variable surface antigen | immuno-dominant variable surface antigen | 3408814 | C4M0X6 | Not Assigned | DS571202:42,921..46,262(-) | DS571202:42921..46262(-) | DS571202 | Entamoeba histolytica HM-1:IMSS | 19 | OG6_114489 | 0 | 1113 | 3342 | 125426 | 6.85 | 1 | HMM: MLGSKSIIAVVAIASAIVTGV, NN: MLGSKSIIAVVAIASAIVTGVVVIVVVVTLSV | NN Sum: 2, NN D: .59, HMM Prob: 0 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_015380ORimmuno-dominant variable surface antigenANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_015380 OR immuno-dominant variable surface antigen AND Entamoeba histolytica HM-1:IMSS |
|
EHI_015550 | EHI_015550A | 1 | 1 | 1 | | | reverse | protein coding | No | 717 | EHI_015550 | retroviral aspartyl protease domain-containing protein | retroviral aspartyl protease domain-containing protein | 6220468 | B1N5E0 | Not Assigned | DS571756:1,191..1,907(-) | DS571756:1191..1907(-) | DS571756 | Entamoeba histolytica HM-1:IMSS | 7 | OG6_101685 | 1 | 239 | 717 | 27129 | 5.98 | 1 | | | | | GO:0004190 | aspartic-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_015550ORretroviral aspartyl protease domain-containing proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_015550 OR retroviral aspartyl protease domain-containing protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_017350 | EHI_017350A | 1 | 1 | 1 | | | forward | protein coding | No | 2601 | EHI_017350 | heat shock protein, putative | heat shock protein, putative | 6220323 | B1N523 | Not Assigned | DS571567:1,590..4,190(+) | DS571567:1590..4190(+) | DS571567 | Entamoeba histolytica HM-1:IMSS | 48 | OG6_100223 | 11 | 866 | 2601 | 97597 | 5.60 | 0 | | | | | GO:0005524;GO:0016887;GO:0005515 | ATP binding;ATPase activity;protein binding | GO:0019538 | protein metabolic process | | | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_017350ORheat shock protein, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_017350 OR heat shock protein, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_019390 | EHI_019390.mRNA | 1 | 1 | 1 | | | forward | protein coding | Yes | 425 | EHI_019390 | cysteine proteinase, pseudogene | cysteine proteinase, pseudogene | 6220440 | | Not Assigned | DS571709:1,291..1,715(+) | DS571709:1291..1715(+) | DS571709 | Entamoeba histolytica HM-1:IMSS | 0 | N/A (orthology not determined because poor protein quality) | 0 | 141 | 425 | 15870 | 7.03 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_019390ORcysteine proteinase, pseudogeneANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_019390 OR cysteine proteinase, pseudogene AND Entamoeba histolytica HM-1:IMSS |
|
EHI_020250 | EHI_020250A | 1 | 1 | 1 | | | forward | protein coding | No | 1200 | EHI_020250 | lecithin:cholesterol acyltransferase domain-containing protein | lecithin:cholesterol acyltransferase domain-containing protein | 3403482 | C4M7V0 | Not Assigned | DS571339:10,459..11,658(+) | DS571339:10459..11658(+) | DS571339 | Entamoeba histolytica HM-1:IMSS | 89 | OG6_101376 | 8 | 399 | 1200 | 45655 | 6.14 | 0 | HMM: MNIFFLCLTLSIAIAE, NN: MNIFFLCLTLSIAIAE | NN Sum: 4, NN D: .77, HMM Prob: 1 | | | GO:0008374;GO:0003674 | O-acyltransferase activity;molecular_function | GO:0008150;GO:0006629 | biological_process;lipid metabolic process | | | | | | | | 2.3.1.43 (Phosphatidylcholine--sterol O-acyltransferase) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_020250ORlecithin:cholesterol acyltransferase domain-containing proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_020250 OR lecithin:cholesterol acyltransferase domain-containing protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_021300 | EHI_021300A | 1 | 1 | 1 | | | reverse | protein coding | No | 1188 | EHI_021300 | lecithin:cholesterol acyltransferase domain-containing protein | lecithin:cholesterol acyltransferase domain-containing protein | 3409680 | C4M045 | Not Assigned | DS571194:26,225..27,412(-) | DS571194:26225..27412(-) | DS571194 | Entamoeba histolytica HM-1:IMSS | 89 | OG6_101376 | 8 | 395 | 1188 | 45587 | 8.02 | 1 | HMM: MLILLFIFIWFDFTIACSS, NN: MLILLFIFIWFDFTIAC | NN Sum: 4, NN D: .83, HMM Prob: 1 | | | GO:0008374;GO:0003674 | O-acyltransferase activity;molecular_function | GO:0008150;GO:0006629 | biological_process;lipid metabolic process | | | | | | | | 2.3.1.43 (Phosphatidylcholine--sterol O-acyltransferase) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_021300ORlecithin:cholesterol acyltransferase domain-containing proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_021300 OR lecithin:cholesterol acyltransferase domain-containing protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_021340 | EHI_021340A | 2 | 2 | 1 | | | forward | protein coding | No | 1308 | EHI_021340 | aminopeptidase, putative | aminopeptidase, putative | 3410950 | C4M049 | Not Assigned | DS571194:36,540..37,891(+) | DS571194:36540..37891(+) | DS571194 | Entamoeba histolytica HM-1:IMSS | 18 | OG6_102047 | 1 | 435 | 1308 | 48685 | 5.05 | 0 | | | GO:0005773 | vacuole | GO:0004177;GO:0004250;GO:0042576;GO:0008270 | aminopeptidase activity;obsolete aminopeptidase I activity;obsolete aspartyl aminopeptidase activity;zinc ion binding | GO:0006508 | proteolysis | | | | | | | | 3.4.11.21 (Aspartyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_021340ORaminopeptidase, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_021340 OR aminopeptidase, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_022620 | EHI_022620A | 1 | 1 | 1 | | | reverse | protein coding | No | 2601 | EHI_022620 | heat shock protein, putative | heat shock protein, putative | 6219381 | B1N2L8 | Not Assigned | DS571153:13,738..16,338(-) | DS571153:13738..16338(-) | DS571153 | Entamoeba histolytica HM-1:IMSS | 48 | OG6_100223 | 11 | 866 | 2601 | 97637 | 5.60 | 0 | | | | | GO:0005524;GO:0016887;GO:0005515 | ATP binding;ATPase activity;protein binding | GO:0019538 | protein metabolic process | | | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_022620ORheat shock protein, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_022620 OR heat shock protein, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_023020 | EHI_023020A | 1 | 1 | 1 | | | forward | protein coding | No | 744 | EHI_023020 | proteasome subunit alpha type 5, putative | proteasome subunit alpha type 5, putative | 3405001 | | Not Assigned | DS571153:55,842..56,585(+) | DS571153:55842..56585(+) | DS571153 | Entamoeba histolytica HM-1:IMSS | 6 | OG6_101621 | 1 | 247 | 744 | 27247 | 4.86 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_023020ORproteasome subunit alpha type 5, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_023020 OR proteasome subunit alpha type 5, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_024470 | EHI_024470A | 1 | 1 | 1 | 21 | | reverse | protein coding | No | 663 | EHI_024470 | proteasome subunit beta type 6 precursor, putative | proteasome subunit beta type 6 precursor, putative | 3405272 | C4M0I9 | Not Assigned | DS571198:26,513..27,175(-) | DS571198:26534..27175(-) | DS571198 | Entamoeba histolytica HM-1:IMSS | 10 | OG6_101390 | 0 | 213 | 642 | 22624 | 7.01 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_024470ORproteasome subunit beta type 6 precursor, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_024470 OR proteasome subunit beta type 6 precursor, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_024630 | EHI_024630A | 1 | 1 | 1 | | | forward | protein coding | No | 1008 | EHI_024630 | glycoprotein endopeptidase, putative | glycoprotein endopeptidase, putative | 3406601 | C4M0K5 | Not Assigned | DS571198:64,674..65,681(+) | DS571198:64674..65681(+) | DS571198 | Entamoeba histolytica HM-1:IMSS | 12 | OG6_100288 | 0 | 335 | 1008 | 36840 | 7.44 | 0 | | | GO:0000408 | EKC/KEOPS complex | GO:0008450 | obsolete O-sialoglycoprotein endopeptidase activity | GO:0006508;GO:0002949 | proteolysis;tRNA threonylcarbamoyladenosine modification | | | | | | | 2.3.1.234 (N(6)-L-threonylcarbamoyladenine synthase) | 2.3.1.234 (N(6)-L-threonylcarbamoyladenine synthase) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_024630ORglycoprotein endopeptidase, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_024630 OR glycoprotein endopeptidase, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_025410 | EHI_025410A | 1 | 1 | 1 | | | forward | protein coding | No | 1401 | EHI_025410 | Ulp1 protease family, C-terminal catalytic domain containing protein | Ulp1 protease family, C-terminal catalytic domain containing protein | 3407268 | C4M328 | Not Assigned | DS571233:33,896..35,296(+) | DS571233:33896..35296(+) | DS571233 | Entamoeba histolytica HM-1:IMSS | 8 | OG6_133048 | 0 | 466 | 1401 | 54300 | 7.64 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.6.1.5 (Apyrase) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_025410ORUlp1 protease family, C-terminal catalytic domain containing proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_025410 OR Ulp1 protease family, C-terminal catalytic domain containing protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_027600 | EHI_027600A | 2 | 2 | 1 | | | forward | protein coding | No | 555 | EHI_027600 | 4-methyl-5(B-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme, putative | 4-methyl-5(B-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme, putative | 3411855 | C4M1U6 | Not Assigned | DS571215:25,525..26,138(+) | DS571215:25525..26138(+) | DS571215 | Entamoeba histolytica HM-1:IMSS | 10 | OG6_101257 | 0 | 184 | 555 | 19803 | 5.81 | 0 | | | | | | | | | | | | | | | | 2.7.1.50 (Hydroxyethylthiazole kinase) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_027600OR4-methyl-5(B-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_027600 OR 4-methyl-5(B-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_027780 | EHI_027780A | 1 | 1 | 1 | | | forward | protein coding | No | 966 | EHI_027780 | signal peptide peptidase family protein | signal peptide peptidase family protein | 3411862 | C4M1W4 | Not Assigned | DS571215:58,276..59,241(+) | DS571215:58276..59241(+) | DS571215 | Entamoeba histolytica HM-1:IMSS | 14 | OG6_184292 | 1 | 321 | 966 | 36688 | 8.10 | 9 | HMM: MFELLQLITLTIIIHYLSCK, NN: MFELLQLITLTIIIHYLSCK | NN Sum: 4, NN D: .63, HMM Prob: .12 | GO:0016021 | integral component of membrane | GO:0004190;GO:0008717 | aspartic-type endopeptidase activity;obsolete D-alanyl-D-alanine endopeptidase activity | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_027780ORsignal peptide peptidase family proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_027780 OR signal peptide peptidase family protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_028920 | EHI_028920A | 1 | 1 | 1 | | | reverse | protein coding | No | 2601 | EHI_028920 | heat shock protein, putative | heat shock protein, putative | 6219805 | B1N3R1 | Not Assigned | DS571266:10,549..13,149(-) | DS571266:10549..13149(-) | DS571266 | Entamoeba histolytica HM-1:IMSS | 48 | OG6_100223 | 11 | 866 | 2601 | 97629 | 5.60 | 0 | | | | | GO:0005524;GO:0016887;GO:0005515 | ATP binding;ATPase activity;protein binding | GO:0019538 | protein metabolic process | | | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_028920ORheat shock protein, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_028920 OR heat shock protein, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_029210 | EHI_029210A | 1 | 1 | 1 | 20 | | forward | protein coding | No | 764 | EHI_029210 | proteasome subunit alpha type 3, putative | proteasome subunit alpha type 3, putative | 3403862 | C4MAW8 | Not Assigned | DS571528:1,149..1,912(+) | DS571528:1149..1892(+) | DS571528 | Entamoeba histolytica HM-1:IMSS | 10 | OG6_102011 | 1 | 247 | 744 | 27603 | 7.43 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_029210ORproteasome subunit alpha type 3, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_029210 OR proteasome subunit alpha type 3, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_029220 | EHI_029220A | 3 | 3 | 1 | | | forward | protein coding | No | 801 | EHI_029220 | peptidase S54 (rhomboid) family protein | peptidase S54 (rhomboid) family protein | 3403861 | C4MAW9 | Not Assigned | DS571528:1,980..2,891(+) | DS571528:1980..2891(+) | DS571528 | Entamoeba histolytica HM-1:IMSS | 12 | OG6_103838 | 0 | 266 | 801 | 30103 | 8.32 | 6 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_029220ORpeptidase S54 (rhomboid) family proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_029220 OR peptidase S54 (rhomboid) family protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_029490 | EHI_029490.mRNA | 1 | 1 | 1 | | | reverse | protein coding | Yes | 303 | EHI_029490 | hypothetical protein, pseudogene | hypothetical protein, pseudogene | 6219971 | | Not Assigned | DS571340:219..521(-) | DS571340:219..521(-) | DS571340 | Entamoeba histolytica HM-1:IMSS | 0 | N/A (orthology not determined because poor protein quality) | 0 | 101 | 303 | 11239 | 9.24 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_029490ORhypothetical protein, pseudogeneANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_029490 OR hypothetical protein, pseudogene AND Entamoeba histolytica HM-1:IMSS |
|
EHI_030170 | EHI_030170A | 1 | 1 | 1 | | | reverse | protein coding | No | 945 | EHI_030170 | 26S proteasome non-ATPase regulatory subunit, putative | 26S proteasome non-ATPase regulatory subunit, putative | 3403560 | C4M451 | Not Assigned | DS571253:21,109..22,053(-) | DS571253:21109..22053(-) | DS571253 | Entamoeba histolytica HM-1:IMSS | 9 | OG6_102054 | 0 | 314 | 945 | 35845 | 6.29 | 0 | | | | | GO:0003824;GO:0005515 | catalytic activity;protein binding | GO:0008152 | metabolic process | | | | | | | | 3.1.3.16 (Protein-serine/threonine phosphatase) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_030170OR26S proteasome non-ATPase regulatory subunit, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_030170 OR 26S proteasome non-ATPase regulatory subunit, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_030720 | EHI_030720A | 2 | 2 | 1 | | | reverse | protein coding | No | 1335 | EHI_030720 | cysteine protease, putative | cysteine protease, putative | 3402755 | C4M1E2 | Not Assigned | DS571208:5,151..6,537(-) | DS571208:5151..6537(-) | DS571208 | Entamoeba histolytica HM-1:IMSS | 52 | OG6_123941 | 10 | 444 | 1335 | 50436 | 7.63 | 1 | HMM: MSILFIITFLLIFSFSK, NN: MSILFIITFLLIFSFSKQTTNTN | NN Sum: 4, NN D: .74, HMM Prob: .99 | | | GO:0008234;GO:0004215 | cysteine-type peptidase activity;obsolete cathepsin H activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.16 (Cathepsin H) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_030720ORcysteine protease, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_030720 OR cysteine protease, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_031250 | EHI_031250A | 1 | 1 | 1 | 33 | | forward | protein coding | No | 1056 | EHI_031250 | signal peptidase, putative | signal peptidase, putative | 3408413 | C4M4K7 | Not Assigned | DS571261:7,292..8,347(+) | DS571261:7292..8314(+) | DS571261 | Entamoeba histolytica HM-1:IMSS | 10 | OG6_102328 | 0 | 340 | 1023 | 38180 | 4.22 | 8 | HMM: MPSFYQLVSSVGLFVTPILPLVLGA, NN: MPSFYQLVSSVGLFVTPILPLVLGA | NN Sum: 3, NN D: .58, HMM Prob: .91 | GO:0016021 | integral component of membrane | GO:0004190;GO:0008717 | aspartic-type endopeptidase activity;obsolete D-alanyl-D-alanine endopeptidase activity | | | | | | | | | | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_031250ORsignal peptidase, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_031250 OR signal peptidase, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_033710 | EHI_033710A | 1 | 1 | 1 | 26 | | forward | protein coding | No | 974 | EHI_033710 | cysteine proteinase 2 | cysteine proteinase 2 | 3404954 | Q01958 | Not Assigned | DS571252:35,348..36,321(+) | DS571252:35348..36295(+) | DS571252 | Entamoeba histolytica HM-1:IMSS | 90 | OG6_100116 | 10 | 315 | 948 | 34687 | 7.26 | 0 | HMM: MFAFICLLAIASAI, NN: MFAFICLLAIASAI | NN Sum: 4, NN D: .7, HMM Prob: .98 | | | GO:0004197;GO:0008234 | cysteine-type endopeptidase activity;cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.22.35 (Histolysain) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_033710ORcysteine proteinase 2ANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_033710 OR cysteine proteinase 2 AND Entamoeba histolytica HM-1:IMSS |
|
EHI_034710 | EHI_034710A | 1 | 1 | 1 | | | reverse | protein coding | No | 2601 | EHI_034710 | heat shock protein, putative | heat shock protein, putative | 3403222 | C4MB78 | Not Assigned | DS571585:4,265..6,865(-) | DS571585:4265..6865(-) | DS571585 | Entamoeba histolytica HM-1:IMSS | 48 | OG6_100223 | 11 | 866 | 2601 | 97655 | 5.60 | 0 | | | | | GO:0005524;GO:0016887;GO:0005515 | ATP binding;ATPase activity;protein binding | GO:0019538 | protein metabolic process | | | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_034710ORheat shock protein, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_034710 OR heat shock protein, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_035180 | EHI_035180A | 1 | 1 | 1 | | | reverse | protein coding | No | 2421 | EHI_035180 | ubiquitin carboxyl-terminal hydrolase domain containing protein | ubiquitin carboxyl-terminal hydrolase domain containing protein | 3410536 | C4M4Z7 | Not Assigned | DS571268:24,942..27,362(-) | DS571268:24942..27362(-) | DS571268 | Entamoeba histolytica HM-1:IMSS | 18 | OG6_101457 | 1 | 806 | 2421 | 93299 | 5.68 | 0 | | | | | GO:0016787;GO:0036459 | hydrolase activity;thiol-dependent ubiquitinyl hydrolase activity | GO:0008152;GO:0016579 | metabolic process;protein deubiquitination | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_035180ORubiquitin carboxyl-terminal hydrolase domain containing proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_035180 OR ubiquitin carboxyl-terminal hydrolase domain containing protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_035580 | EHI_035580A | 2 | 2 | 1 | | | forward | protein coding | No | 765 | EHI_035580 | Der1 family protein, putative | Der1 family protein, putative | 3410440 | C4LXY8 | Not Assigned | DS571174:48,110..48,926(+) | DS571174:48110..48926(+) | DS571174 | Entamoeba histolytica HM-1:IMSS | 10 | OG6_101672 | 0 | 254 | 765 | 30204 | 4.42 | 5 | HMM: MEILNVFAGYPIITRTILI, NN: MEILNVFAGYPIITRTILIMIISLFVLMKVRII | NN Sum: 3, NN D: .53, HMM Prob: 0 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_035580ORDer1 family protein, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_035580 OR Der1 family protein, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_035750 | EHI_035750A | 1 | 1 | 1 | | | reverse | protein coding | No | 1239 | EHI_035750 | lecithin:cholesterol acyltransferase domain-containing protein | lecithin:cholesterol acyltransferase domain-containing protein | 3410455 | C4LY02 | Not Assigned | DS571174:81,530..82,768(-) | DS571174:81530..82768(-) | DS571174 | Entamoeba histolytica HM-1:IMSS | 89 | OG6_101376 | 8 | 412 | 1239 | 47061 | 6.77 | 0 | HMM: MFFLYLLLSITWGK, NN: MFFLYLLLSITWGK | NN Sum: 4, NN D: .65, HMM Prob: .92 | | | GO:0008374;GO:0003674 | O-acyltransferase activity;molecular_function | GO:0008150;GO:0006629 | biological_process;lipid metabolic process | | | | | | | | 2.3.1.43 (Phosphatidylcholine--sterol O-acyltransferase) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_035750ORlecithin:cholesterol acyltransferase domain-containing proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_035750 OR lecithin:cholesterol acyltransferase domain-containing protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_037190 | EHI_037190A | 1 | 1 | 1 | | | reverse | protein coding | No | 1443 | EHI_037190 | serine carboxypeptidase (S28) family protein | serine carboxypeptidase (S28) family protein | 3403271 | C4M7N4 | Not Assigned | DS571334:21,002..22,444(-) | DS571334:21002..22444(-) | DS571334 | Entamoeba histolytica HM-1:IMSS | 24 | OG6_100644 | 2 | 480 | 1443 | 54293 | 4.57 | 0 | HMM: MFLFILLFLSAYASLT, NN: MFLFILLFLSAYASLTLHQ | NN Sum: 3, NN D: .61, HMM Prob: 1 | | | GO:0004188;GO:0008236 | obsolete serine-type Pro-X carboxypeptidase activity;serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.16.2 (Lysosomal Pro-Xaa carboxypeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_037190ORserine carboxypeptidase (S28) family proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_037190 OR serine carboxypeptidase (S28) family protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_037210 | EHI_037210A | 1 | 1 | 1 | | | reverse | protein coding | No | 894 | EHI_037210 | hypothetical protein | hypothetical protein | 6219961 | B1N449 | Not Assigned | DS571334:24,157..25,050(-) | DS571334:24157..25050(-) | DS571334 | Entamoeba histolytica HM-1:IMSS | 17 | OG6_101827 | 1 | 297 | 894 | 34229 | 5.88 | 1 | HMM: MIWEIIAGATALIMVLSGIHLF, NN: MIWEIIAGATALIMVLSGI | NN Sum: 3, NN D: .65, HMM Prob: .89 | | | | | | | | | | | | | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_037210ORhypothetical proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_037210 OR hypothetical protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_038330 | EHI_038330A | 1 | 1 | 1 | 543 | 53 | forward | protein coding | No | 1250 | EHI_038330 | zinc finger domain containing protein | zinc finger domain containing protein | 3408028 | C4M901 | Not Assigned | DS571382:20,785..22,034(+) | DS571382:20838..21491(+) | DS571382 | Entamoeba histolytica HM-1:IMSS | 9 | OG6_102074 | 1 | 217 | 654 | 24480 | 4.67 | 2 | | | | | GO:0003674 | molecular_function | GO:0008150 | biological_process | | | | | | | | 6.3.2.19 (Transferred entry: 2.3.2.23, 2.3.2.27 and 6.2.1.45) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_038330ORzinc finger domain containing proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_038330 OR zinc finger domain containing protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_039610 | EHI_039610A | 1 | 1 | 1 | 15 | | forward | protein coding | No | 963 | EHI_039610 | cysteine proteinase, putative | cysteine proteinase, putative | 3403278 | Q8I8E0 | Not Assigned | DS571440:15,866..16,828(+) | DS571440:15866..16813(+) | DS571440 | Entamoeba histolytica HM-1:IMSS | 90 | OG6_100116 | 10 | 315 | 948 | 34931 | 5.28 | 0 | HMM: MIVLIYLLSIVNGI, NN: MIVLIYLLSIVNGI | NN Sum: 4, NN D: .71, HMM Prob: .28 | | | GO:0004197;GO:0008234 | cysteine-type endopeptidase activity;cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_039610ORcysteine proteinase, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_039610 OR cysteine proteinase, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_039840 | EHI_039840A | 1 | 1 | 1 | | | reverse | protein coding | No | 831 | EHI_039840 | hydrolase, alpha/beta fold family domain containing protein | hydrolase, alpha/beta fold family domain containing protein | 3406274 | C4MA88 | Not Assigned | DS571454:7,928..8,758(-) | DS571454:7928..8758(-) | DS571454 | Entamoeba histolytica HM-1:IMSS | 37 | OG6_100231 | 3 | 276 | 831 | 31904 | 8.43 | 1 | | | | | GO:0016787 | hydrolase activity | GO:0008152 | metabolic process | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_039840ORhydrolase, alpha/beta fold family domain containing proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_039840 OR hydrolase, alpha/beta fold family domain containing protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_042170 | EHI_042170A | 1 | 1 | 1 | | | forward | protein coding | No | 1551 | EHI_042170 | aminoacyl-histidine dipeptidase, putative | aminoacyl-histidine dipeptidase, putative | 3409921 | C4M4H1 | Not Assigned | DS571259:29,783..31,333(+) | DS571259:29783..31333(+) | DS571259 | Entamoeba histolytica HM-1:IMSS | 19 | OG6_112555 | 1 | 516 | 1551 | 56919 | 6.04 | 0 | | | | | GO:0016787;GO:0008237;GO:0008769 | hydrolase activity;metallopeptidase activity;obsolete X-His dipeptidase activity | GO:0008152;GO:0006508 | metabolic process;proteolysis | | | | | | | | 3.4.13.3 (Transferred entry: 3.4.13.18 and 3.4.13.20) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_042170ORaminoacyl-histidine dipeptidase, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_042170 OR aminoacyl-histidine dipeptidase, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_042860 | EHI_042860A | 1 | 1 | 1 | | | reverse | protein coding | No | 2601 | EHI_042860 | heat shock protein, putative | heat shock protein, putative | 6219872 | | Not Assigned | DS571292:3,711..6,311(-) | DS571292:3711..6311(-) | DS571292 | Entamoeba histolytica HM-1:IMSS | 48 | OG6_100223 | 11 | 866 | 2601 | 97623 | 5.60 | 0 | | | | | GO:0005524;GO:0016887;GO:0005515 | ATP binding;ATPase activity;protein binding | GO:0019538 | protein metabolic process | | | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_042860ORheat shock protein, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_042860 OR heat shock protein, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_042870 | EHI_042870A | 2 | 2 | 1 | | | forward | protein coding | No | 1989 | EHI_042870 | cell surface protease gp63, putative | cell surface protease gp63, putative | 3406949 | C4M655 | Not Assigned | DS571292:7,863..9,901(+) | DS571292:7863..9901(+) | DS571292 | Entamoeba histolytica HM-1:IMSS | 16 | OG6_101754 | 1 | 662 | 1989 | 75511 | 6.46 | 1 | | | GO:0016020 | membrane | GO:0004222;GO:0008270 | metalloendopeptidase activity;zinc ion binding | GO:0007155;GO:0006508 | cell adhesion;proteolysis | | | | | | | | 3.4.24.36 (Leishmanolysin) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_042870ORcell surface protease gp63, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_042870 OR cell surface protease gp63, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_043740 | EHI_043740A | 2 | 2 | 1 | | | forward | protein coding | No | 3192 | EHI_043740 | ubiquitin carboxyl-terminal hydrolase domain containing protein | ubiquitin carboxyl-terminal hydrolase domain containing protein | 3406677 | C4M788 | Not Assigned | DS571320:2,403..5,649(+) | DS571320:2403..5649(+) | DS571320 | Entamoeba histolytica HM-1:IMSS | 8 | OG6_163742 | 0 | 1063 | 3192 | 123062 | 6.83 | 0 | HMM: MTSNDVFIKMLPLLIFIPDYICN, NN: MTSNDVFIKMLPLLIFIPDYICN | NN Sum: 3, NN D: .48, HMM Prob: 0 | | | GO:0016787;GO:0036459 | hydrolase activity;thiol-dependent ubiquitinyl hydrolase activity | GO:0008152;GO:0016579 | metabolic process;protein deubiquitination | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_043740ORubiquitin carboxyl-terminal hydrolase domain containing proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_043740 OR ubiquitin carboxyl-terminal hydrolase domain containing protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_044210 | EHI_044210A | 1 | 1 | 1 | | | forward | protein coding | No | 858 | EHI_044210 | hydrolase, alpha/beta fold family domain containing protein | hydrolase, alpha/beta fold family domain containing protein | 3406682 | C4M793 | Not Assigned | DS571320:21,149..22,006(+) | DS571320:21149..22006(+) | DS571320 | Entamoeba histolytica HM-1:IMSS | 37 | OG6_100231 | 3 | 285 | 858 | 32679 | 5.92 | 2 | | | | | GO:0016787 | hydrolase activity | GO:0008152 | metabolic process | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_044210ORhydrolase, alpha/beta fold family domain containing proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_044210 OR hydrolase, alpha/beta fold family domain containing protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_045290 | EHI_045290A | 1 | 1 | 1 | | | reverse | protein coding | No | 1422 | EHI_045290 | calpain family cysteine protease, putative | calpain family cysteine protease, putative | 3411610 | C4LTE2 | Not Assigned | DS571147:121,131..122,552(-) | DS571147:121131..122552(-) | DS571147 | Entamoeba histolytica HM-1:IMSS | 10 | OG6_104309 | 0 | 473 | 1422 | 53102 | 6.81 | 0 | | | GO:0005622 | intracellular | GO:0004198;GO:0008270 | calcium-dependent cysteine-type endopeptidase activity;zinc ion binding | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_045290ORcalpain family cysteine protease, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_045290 OR calpain family cysteine protease, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_045330 | EHI_045330A | 1 | 1 | 1 | | | forward | protein coding | No | 855 | EHI_045330 | unspecified product | unspecified product | 3411603 | C4LTE6 | Not Assigned | DS571147:130,570..131,424(+) | DS571147:130570..131424(+) | DS571147 | Entamoeba histolytica HM-1:IMSS | 37 | OG6_100231 | 3 | 284 | 855 | 33228 | 8.10 | 2 | | | | | GO:0016787 | hydrolase activity | GO:0008152 | metabolic process | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_045330ORunspecified productANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_045330 OR unspecified product AND Entamoeba histolytica HM-1:IMSS |
|
EHI_045440 | EHI_045440A | 1 | 1 | 1 | | | forward | protein coding | No | 4434 | EHI_045440 | ubiquitin carboxyl-terminal hydrolase domain containing protein | ubiquitin carboxyl-terminal hydrolase domain containing protein | 3407895 | C4LTF7 | Not Assigned | DS571147:148,507..152,940(+) | DS571147:148507..152940(+) | DS571147 | Entamoeba histolytica HM-1:IMSS | 9 | OG6_136986 | 0 | 1477 | 4434 | 172021 | 5.66 | 0 | | | | | GO:0004221;GO:0036459 | obsolete ubiquitin thiolesterase activity;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_045440ORubiquitin carboxyl-terminal hydrolase domain containing proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_045440 OR ubiquitin carboxyl-terminal hydrolase domain containing protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_045560 | EHI_045560A | 1 | 1 | 1 | | | forward | protein coding | No | 2277 | EHI_045560 | hypothetical protein | hypothetical protein | 3407904 | C4LTG7 | Not Assigned | DS571147:171,713..173,989(+) | DS571147:171713..173989(+) | DS571147 | Entamoeba histolytica HM-1:IMSS | 16 | OG6_113142 | 1 | 758 | 2277 | 88069 | 7.94 | 3 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_045560ORhypothetical proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_045560 OR hypothetical protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_049330 | EHI_049330A | 2 | 2 | 1 | 19 | | forward | protein coding | No | 637 | EHI_049330 | proteasome subunit beta type 3, putative | proteasome subunit beta type 3, putative | 3410201 | C4LUD5 | Not Assigned | DS571152:11,041..11,738(+) | DS571152:11041..11719(+) | DS571152 | Entamoeba histolytica HM-1:IMSS | 10 | OG6_101970 | 0 | 205 | 618 | 22699 | 4.85 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_049330ORproteasome subunit beta type 3, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_049330 OR proteasome subunit beta type 3, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_049540 | EHI_049540A | 2 | 2 | 1 | | | forward | protein coding | No | 1140 | EHI_049540 | ubiquitin carboxyl-terminal hydrolase domain containing protein | ubiquitin carboxyl-terminal hydrolase domain containing protein | 3410177 | C4LUF5 | Not Assigned | DS571152:53,749..54,937(+) | DS571152:53749..54937(+) | DS571152 | Entamoeba histolytica HM-1:IMSS | 9 | OG6_114754 | 1 | 379 | 1140 | 43825 | 6.97 | 0 | | | | | GO:0004221;GO:0036459 | obsolete ubiquitin thiolesterase activity;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_049540ORubiquitin carboxyl-terminal hydrolase domain containing proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_049540 OR ubiquitin carboxyl-terminal hydrolase domain containing protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_049940 | EHI_049940A | 1 | 1 | 1 | | | reverse | protein coding | No | 2127 | EHI_049940 | ubiquitin carboxyl-terminal hydrolase 5, putative | ubiquitin carboxyl-terminal hydrolase 5, putative | 3410770 | C4LUJ2 | Not Assigned | DS571152:143,306..145,432(-) | DS571152:143306..145432(-) | DS571152 | Entamoeba histolytica HM-1:IMSS | 11 | OG6_101380 | 0 | 708 | 2127 | 82089 | 4.86 | 0 | | | | | GO:0004221;GO:0005515;GO:0036459;GO:0008270 | obsolete ubiquitin thiolesterase activity;protein binding;thiol-dependent ubiquitinyl hydrolase activity;zinc ion binding | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_049940ORubiquitin carboxyl-terminal hydrolase 5, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_049940 OR ubiquitin carboxyl-terminal hydrolase 5, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_050570 | EHI_050570A | 1 | 1 | 1 | | | forward | protein coding | No | 936 | EHI_050570 | cysteine proteinase, putative | cysteine proteinase, putative | 3410919 | C4LTT0 | Not Assigned | DS571149:63,330..64,265(+) | DS571149:63330..64265(+) | DS571149 | Entamoeba histolytica HM-1:IMSS | 90 | OG6_100116 | 10 | 311 | 936 | 33686 | 7.40 | 0 | HMM: MFNFLLLVVAASAIDFKSWAA, NN: MFNFLLLVVAASAIDFKSWAA | NN Sum: 4, NN D: .56, HMM Prob: .97 | | | GO:0004197;GO:0008234 | cysteine-type endopeptidase activity;cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_050570ORcysteine proteinase, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_050570 OR cysteine proteinase, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_050800 | EHI_050800A | 1 | 1 | 1 | | | forward | protein coding | No | 1704 | EHI_050800 | hypothetical protein | hypothetical protein | 3402808 | C4LTV0 | Not Assigned | DS571149:115,626..117,329(+) | DS571149:115626..117329(+) | DS571149 | Entamoeba histolytica HM-1:IMSS | 32 | OG6_159401 | 3 | 567 | 1704 | 64500 | 5.08 | 1 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_050800ORhypothetical proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_050800 OR hypothetical protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_051580 | EHI_051580A | 1 | 1 | 1 | | | reverse | protein coding | No | 645 | EHI_051580 | hypothetical protein | hypothetical protein | 6219518 | B1N2Z7 | Not Assigned | DS571176:25,824..26,468(-) | DS571176:25824..26468(-) | DS571176 | Entamoeba histolytica HM-1:IMSS | 12 | OG6_101924 | 2 | 214 | 645 | 25031 | 8.01 | 0 | | | | | GO:0003674 | molecular_function | GO:0008150 | biological_process | | | | | | | | 3.6.3.14 (Transferred entry: 7.1.2.2) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_051580ORhypothetical proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_051580 OR hypothetical protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_051690 | EHI_051690A | 1 | 1 | 1 | | | reverse | protein coding | No | 627 | EHI_051690 | hypothetical protein | hypothetical protein | 6219519 | B1N2Z8 | Not Assigned | DS571176:26,566..27,192(-) | DS571176:26566..27192(-) | DS571176 | Entamoeba histolytica HM-1:IMSS | 12 | OG6_101924 | 2 | 209 | 627 | 23568 | 4.96 | 0 | | | | | GO:0003674 | molecular_function | GO:0008150 | biological_process | | | | | | | | 3.6.3.14 (Transferred entry: 7.1.2.2) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_051690ORhypothetical proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_051690 OR hypothetical protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_051790 | EHI_051790A | 1 | 1 | 1 | | | forward | protein coding | No | 498 | EHI_051790 | hypothetical protein | hypothetical protein | 3407698 | C4LY73 | Not Assigned | DS571176:47,440..47,937(+) | DS571176:47440..47937(+) | DS571176 | Entamoeba histolytica HM-1:IMSS | 4 | OG6_187453 | 1 | 165 | 498 | 19519 | 8.54 | 2 | | | GO:0016021;GO:0005787 | integral component of membrane;signal peptidase complex | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_051790ORhypothetical proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_051790 OR hypothetical protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_052050 | EHI_052050A | 1 | 1 | 1 | | | reverse | protein coding | No | 1254 | EHI_052050 | 26S protease regulatory subunit, putative | 26S protease regulatory subunit, putative | 3409547 | C4M846 | Not Assigned | DS571347:3,652..4,905(-) | DS571347:3652..4905(-) | DS571347 | Entamoeba histolytica HM-1:IMSS | 10 | OG6_101899 | 1 | 417 | 1254 | 46914 | 5.49 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016887;GO:0016787 | ATP binding;ATPase activity;hydrolase activity | GO:0030163;GO:0006508 | protein catabolic process;proteolysis | | | | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_052050OR26S protease regulatory subunit, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_052050 OR 26S protease regulatory subunit, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_052140 | EHI_052140A | 1 | 1 | 1 | 13 | | reverse | protein coding | No | 724 | EHI_052140 | proteasome subunit alpha type 2-A, putative | proteasome subunit alpha type 2-A, putative | 3409637 | C4M854 | Not Assigned | DS571347:15,150..15,873(-) | DS571347:15163..15873(-) | DS571347 | Entamoeba histolytica HM-1:IMSS | 11 | OG6_101969 | 0 | 236 | 711 | 26125 | 5.17 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_052140ORproteasome subunit alpha type 2-A, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_052140 OR proteasome subunit alpha type 2-A, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_053020 | EHI_053020A | 1 | 1 | 1 | | | forward | protein coding | No | 1269 | EHI_053020 | 26S protease regulatory subunit, putative | 26S protease regulatory subunit, putative | 3411429 | C4M3C0 | Not Assigned | DS571238:9,824..11,092(+) | DS571238:9824..11092(+) | DS571238 | Entamoeba histolytica HM-1:IMSS | 11 | OG6_101915 | 0 | 422 | 1269 | 47367 | 5.22 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016887;GO:0016787 | ATP binding;ATPase activity;hydrolase activity | GO:0030163;GO:0006508 | protein catabolic process;proteolysis | | | | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_053020OR26S protease regulatory subunit, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_053020 OR 26S protease regulatory subunit, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_054530 | EHI_054530A | 1 | 1 | 1 | | | reverse | protein coding | No | 1401 | EHI_054530 | serine carboxypeptidase (S28) family protein | serine carboxypeptidase (S28) family protein | 3406398 | C4M2I4 | Not Assigned | DS571225:10,709..12,109(-) | DS571225:10709..12109(-) | DS571225 | Entamoeba histolytica HM-1:IMSS | 24 | OG6_100644 | 2 | 466 | 1401 | 53075 | 4.77 | 0 | HMM: MFLFLLLTTSLGFRFQN, NN: MFLFLLLTTSLGF | NN Sum: 2, NN D: .55, HMM Prob: .42 | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.16.2 (Lysosomal Pro-Xaa carboxypeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_054530ORserine carboxypeptidase (S28) family proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_054530 OR serine carboxypeptidase (S28) family protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_055660 | EHI_055660A | 1 | 1 | 1 | | | forward | protein coding | No | 1041 | EHI_055660 | peptidase, C54 family | peptidase, C54 family | 3406350 | C4M7A8 | Not Assigned | DS571322:5,955..6,995(+) | DS571322:5955..6995(+) | DS571322 | Entamoeba histolytica HM-1:IMSS | 31 | OG6_139788 | 3 | 346 | 1041 | 39466 | 6.50 | 0 | | | | | GO:0008233 | peptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_055660ORpeptidase, C54 familyANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_055660 OR peptidase, C54 family AND Entamoeba histolytica HM-1:IMSS |
|
EHI_058500 | EHI_058500A | 2 | 2 | 1 | | | forward | protein coding | No | 978 | EHI_058500 | peptidase, C54 family | peptidase, C54 family | 3405697 | C4M5F6 | Not Assigned | DS571278:18,269..19,320(+) | DS571278:18269..19320(+) | DS571278 | Entamoeba histolytica HM-1:IMSS | 31 | OG6_139788 | 3 | 325 | 978 | 36904 | 6.58 | 0 | | | | | GO:0008233 | peptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_058500ORpeptidase, C54 familyANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_058500 OR peptidase, C54 family AND Entamoeba histolytica HM-1:IMSS |
|
EHI_059810 | EHI_059810A | 1 | 1 | 1 | | | reverse | protein coding | No | 3519 | EHI_059810 | ubiquitin carboxyl-terminal hydrolase domain containing protein | ubiquitin carboxyl-terminal hydrolase domain containing protein | 6219728 | B1N3J1 | Not Assigned | DS571234:19,331..22,849(-) | DS571234:19331..22849(-) | DS571234 | Entamoeba histolytica HM-1:IMSS | 8 | OG6_501693 | 0 | 1172 | 3519 | 139235 | 7.13 | 0 | | | | | GO:0004221;GO:0036459 | obsolete ubiquitin thiolesterase activity;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_059810ORubiquitin carboxyl-terminal hydrolase domain containing proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_059810 OR ubiquitin carboxyl-terminal hydrolase domain containing protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_060330 | EHI_060330A | 1 | 1 | 1 | | | reverse | protein coding | No | 936 | EHI_060330 | peptidase S54 (rhomboid) family protein | peptidase S54 (rhomboid) family protein | 3407547 | C4M6J0 | Not Assigned | DS571301:3,747..4,682(-) | DS571301:3747..4682(-) | DS571301 | Entamoeba histolytica HM-1:IMSS | 6 | OG6_501759 | 0 | 311 | 936 | 35781 | 7.56 | 8 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | 3.4.21.- (Serine endopeptidases.) | 3.4.21.- (Serine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_060330ORpeptidase S54 (rhomboid) family proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_060330 OR peptidase S54 (rhomboid) family protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_062480 | EHI_062480A | 1 | 1 | 1 | | | reverse | protein coding | No | 1263 | EHI_062480 | cysteine protease, putative | cysteine protease, putative | 3405448 | C4M1N5 | Not Assigned | DS571213:10,210..11,472(-) | DS571213:10210..11472(-) | DS571213 | Entamoeba histolytica HM-1:IMSS | 8 | OG6_502820 | 0 | 420 | 1263 | 49514 | 8.67 | 0 | HMM: MKNIINVVILMLFVNCFGD, NN: MKNIINVVILMLFVNCFGD | NN Sum: 4, NN D: .74, HMM Prob: .78 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_062480ORcysteine protease, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_062480 OR cysteine protease, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_064200 | EHI_064200A | 2 | 2 | 1 | | | reverse | protein coding | No | 516 | EHI_064200 | ubiquitin carboxyl-terminal hydrolase 5, putative | ubiquitin carboxyl-terminal hydrolase 5, putative | 6219612 | B1N380 | Not Assigned | DS571196:4,925..5,489(-) | DS571196:4925..5489(-) | DS571196 | Entamoeba histolytica HM-1:IMSS | 9 | OG6_114754 | 1 | 171 | 516 | 20080 | 7.08 | 0 | | | | | GO:0004221;GO:0036459 | obsolete ubiquitin thiolesterase activity;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_064200ORubiquitin carboxyl-terminal hydrolase 5, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_064200 OR ubiquitin carboxyl-terminal hydrolase 5, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_064430 | EHI_064430A | 1 | 1 | 1 | | | reverse | protein coding | No | 789 | EHI_064430 | OTU-like cysteine protease, putative | OTU-like cysteine protease, putative | 3408333 | C4M0B2 | Not Assigned | DS571196:15,764..16,552(-) | DS571196:15764..16552(-) | DS571196 | Entamoeba histolytica HM-1:IMSS | 12 | OG6_102949 | 0 | 262 | 789 | 30674 | 5.69 | 0 | | | | | | | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_064430OROTU-like cysteine protease, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_064430 OR OTU-like cysteine protease, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_064460 | EHI_064460A | 1 | 1 | 1 | | | reverse | protein coding | No | 1185 | EHI_064460 | ubiquitin carboxyl-terminal hydrolase domain containing protein | ubiquitin carboxyl-terminal hydrolase domain containing protein | 3408336 | C4M0B5 | Not Assigned | DS571196:22,421..23,605(-) | DS571196:22421..23605(-) | DS571196 | Entamoeba histolytica HM-1:IMSS | 7 | OG6_175840 | 0 | 394 | 1185 | 45862 | 6.78 | 0 | | | | | GO:0004221;GO:0036459 | obsolete ubiquitin thiolesterase activity;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_064460ORubiquitin carboxyl-terminal hydrolase domain containing proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_064460 OR ubiquitin carboxyl-terminal hydrolase domain containing protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_067510 | EHI_067510A | 1 | 1 | 1 | | | forward | protein coding | No | 858 | EHI_067510 | Ulp1 protease family, C-terminal catalytic domain containing protein | Ulp1 protease family, C-terminal catalytic domain containing protein | 3411460 | C4M9F7 | Not Assigned | DS571402:6,253..7,110(+) | DS571402:6253..7110(+) | DS571402 | Entamoeba histolytica HM-1:IMSS | 8 | OG6_101235 | 0 | 285 | 858 | 32646 | 4.95 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.68 (Ulp1 peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_067510ORUlp1 protease family, C-terminal catalytic domain containing proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_067510 OR Ulp1 protease family, C-terminal catalytic domain containing protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_068090 | EHI_068090A | 1 | 1 | 1 | | | reverse | protein coding | No | 1443 | EHI_068090 | serine carboxypeptidase (S28) family protein | serine carboxypeptidase (S28) family protein | 3411117 | C4LU03 | Not Assigned | DS571150:60,049..61,491(-) | DS571150:60049..61491(-) | DS571150 | Entamoeba histolytica HM-1:IMSS | 24 | OG6_100644 | 2 | 480 | 1443 | 54072 | 4.49 | 0 | HMM: MLLLALCVICSYAKLS, NN: MLLLALCVICSYAKLSLNQ | NN Sum: 3, NN D: .54, HMM Prob: .95 | | | GO:0004188;GO:0008236 | obsolete serine-type Pro-X carboxypeptidase activity;serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.16.2 (Lysosomal Pro-Xaa carboxypeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_068090ORserine carboxypeptidase (S28) family proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_068090 OR serine carboxypeptidase (S28) family protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_072140 | EHI_072140A | 1 | 1 | 1 | | | forward | protein coding | No | 2601 | EHI_072140 | heat shock protein, putative | heat shock protein, putative | 3406947 | | Not Assigned | DS571289:36,415..39,015(+) | DS571289:36415..39015(+) | DS571289 | Entamoeba histolytica HM-1:IMSS | 48 | OG6_100223 | 11 | 866 | 2601 | 97623 | 5.60 | 0 | | | | | GO:0005524;GO:0016887;GO:0005515 | ATP binding;ATPase activity;protein binding | GO:0019538 | protein metabolic process | | | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_072140ORheat shock protein, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_072140 OR heat shock protein, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_074180 | EHI_074180A | 1 | 1 | 1 | 29 | | forward | protein coding | No | 977 | EHI_074180 | cysteine proteinase 1, putative | cysteine proteinase 1, putative | 3404457 | C4M307 | Not Assigned | DS571232:53,874..54,850(+) | DS571232:53874..54821(+) | DS571232 | Entamoeba histolytica HM-1:IMSS | 90 | OG6_100116 | 10 | 315 | 948 | 35083 | 6.29 | 0 | | | | | GO:0004197;GO:0008234 | cysteine-type endopeptidase activity;cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_074180ORcysteine proteinase 1, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_074180 OR cysteine proteinase 1, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_074770 | EHI_074770A | 1 | 1 | 1 | | | forward | protein coding | No | 576 | EHI_074770 | proteasome regulatory subunit, putative | proteasome regulatory subunit, putative | 3403877 | C4M9F1 | Not Assigned | DS571401:14,935..15,510(+) | DS571401:14935..15510(+) | DS571401 | Entamoeba histolytica HM-1:IMSS | 10 | OG6_102356 | 0 | 191 | 576 | 22250 | 4.90 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_074770ORproteasome regulatory subunit, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_074770 OR proteasome regulatory subunit, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_075660 | EHI_075660A | 2 | 2 | 1 | | | reverse | protein coding | No | 1251 | EHI_075660 | CAAX prenyl protease, putative | CAAX prenyl protease, putative | 3403055 | C4M998 | Not Assigned | DS571394:10,937..12,270(-) | DS571394:10937..12270(-) | DS571394 | Entamoeba histolytica HM-1:IMSS | 13 | OG6_101632 | 0 | 416 | 1251 | 48607 | 6.52 | 7 | HMM: MFPYWTSIIVLTILTTLF, NN: MFPYWTSIIVLTILTTLFELY | NN Sum: 2, NN D: .56, HMM Prob: .19 | GO:0016020 | membrane | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.24.84 (Ste24 endopeptidase) | 3.4.24.84 (Ste24 endopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_075660ORCAAX prenyl protease, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_075660 OR CAAX prenyl protease, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_076480 | EHI_076480A | 1 | 1 | 1 | | | reverse | protein coding | No | 603 | EHI_076480 | heat shock protein 101, putative | heat shock protein 101, putative | 6220654 | B1N5T5 | Not Assigned | DS572161:7..609(-) | DS572161:7..609(-) | DS572161 | Entamoeba histolytica HM-1:IMSS | 3 | OG6_148837 | 4 | 201 | 603 | 22944 | 6.57 | 0 | | | | | GO:0005515 | protein binding | GO:0019538 | protein metabolic process | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_076480ORheat shock protein 101, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_076480 OR heat shock protein 101, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_078710 | EHI_078710A | 1 | 1 | 1 | | | reverse | protein coding | No | 597 | EHI_078710 | probable proteasome subunit beta type 2, putative | probable proteasome subunit beta type 2, putative | 3405733 | C4M4F3 | Not Assigned | DS571258:30,938..31,534(-) | DS571258:30938..31534(-) | DS571258 | Entamoeba histolytica HM-1:IMSS | 11 | OG6_102061 | 0 | 198 | 597 | 22302 | 6.12 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_078710ORprobable proteasome subunit beta type 2, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_078710 OR probable proteasome subunit beta type 2, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_080890 | EHI_080890A | 1 | 1 | 1 | | | reverse | protein coding | No | 1254 | EHI_080890 | 26S protease regulatory subunit, putative | 26S protease regulatory subunit, putative | 6220187 | B1N4Q6 | Not Assigned | DS571466:10,093..11,346(-) | DS571466:10093..11346(-) | DS571466 | Entamoeba histolytica HM-1:IMSS | 10 | OG6_101899 | 1 | 417 | 1254 | 46884 | 5.49 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016887;GO:0016787 | ATP binding;ATPase activity;hydrolase activity | GO:0030163;GO:0006508 | protein catabolic process;proteolysis | | | | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_080890OR26S protease regulatory subunit, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_080890 OR 26S protease regulatory subunit, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_082250 | EHI_082250A | 1 | 1 | 1 | | | reverse | protein coding | No | 1179 | EHI_082250 | hypothetical protein | hypothetical protein | 3406229 | C4M5U7 | Not Assigned | DS571285:32,721..33,899(-) | DS571285:32721..33899(-) | DS571285 | Entamoeba histolytica HM-1:IMSS | 20 | OG6_100626 | 1 | 392 | 1179 | 44060 | 5.00 | 0 | | | | | GO:0016787;GO:0008237;GO:0046983;GO:0009014 | hydrolase activity;metallopeptidase activity;protein dimerization activity;succinyl-diaminopimelate desuccinylase activity | GO:0008152;GO:0006508 | metabolic process;proteolysis | | | | | | | | 3.5.1.16 (Acetylornithine deacetylase) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_082250ORhypothetical proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_082250 OR hypothetical protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_084060 | EHI_084060A | 1 | 1 | 1 | | | forward | protein coding | No | 1296 | EHI_084060 | cysteine protease, putative | cysteine protease, putative | 6220519 | | Not Assigned | DS571850:1,771..3,066(+) | DS571850:1771..3066(+) | DS571850 | Entamoeba histolytica HM-1:IMSS | 52 | OG6_123941 | 10 | 431 | 1296 | 48611 | 4.68 | 0 | HMM: MIGVVLVLLVLGSEGN, NN: MIGVVLVLLVLGSEGNSF | NN Sum: 4, NN D: .66, HMM Prob: .99 | | | GO:0008234;GO:0004215 | cysteine-type peptidase activity;obsolete cathepsin H activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.16 (Cathepsin H) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_084060ORcysteine protease, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_084060 OR cysteine protease, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_084690 | EHI_084690A | 1 | 1 | 1 | | | forward | protein coding | No | 1221 | EHI_084690 | lecithin:cholesterol acyltransferase domain-containing protein | lecithin:cholesterol acyltransferase domain-containing protein | 3409407 | C4M1K0 | Not Assigned | DS571211:14,942..16,162(+) | DS571211:14942..16162(+) | DS571211 | Entamoeba histolytica HM-1:IMSS | 89 | OG6_101376 | 8 | 406 | 1221 | 45802 | 6.62 | 0 | HMM: MLVIVLLYIICSIQAQ, NN: MLVIVLLYIICSIQAQ | NN Sum: 4, NN D: .69, HMM Prob: .99 | | | GO:0008374;GO:0003674 | O-acyltransferase activity;molecular_function | GO:0008150;GO:0006629 | biological_process;lipid metabolic process | | | | | | | | 2.3.1.43 (Phosphatidylcholine--sterol O-acyltransferase) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_084690ORlecithin:cholesterol acyltransferase domain-containing proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_084690 OR lecithin:cholesterol acyltransferase domain-containing protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_086080 | EHI_086080A | 1 | 1 | 1 | | | reverse | protein coding | No | 750 | EHI_086080 | proteasome subunit alpha type 1, putative | proteasome subunit alpha type 1, putative | 3407400 | C4M363 | Not Assigned | DS571235:26,555..27,304(-) | DS571235:26555..27304(-) | DS571235 | Entamoeba histolytica HM-1:IMSS | 10 | OG6_102143 | 0 | 249 | 750 | 28119 | 5.69 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_086080ORproteasome subunit alpha type 1, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_086080 OR proteasome subunit alpha type 1, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_086370 | EHI_086370A | 1 | 1 | 1 | | | forward | protein coding | No | 834 | EHI_086370 | hydrolase, alpha/beta fold family domain containing protein | hydrolase, alpha/beta fold family domain containing protein | 3403856 | C4M8Y5 | Not Assigned | DS571381:2,390..3,223(+) | DS571381:2390..3223(+) | DS571381 | Entamoeba histolytica HM-1:IMSS | 37 | OG6_100231 | 3 | 277 | 834 | 31898 | 7.40 | 2 | | | | | GO:0016787 | hydrolase activity | GO:0008152 | metabolic process | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_086370ORhydrolase, alpha/beta fold family domain containing proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_086370 OR hydrolase, alpha/beta fold family domain containing protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_090000 | EHI_090000A | 1 | 1 | 1 | | | forward | protein coding | No | 738 | EHI_090000 | proteasome subunit alpha type 7, putative | proteasome subunit alpha type 7, putative | 3402987 | C4MA29 | Not Assigned | DS571441:10,395..11,132(+) | DS571441:10395..11132(+) | DS571441 | Entamoeba histolytica HM-1:IMSS | 11 | OG6_101207 | 1 | 245 | 738 | 27566 | 6.81 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_090000ORproteasome subunit alpha type 7, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_090000 OR proteasome subunit alpha type 7, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_091450 | EHI_091450A | 2 | 2 | 1 | | | reverse | protein coding | No | 1953 | EHI_091450 | cysteine protease, putative | cysteine protease, putative | 3404695 | Q8I8D2 | Not Assigned | DS571400:783..2,794(-) | DS571400:783..2794(-) | DS571400 | Entamoeba histolytica HM-1:IMSS | 40 | OG6_159415 | 3 | 650 | 1953 | 74074 | 4.74 | 1 | HMM: MNEITIKVILLFSIYTYAQ, NN: MNEITIKVILLFSIYTYAQ | NN Sum: 4, NN D: .73, HMM Prob: .25 | | | GO:0008234;GO:0004215 | cysteine-type peptidase activity;obsolete cathepsin H activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.50 (V-cath endopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_091450ORcysteine protease, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_091450 OR cysteine protease, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_092280 | EHI_092280A | 1 | 1 | 1 | | | forward | protein coding | No | 900 | EHI_092280 | GPI-anchor transamidase, putative | GPI-anchor transamidase, putative | 3408858 | C4LUZ2 | Not Assigned | DS571155:53,656..54,555(+) | DS571155:53656..54555(+) | DS571155 | Entamoeba histolytica HM-1:IMSS | 10 | OG6_101767 | 0 | 299 | 900 | 34839 | 6.40 | 0 | HMM: MNIIITLLLCFCFGIEQPQQNQAV, NN: MNIIITLLLCFCFGIEQPQQNQAV | NN Sum: 4, NN D: .59, HMM Prob: .97 | | | GO:0001509;GO:0008233 | obsolete legumain activity;peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.-.-.- (Hydrolases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_092280ORGPI-anchor transamidase, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_092280 OR GPI-anchor transamidase, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_093970 | EHI_093970A | 1 | 1 | 1 | | | forward | protein coding | No | 1788 | EHI_093970 | hypothetical protein | hypothetical protein | 3410877 | C4LYI8 | Not Assigned | DS571179:64,587..66,374(+) | DS571179:64587..66374(+) | DS571179 | Entamoeba histolytica HM-1:IMSS | 37 | OG6_113471 | 5 | 595 | 1788 | 68804 | 5.00 | 1 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_093970ORhypothetical proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_093970 OR hypothetical protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_094470 | EHI_094470A | 1 | 1 | 1 | | | reverse | protein coding | No | 366 | EHI_094470 | heat shock protein 101, putative | heat shock protein 101, putative | 6220600 | B1N5P1 | Not Assigned | DS571978:2,002..2,367(-) | DS571978:2002..2367(-) | DS571978 | Entamoeba histolytica HM-1:IMSS | 1 | OG6_502688 | 0 | 121 | 366 | 13757 | 9.76 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_094470ORheat shock protein 101, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_094470 OR heat shock protein 101, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_094680 | EHI_094680A | 1 | 1 | 1 | | | forward | protein coding | No | 945 | EHI_094680 | chaperone clpB, putative | chaperone clpB, putative | 6220648 | B1N5T0 | Not Assigned | DS572141:33..977(+) | DS572141:33..977(+) | DS572141 | Entamoeba histolytica HM-1:IMSS | 48 | OG6_100223 | 11 | 314 | 945 | 35017 | 5.61 | 0 | | | | | GO:0005524;GO:0016887 | ATP binding;ATPase activity | | | | | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_094680ORchaperone clpB, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_094680 OR chaperone clpB, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_094830 | EHI_094830.mRNA | 1 | 1 | 1 | | | forward | protein coding | Yes | 921 | EHI_094830 | hypothetical protein, pseudogene | hypothetical protein, pseudogene | 6220259 | | Not Assigned | DS571516:12,176..13,096(+) | DS571516:12176..13096(+) | DS571516 | Entamoeba histolytica HM-1:IMSS | 0 | N/A (orthology not determined because poor protein quality) | 0 | 307 | 921 | 34056 | 9.20 | 2 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_094830ORhypothetical protein, pseudogeneANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_094830 OR hypothetical protein, pseudogene AND Entamoeba histolytica HM-1:IMSS |
|
EHI_095840 | EHI_095840A | 1 | 1 | 1 | | | forward | protein coding | No | 723 | EHI_095840 | retroviral aspartyl protease domain-containing protein | retroviral aspartyl protease domain-containing protein | 3402455 | C4M3E1 | Not Assigned | DS571239:10,407..11,129(+) | DS571239:10407..11129(+) | DS571239 | Entamoeba histolytica HM-1:IMSS | 7 | OG6_101685 | 1 | 240 | 723 | 27284 | 5.98 | 1 | | | | | GO:0004190 | aspartic-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_095840ORretroviral aspartyl protease domain-containing proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_095840 OR retroviral aspartyl protease domain-containing protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_096730 | EHI_096730A | 1 | 1 | 1 | | | reverse | protein coding | No | 309 | EHI_096730 | prolyl oligopeptidase family protein | prolyl oligopeptidase family protein | 3409997 | | Not Assigned | DS571163:109,437..109,745(-) | DS571163:109437..109745(-) | DS571163 | Entamoeba histolytica HM-1:IMSS | 0 | OG6_204751 | 1 | 102 | 309 | 12383 | 9.12 | 0 | | | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_096730ORprolyl oligopeptidase family proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_096730 OR prolyl oligopeptidase family protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_096740 | EHI_096740A | 1 | 1 | 1 | | | forward | protein coding | No | 894 | EHI_096740 | cysteine proteinase, putative | cysteine proteinase, putative | 3409996 | Q8I8D8 | Not Assigned | DS571163:109,943..110,836(+) | DS571163:109943..110836(+) | DS571163 | Entamoeba histolytica HM-1:IMSS | 90 | OG6_100116 | 10 | 297 | 894 | 34437 | 6.86 | 0 | HMM: MYRNNLFFLIIVNFSFAI, NN: MYRNNLFFLIIVNFSFAI | NN Sum: 3, NN D: .71, HMM Prob: .64 | | | GO:0004197;GO:0008234 | cysteine-type endopeptidase activity;cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_096740ORcysteine proteinase, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_096740 OR cysteine proteinase, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_097900 | EHI_097900A | 1 | 1 | 1 | | | reverse | protein coding | No | 1422 | EHI_097900 | cysteine protease, putative | cysteine protease, putative | 3405365 | C4M490 | Not Assigned | DS571255:15,189..16,610(-) | DS571255:15189..16610(-) | DS571255 | Entamoeba histolytica HM-1:IMSS | 40 | OG6_159415 | 3 | 473 | 1422 | 53452 | 4.85 | 0 | HMM: MIFFVIFFIINLALAE, NN: MIFFVIFFIINLALAE | NN Sum: 4, NN D: .88, HMM Prob: .99 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.50 (V-cath endopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_097900ORcysteine protease, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_097900 OR cysteine protease, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_097940 | EHI_097940A | 1 | 1 | 1 | | | forward | protein coding | No | 1617 | EHI_097940 | Ulp1 protease family, C-terminal catalytic domain containing protein | Ulp1 protease family, C-terminal catalytic domain containing protein | 3405349 | C4M492 | Not Assigned | DS571255:20,797..22,413(+) | DS571255:20797..22413(+) | DS571255 | Entamoeba histolytica HM-1:IMSS | 24 | OG6_102905 | 2 | 538 | 1617 | 63929 | 5.68 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_097940ORUlp1 protease family, C-terminal catalytic domain containing proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_097940 OR Ulp1 protease family, C-terminal catalytic domain containing protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_098060 | EHI_098060A | 1 | 1 | 1 | | | forward | protein coding | No | 744 | EHI_098060 | proteasome subunit alpha type 3, putative | proteasome subunit alpha type 3, putative | 3405360 | C4M4A2 | Not Assigned | DS571255:44,912..45,655(+) | DS571255:44912..45655(+) | DS571255 | Entamoeba histolytica HM-1:IMSS | 10 | OG6_102011 | 1 | 247 | 744 | 27669 | 7.43 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_098060ORproteasome subunit alpha type 3, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_098060 OR proteasome subunit alpha type 3, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_098460 | EHI_098460A | 1 | 1 | 1 | | | reverse | protein coding | No | 1008 | EHI_098460 | hypothetical protein | hypothetical protein | 3410341 | C4LXC7 | Not Assigned | DS571169:80,308..81,315(-) | DS571169:80308..81315(-) | DS571169 | Entamoeba histolytica HM-1:IMSS | 10 | OG6_100777 | 0 | 335 | 1008 | 39732 | 9.67 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_098460ORhypothetical proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_098460 OR hypothetical protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_104450 | EHI_104450A | 1 | 1 | 1 | | | forward | protein coding | No | 1617 | EHI_104450 | hypothetical protein | hypothetical protein | 3409327 | C4LZ56 | Not Assigned | DS571185:31,570..33,186(+) | DS571185:31570..33186(+) | DS571185 | Entamoeba histolytica HM-1:IMSS | 10 | OG6_204729 | 1 | 538 | 1617 | 61932 | 7.20 | 1 | HMM: MEQPTKKAVIPFWILWSGLIVLNLFILVVTITSAC, NN: MEQPTKKAVIPFWILWSGLIVLNLFILVVTITSAC | NN Sum: 4, NN D: .8, HMM Prob: .46 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_104450ORhypothetical proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_104450 OR hypothetical protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_104610 | EHI_104610A | 1 | 1 | 1 | | | reverse | protein coding | No | 933 | EHI_104610 | hypothetical protein, conserved | hypothetical protein, conserved | 3402904 | C4LZ70 | Not Assigned | DS571185:61,680..62,612(-) | DS571185:61680..62612(-) | DS571185 | Entamoeba histolytica HM-1:IMSS | 11 | OG6_104384 | 0 | 310 | 933 | 36939 | 7.63 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_104610ORhypothetical protein, conservedANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_104610 OR hypothetical protein, conserved AND Entamoeba histolytica HM-1:IMSS |
|
EHI_105770 | EHI_105770A | 1 | 1 | 1 | | | reverse | protein coding | No | 498 | EHI_105770 | hypothetical protein | hypothetical protein | 3410956 | C4M9H4 | Not Assigned | DS571403:1,305..1,802(-) | DS571403:1305..1802(-) | DS571403 | Entamoeba histolytica HM-1:IMSS | 4 | OG6_187453 | 1 | 165 | 498 | 19510 | 7.39 | 2 | | | GO:0016021;GO:0005787 | integral component of membrane;signal peptidase complex | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_105770ORhypothetical proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_105770 OR hypothetical protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_106690 | EHI_106690A | 1 | 1 | 1 | | | forward | protein coding | No | 1296 | EHI_106690 | aspartyl aminopeptidase, putative | aspartyl aminopeptidase, putative | 3404772 | C4MBI8 | Not Assigned | DS571699:2,619..3,914(+) | DS571699:2619..3914(+) | DS571699 | Entamoeba histolytica HM-1:IMSS | 18 | OG6_102047 | 1 | 431 | 1296 | 47688 | 7.14 | 0 | | | GO:0005773 | vacuole | GO:0004177;GO:0004250;GO:0042576;GO:0008270 | aminopeptidase activity;obsolete aminopeptidase I activity;obsolete aspartyl aminopeptidase activity;zinc ion binding | GO:0006508 | proteolysis | | | | | | | | 3.4.11.21 (Aspartyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_106690ORaspartyl aminopeptidase, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_106690 OR aspartyl aminopeptidase, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_108240 | EHI_108240A | 1 | 1 | 1 | | | reverse | protein coding | No | 351 | EHI_108240 | cysteine protease, putative | cysteine protease, putative | 6220133 | B1N4K4 | Not Assigned | DS571425:3,484..3,834(-) | DS571425:3484..3834(-) | DS571425 | Entamoeba histolytica HM-1:IMSS | 90 | OG6_100116 | 10 | 116 | 351 | 12521 | 7.08 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_108240ORcysteine protease, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_108240 OR cysteine protease, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_109860 | EHI_109860A | 1 | 1 | 1 | | | forward | protein coding | No | 2421 | EHI_109860 | chromatin-specific transcription elongation factor, putative | chromatin-specific transcription elongation factor, putative | 3406513 | C4M3K5 | Not Assigned | DS571242:18,721..21,141(+) | DS571242:18721..21141(+) | DS571242 | Entamoeba histolytica HM-1:IMSS | 10 | OG6_102309 | 0 | 806 | 2421 | 92989 | 5.80 | 0 | | | | | | | | | | | | | | | | 1.1.1.27 (L-lactate dehydrogenase) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_109860ORchromatin-specific transcription elongation factor, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_109860 OR chromatin-specific transcription elongation factor, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_110170 | EHI_110170A | 1 | 1 | 1 | | | reverse | protein coding | No | 4899 | EHI_110170 | ubiquitin carboxyl-terminal hydrolase domain containing protein | ubiquitin carboxyl-terminal hydrolase domain containing protein | 3411355 | C4LU71 | Not Assigned | DS571151:11,126..16,024(-) | DS571151:11126..16024(-) | DS571151 | Entamoeba histolytica HM-1:IMSS | 16 | OG6_204261 | 1 | 1632 | 4899 | 190315 | 6.50 | 1 | | | | | GO:0004221;GO:0036459 | obsolete ubiquitin thiolesterase activity;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_110170ORubiquitin carboxyl-terminal hydrolase domain containing proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_110170 OR ubiquitin carboxyl-terminal hydrolase domain containing protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_110750 | EHI_110750A | 1 | 1 | 1 | | | reverse | protein coding | No | 1938 | EHI_110750 | dipeptidyl-peptidase III, putative | dipeptidyl-peptidase III, putative | 3408574 | C4LUC2 | Not Assigned | DS571151:143,283..145,220(-) | DS571151:143283..145220(-) | DS571151 | Entamoeba histolytica HM-1:IMSS | 9 | OG6_103290 | 0 | 645 | 1938 | 73982 | 5.05 | 0 | | | GO:0005737 | cytoplasm | GO:0008239;GO:0017039 | dipeptidyl-peptidase activity;obsolete dipeptidyl-peptidase III activity | GO:0006508 | proteolysis | | | | | | | 3.4.14.4 (Dipeptidyl-peptidase III) | 3.4.14.4 (Dipeptidyl-peptidase III) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_110750ORdipeptidyl-peptidase III, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_110750 OR dipeptidyl-peptidase III, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_114340 | EHI_114340A | 2 | 2 | 1 | | | reverse | protein coding | No | 1143 | EHI_114340 | acetylornithine deacetylase, putative | acetylornithine deacetylase, putative | 3404035 | C4M8M9 | Not Assigned | DS571368:7,713..8,903(-) | DS571368:7713..8903(-) | DS571368 | Entamoeba histolytica HM-1:IMSS | 20 | OG6_100626 | 1 | 380 | 1143 | 42517 | 5.15 | 0 | | | | | GO:0008777;GO:0016787;GO:0008237;GO:0046983 | acetylornithine deacetylase activity;hydrolase activity;metallopeptidase activity;protein dimerization activity | GO:0008152;GO:0006508 | metabolic process;proteolysis | | | | | | | | 3.5.1.16 (Acetylornithine deacetylase) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_114340ORacetylornithine deacetylase, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_114340 OR acetylornithine deacetylase, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_115380 | EHI_115380A | 1 | 1 | 1 | | | forward | protein coding | No | 1770 | EHI_115380 | aminopeptidase, putative | aminopeptidase, putative | 3404278 | C4M8E9 | Not Assigned | DS571357:24,255..26,024(+) | DS571357:24255..26024(+) | DS571357 | Entamoeba histolytica HM-1:IMSS | 20 | OG6_100896 | 1 | 589 | 1770 | 68273 | 4.99 | 0 | | | | | GO:0016787;GO:0008235;GO:0008451 | hydrolase activity;metalloexopeptidase activity;obsolete X-Pro aminopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.11.9 (Xaa-Pro aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_115380ORaminopeptidase, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_115380 OR aminopeptidase, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_115820 | EHI_115820A | 1 | 1 | 1 | | | forward | protein coding | No | 738 | EHI_115820 | hypothetical protein | hypothetical protein | 3404480 | C4MAG4 | Not Assigned | DS571475:383..1,120(+) | DS571475:383..1120(+) | DS571475 | Entamoeba histolytica HM-1:IMSS | 6 | OG6_144711 | 3 | 245 | 738 | 28142 | 4.99 | 1 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_115820ORhypothetical proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_115820 OR hypothetical protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_116360 | EHI_116360A | 1 | 1 | 1 | 22 | 3 | reverse | protein coding | No | 727 | EHI_116360 | serine-rich protein | serine-rich protein | 3402462 | C4MBR8 | Not Assigned | DS571976:1,108..1,834(-) | DS571976:1130..1831(-) | DS571976 | Entamoeba histolytica HM-1:IMSS | 5 | OG6_110485 | 7 | 233 | 702 | 24718 | 4.01 | 0 | HMM: MFAFLLFIAFTSAT, NN: MFAFLLFIAFTSAT | NN Sum: 4, NN D: .79, HMM Prob: .96 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_116360ORserine-rich proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_116360 OR serine-rich protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_117650 | EHI_117650A | 1 | 1 | 1 | | | reverse | protein coding | No | 1281 | EHI_117650 | cysteine protease, putative | cysteine protease, putative | 3405887 | C4M680 | Not Assigned | DS571293:21,053..22,333(-) | DS571293:21053..22333(-) | DS571293 | Entamoeba histolytica HM-1:IMSS | 52 | OG6_123941 | 10 | 426 | 1281 | 47935 | 5.09 | 0 | HMM: MIGVVLVLLVLGSEGS, NN: MIGVVLVLLVLGSEGSSF | NN Sum: 4, NN D: .69, HMM Prob: 1 | | | GO:0008234;GO:0004215 | cysteine-type peptidase activity;obsolete cathepsin H activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.16 (Cathepsin H) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_117650ORcysteine protease, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_117650 OR cysteine protease, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_119600 | EHI_119600A | 1 | 1 | 1 | | | forward | protein coding | No | 3888 | EHI_119600 | ubiquitin carboxyl-terminal hydrolase domain containing protein | ubiquitin carboxyl-terminal hydrolase domain containing protein | 3405784 | C4M7Z0 | Not Assigned | DS571342:20,575..24,462(+) | DS571342:20575..24462(+) | DS571342 | Entamoeba histolytica HM-1:IMSS | 9 | OG6_104647 | 0 | 1295 | 3888 | 149101 | 7.18 | 0 | | | | | GO:0004221;GO:0004843;GO:0036459 | obsolete ubiquitin thiolesterase activity;thiol-dependent ubiquitin-specific protease activity;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_119600ORubiquitin carboxyl-terminal hydrolase domain containing proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_119600 OR ubiquitin carboxyl-terminal hydrolase domain containing protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_121160 | EHI_121160A | 1 | 1 | 1 | | | forward | protein coding | No | 1266 | EHI_121160 | cysteine protease, putative | cysteine protease, putative | 6220522 | B1N5I6 | Not Assigned | DS571861:1,055..2,320(+) | DS571861:1055..2320(+) | DS571861 | Entamoeba histolytica HM-1:IMSS | 52 | OG6_123941 | 10 | 421 | 1266 | 47339 | 4.68 | 0 | HMM: MIGVVLVLLVLGSEGN, NN: MIGVVLVLLVLGSEGNSF | NN Sum: 4, NN D: .66, HMM Prob: .99 | | | GO:0008234;GO:0004215 | cysteine-type peptidase activity;obsolete cathepsin H activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.16 (Cathepsin H) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_121160ORcysteine protease, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_121160 OR cysteine protease, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_121860 | EHI_121860A | 3 | 3 | 1 | | | reverse | protein coding | No | 507 | EHI_121860 | microsomal signal peptidase subunit, putative | microsomal signal peptidase subunit, putative | 3406099 | C4M5D2 | Not Assigned | DS571276:33,155..33,773(-) | DS571276:33155..33773(-) | DS571276 | Entamoeba histolytica HM-1:IMSS | 9 | OG6_102447 | 0 | 168 | 507 | 19535 | 8.72 | 1 | HMM: MYHTLERMYNISYFAFQWLGVAVFFLYLSSLILYVPPITSV, NN: MYHTLERMYNISYFAFQWLGVAVFFLYLSSLILYVPPITSV | NN Sum: 3, NN D: .51, HMM Prob: .01 | GO:0016021;GO:0005787 | integral component of membrane;signal peptidase complex | GO:0009003;GO:0008233 | obsolete signal peptidase activity;peptidase activity | GO:0006465 | signal peptide processing | | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_121860ORmicrosomal signal peptidase subunit, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_121860 OR microsomal signal peptidase subunit, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_123950 | EHI_123950A | 1 | 1 | 1 | | | forward | protein coding | No | 1116 | EHI_123950 | cysteine protease, putative | cysteine protease, putative | 6220275 | B1N4X7 | Not Assigned | DS571524:1,055..2,170(+) | DS571524:1055..2170(+) | DS571524 | Entamoeba histolytica HM-1:IMSS | 52 | OG6_123941 | 10 | 371 | 1116 | 42321 | 5.07 | 0 | HMM: MIGVVLVLLVLGSEGN, NN: MIGVVLVLLVLGSEGNSF | NN Sum: 4, NN D: .66, HMM Prob: .99 | | | GO:0008234;GO:0004215 | cysteine-type peptidase activity;obsolete cathepsin H activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.16 (Cathepsin H) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_123950ORcysteine protease, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_123950 OR cysteine protease, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_124430 | EHI_124430A | 1 | 1 | 1 | | | reverse | protein coding | No | 2910 | EHI_124430 | Zn-dependent peptidase, putative | Zn-dependent peptidase, putative | 3409164 | C4LZH9 | Not Assigned | DS571188:34,277..37,186(-) | DS571188:34277..37186(-) | DS571188 | Entamoeba histolytica HM-1:IMSS | 16 | OG6_101809 | 0 | 969 | 2910 | 111460 | 5.29 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | GO:0006508 | proteolysis | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_124430ORZn-dependent peptidase, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_124430 OR Zn-dependent peptidase, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_126170 | EHI_126170A | 1 | 1 | 1 | | | reverse | protein coding | No | 951 | EHI_126170 | cysteine protease, putative | cysteine protease, putative | 3406777 | Q8I8D3 | Not Assigned | DS571160:110,993..111,943(-) | DS571160:110993..111943(-) | DS571160 | Entamoeba histolytica HM-1:IMSS | 52 | OG6_123941 | 10 | 316 | 951 | 36254 | 8.50 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.16 (Cathepsin H) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_126170ORcysteine protease, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_126170 OR cysteine protease, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_126880 | EHI_126880A | 1 | 1 | 1 | | | reverse | protein coding | No | 1242 | EHI_126880 | methionine aminopeptidase, putative | methionine aminopeptidase, putative | 3405845 | C4LWW4 | Not Assigned | DS571166:3,730..4,971(-) | DS571166:3730..4971(-) | DS571166 | Entamoeba histolytica HM-1:IMSS | 11 | OG6_100815 | 0 | 413 | 1242 | 46003 | 6.58 | 0 | | | | | GO:0004177;GO:0008235;GO:0004239 | aminopeptidase activity;metalloexopeptidase activity;obsolete methionyl aminopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_126880ORmethionine aminopeptidase, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_126880 OR methionine aminopeptidase, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_127030 | EHI_127030A | 1 | 1 | 1 | | | forward | protein coding | No | 1512 | EHI_127030 | hypothetical protein | hypothetical protein | 3405859 | C4LWX8 | Not Assigned | DS571166:28,566..30,077(+) | DS571166:28566..30077(+) | DS571166 | Entamoeba histolytica HM-1:IMSS | 37 | OG6_113471 | 5 | 503 | 1512 | 57953 | 5.16 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_127030ORhypothetical proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_127030 OR hypothetical protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_127280 | EHI_127280A | 1 | 1 | 1 | | | reverse | protein coding | No | 1518 | EHI_127280 | aminoacyl-histidine dipeptidase, putative | aminoacyl-histidine dipeptidase, putative | 3406472 | C4LX00 | Not Assigned | DS571166:74,003..75,520(-) | DS571166:74003..75520(-) | DS571166 | Entamoeba histolytica HM-1:IMSS | 19 | OG6_112555 | 1 | 505 | 1518 | 56306 | 5.15 | 0 | | | | | GO:0016787;GO:0008237;GO:0008769 | hydrolase activity;metallopeptidase activity;obsolete X-His dipeptidase activity | GO:0008152;GO:0006508 | metabolic process;proteolysis | | | | | | | | 3.4.13.3 (Transferred entry: 3.4.13.18 and 3.4.13.20) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_127280ORaminoacyl-histidine dipeptidase, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_127280 OR aminoacyl-histidine dipeptidase, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_127470 | EHI_127470.mRNA | 1 | 1 | 1 | | | forward | protein coding | Yes | 425 | EHI_127470 | cysteine proteinase, pseudogene | cysteine proteinase, pseudogene | 6219461 | | Not Assigned | DS571166:119,757..120,181(+) | DS571166:119757..120181(+) | DS571166 | Entamoeba histolytica HM-1:IMSS | 0 | N/A (orthology not determined because poor protein quality) | 0 | 141 | 425 | 15929 | 7.12 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_127470ORcysteine proteinase, pseudogeneANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_127470 OR cysteine proteinase, pseudogene AND Entamoeba histolytica HM-1:IMSS |
|
EHI_128190 | EHI_128190A | 2 | 2 | 1 | | | forward | protein coding | No | 1056 | EHI_128190 | peptidase S54 (rhomboid) family protein | peptidase S54 (rhomboid) family protein | 3409076 | C4M529 | Not Assigned | DS571270:38,613..39,740(+) | DS571270:38613..39740(+) | DS571270 | Entamoeba histolytica HM-1:IMSS | 9 | OG6_143303 | 1 | 351 | 1056 | 39640 | 4.73 | 7 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | 3.4.21.- (Serine endopeptidases.) | 3.4.21.- (Serine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_128190ORpeptidase S54 (rhomboid) family proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_128190 OR peptidase S54 (rhomboid) family protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_130660 | EHI_130660A | 1 | 1 | 1 | | | reverse | protein coding | No | 390 | EHI_130660 | microtubule associated protein, putative | microtubule associated protein, putative | 3403452 | C4LXE4 | Not Assigned | DS571170:10,954..11,343(-) | DS571170:10954..11343(-) | DS571170 | Entamoeba histolytica HM-1:IMSS | 11 | OG6_100707 | 1 | 129 | 390 | 14811 | 4.79 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_130660ORmicrotubule associated protein, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_130660 OR microtubule associated protein, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_131090 | EHI_131090A | 1 | 1 | 1 | | | reverse | protein coding | No | 1014 | EHI_131090 | ubiquitin carboxyl-terminal hydrolase domain containing protein | ubiquitin carboxyl-terminal hydrolase domain containing protein | 3409833 | C4LXH7 | Not Assigned | DS571170:76,888..77,901(-) | DS571170:76888..77901(-) | DS571170 | Entamoeba histolytica HM-1:IMSS | 10 | OG6_103260 | 0 | 337 | 1014 | 39302 | 9.18 | 0 | | | | | GO:0004221;GO:0036459 | obsolete ubiquitin thiolesterase activity;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_131090ORubiquitin carboxyl-terminal hydrolase domain containing proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_131090 OR ubiquitin carboxyl-terminal hydrolase domain containing protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_132640 | EHI_132640.mRNA | 1 | 1 | 1 | | | reverse | protein coding | Yes | 852 | EHI_132640 | cysteine proteinase, pseudogene | cysteine proteinase, pseudogene | 6220619 | | Not Assigned | DS572056:1,177..2,028(-) | DS572056:1177..2028(-) | DS572056 | Entamoeba histolytica HM-1:IMSS | 0 | N/A (orthology not determined because poor protein quality) | 0 | 283 | 852 | 31222 | 5.10 | 0 | | | | | GO:0008234;GO:0004215 | cysteine-type peptidase activity;obsolete cathepsin H activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_132640ORcysteine proteinase, pseudogeneANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_132640 OR cysteine proteinase, pseudogene AND Entamoeba histolytica HM-1:IMSS |
|
EHI_133210 | EHI_133210A | 1 | 1 | 1 | | | forward | protein coding | No | 369 | EHI_133210 | hypothetical protein | hypothetical protein | 6220311 | B1N513 | Not Assigned | DS571559:4,629..4,997(+) | DS571559:4629..4997(+) | DS571559 | Entamoeba histolytica HM-1:IMSS | 9 | OG6_143303 | 1 | 122 | 369 | 13723 | 8.19 | 3 | HMM: MGPFAGLISVFLVDLALTN, NN: MGPFAGLISVFLVDLALTN | NN Sum: 4, NN D: .64, HMM Prob: .49 | | | | | | | | | | | | | | 3.4.21.- (Serine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_133210ORhypothetical proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_133210 OR hypothetical protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_135320 | EHI_135320.mRNA | 1 | 1 | 1 | | | reverse | protein coding | Yes | 918 | EHI_135320 | hypothetical protein, pseudogene | hypothetical protein, pseudogene | 6220411 | | Not Assigned | DS571668:2,137..3,054(-) | DS571668:2137..3054(-) | DS571668 | Entamoeba histolytica HM-1:IMSS | 0 | N/A (orthology not determined because poor protein quality) | 0 | 305 | 918 | 33244 | 9.19 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_135320ORhypothetical protein, pseudogeneANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_135320 OR hypothetical protein, pseudogene AND Entamoeba histolytica HM-1:IMSS |
|
EHI_136440 | EHI_136440A | 1 | 1 | 1 | 19 | | forward | protein coding | No | 2017 | EHI_136440 | dipeptidyl-peptidase, putative | dipeptidyl-peptidase, putative | 3409552 | Q9U593 | Not Assigned | DS571222:42,636..44,652(+) | DS571222:42636..44633(+) | DS571222 | Entamoeba histolytica HM-1:IMSS | 22 | OG6_104931 | 3 | 665 | 1998 | 76528 | 4.85 | 0 | HMM: MRIILLVAIIALSYAK, NN: MRIILLVAIIALSYAK | NN Sum: 4, NN D: .87, HMM Prob: 1 | | | GO:0004274;GO:0008236 | obsolete dipeptidyl-peptidase IV activity;serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.19.1 (Acylaminoacyl-peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_136440ORdipeptidyl-peptidase, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_136440 OR dipeptidyl-peptidase, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_137120 | EHI_137120A | 3 | 3 | 1 | | | reverse | protein coding | No | 1242 | EHI_137120 | calcium-dependent protein kinase 2, putative | calcium-dependent protein kinase 2, putative | 6219862 | B1N3W3 | Not Assigned | DS571287:32,012..33,413(-) | DS571287:32012..33413(-) | DS571287 | Entamoeba histolytica HM-1:IMSS | 11 | OG6_101718 | 1 | 413 | 1242 | 46166 | 5.12 | 0 | | | GO:0005839 | proteasome core complex | GO:0005524;GO:0004672;GO:0004298 | ATP binding;protein kinase activity;threonine-type endopeptidase activity | GO:0006468;GO:0051603;GO:0006511 | protein phosphorylation;proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_137120ORcalcium-dependent protein kinase 2, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_137120 OR calcium-dependent protein kinase 2, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_137730 | EHI_137730A | 1 | 1 | 1 | | | reverse | protein coding | No | 1023 | EHI_137730 | ubiquitin carboxyl-terminal hydrolase domain containing protein | ubiquitin carboxyl-terminal hydrolase domain containing protein | 3408378 | C4LZD6 | Not Assigned | DS571187:22,838..23,860(-) | DS571187:22838..23860(-) | DS571187 | Entamoeba histolytica HM-1:IMSS | 8 | OG6_101021 | 0 | 340 | 1023 | 39673 | 7.91 | 0 | | | | | GO:0004221;GO:0036459 | obsolete ubiquitin thiolesterase activity;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_137730ORubiquitin carboxyl-terminal hydrolase domain containing proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_137730 OR ubiquitin carboxyl-terminal hydrolase domain containing protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_137970 | EHI_137970A | 2 | 2 | 1 | 70 | | reverse | protein coding | No | 748 | EHI_137970 | proteasome subunit beta Type 4 precursor, putative | proteasome subunit beta Type 4 precursor, putative | 3406896 | C4LZF8 | Not Assigned | DS571187:71,754..72,551(-) | DS571187:71824..72551(-) | DS571187 | Entamoeba histolytica HM-1:IMSS | 11 | OG6_101718 | 1 | 225 | 678 | 25039 | 4.98 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_137970ORproteasome subunit beta Type 4 precursor, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_137970 OR proteasome subunit beta Type 4 precursor, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_138460 | EHI_138460A | 2 | 2 | 1 | | | forward | protein coding | No | 1719 | EHI_138460 | papain family cysteine protease domain containing protein | papain family cysteine protease domain containing protein | 3409444 | C4M3I8 | Not Assigned | DS571241:36,066..37,832(+) | DS571241:36066..37832(+) | DS571241 | Entamoeba histolytica HM-1:IMSS | 32 | OG6_159401 | 3 | 572 | 1719 | 65517 | 5.53 | 1 | HMM: MMQSNILFPRQGKDFLFFILLFVSLVTLVVAS, NN: MMQSNILFPRQGKDFLFFILLFVSLVTLVVAS | NN Sum: 4, NN D: .77, HMM Prob: .05 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_138460ORpapain family cysteine protease domain containing proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_138460 OR papain family cysteine protease domain containing protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_138530 | EHI_138530A | 1 | 1 | 1 | | | reverse | protein coding | No | 1032 | EHI_138530 | Ulp1 protease family, C-terminal catalytic domain containing protein | Ulp1 protease family, C-terminal catalytic domain containing protein | 3409438 | C4M3J5 | Not Assigned | DS571241:47,322..48,353(-) | DS571241:47322..48353(-) | DS571241 | Entamoeba histolytica HM-1:IMSS | 24 | OG6_102905 | 2 | 343 | 1032 | 40453 | 4.67 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_138530ORUlp1 protease family, C-terminal catalytic domain containing proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_138530 OR Ulp1 protease family, C-terminal catalytic domain containing protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_140220 | EHI_140220A | 1 | 1 | 1 | | | reverse | protein coding | No | 1425 | EHI_140220 | cysteine protease, putative | cysteine protease, putative | 3411057 | Q8I8D6 | Not Assigned | DS571254:19,048..20,472(-) | DS571254:19048..20472(-) | DS571254 | Entamoeba histolytica HM-1:IMSS | 52 | OG6_123941 | 10 | 474 | 1425 | 53453 | 6.35 | 1 | HMM: MSHLIIIVSLVICSFSL, NN: MSHLIIIVSLVICSFSL | NN Sum: 3, NN D: .68, HMM Prob: .91 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.16 (Cathepsin H) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_140220ORcysteine protease, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_140220 OR cysteine protease, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_140500 | EHI_140500A | 2 | 2 | 1 | 14 | | forward | protein coding | No | 950 | EHI_140500 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | 3408501 | C4M3M3 | Not Assigned | DS571243:6,152..7,152(+) | DS571243:6152..7138(+) | DS571243 | Entamoeba histolytica HM-1:IMSS | 10 | OG6_102753 | 0 | 311 | 936 | 36049 | 4.96 | 0 | | | GO:0005622 | intracellular | GO:0004221;GO:0004843 | obsolete ubiquitin thiolesterase activity;thiol-dependent ubiquitin-specific protease activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_140500ORubiquitin carboxyl-terminal hydrolase, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_140500 OR ubiquitin carboxyl-terminal hydrolase, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_140630 | EHI_140630A | 1 | 1 | 1 | | | reverse | protein coding | No | 1734 | EHI_140630 | hypothetical protein, conserved | hypothetical protein, conserved | 3408521 | C4M3N5 | Not Assigned | DS571243:24,478..26,211(-) | DS571243:24478..26211(-) | DS571243 | Entamoeba histolytica HM-1:IMSS | 20 | OG6_100896 | 1 | 577 | 1734 | 67332 | 6.32 | 0 | | | | | GO:0016787;GO:0008235;GO:0008451 | hydrolase activity;metalloexopeptidase activity;obsolete X-Pro aminopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.11.9 (Xaa-Pro aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_140630ORhypothetical protein, conservedANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_140630 OR hypothetical protein, conserved AND Entamoeba histolytica HM-1:IMSS |
|
EHI_141400 | EHI_141400A | 1 | 1 | 1 | 16 | | reverse | protein coding | No | 1009 | EHI_141400 | peptidase, C54 family | peptidase, C54 family | 6219429 | B1N2R5 | Not Assigned | DS571161:21,389..22,397(-) | DS571161:21405..22397(-) | DS571161 | Entamoeba histolytica HM-1:IMSS | 13 | OG6_100501 | 0 | 330 | 993 | 37738 | 6.06 | 0 | | | | | GO:0008233 | peptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_141400ORpeptidase, C54 familyANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_141400 OR peptidase, C54 family AND Entamoeba histolytica HM-1:IMSS |
|
EHI_144040 | EHI_144040.mRNA | 1 | 1 | 1 | | | reverse | protein coding | Yes | 948 | EHI_144040 | cysteine proteinase, pseudogene | cysteine proteinase, pseudogene | 6220517 | | Not Assigned | DS571848:66..1,013(-) | DS571848:66..1013(-) | DS571848 | Entamoeba histolytica HM-1:IMSS | 0 | N/A (orthology not determined because poor protein quality) | 0 | 315 | 948 | 34934 | 5.28 | 0 | HMM: MIVLIYLLSIVNGI, NN: MIVLIYLLSIVNGI | NN Sum: 4, NN D: .71, HMM Prob: .28 | | | GO:0008234;GO:0004215 | cysteine-type peptidase activity;obsolete cathepsin H activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_144040ORcysteine proteinase, pseudogeneANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_144040 OR cysteine proteinase, pseudogene AND Entamoeba histolytica HM-1:IMSS |
|
EHI_146330 | EHI_146330A | 1 | 1 | 1 | | | reverse | protein coding | No | 1776 | EHI_146330 | calpain large subunit domain III containing protein | calpain large subunit domain III containing protein | 3404219 | C4M9C0 | Not Assigned | DS571398:6,729..8,504(-) | DS571398:6729..8504(-) | DS571398 | Entamoeba histolytica HM-1:IMSS | 8 | OG6_203074 | 0 | 591 | 1776 | 67854 | 5.00 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_146330ORcalpain large subunit domain III containing proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_146330 OR calpain large subunit domain III containing protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_146800 | EHI_146800A | 1 | 1 | 1 | | | forward | protein coding | No | 5478 | EHI_146800 | ubiquitin carboxyl-terminal hydrolase domain containing protein | ubiquitin carboxyl-terminal hydrolase domain containing protein | 3410534 | C4MB35 | Not Assigned | DS571554:2,531..8,008(+) | DS571554:2531..8008(+) | DS571554 | Entamoeba histolytica HM-1:IMSS | 16 | OG6_204818 | 1 | 1825 | 5478 | 213032 | 5.48 | 0 | | | GO:0005622 | intracellular | GO:0005096;GO:0004221;GO:0036459 | GTPase activator activity;obsolete ubiquitin thiolesterase activity;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0051056;GO:0006511 | protein deubiquitination;regulation of small GTPase mediated signal transduction;ubiquitin-dependent protein catabolic process | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_146800ORubiquitin carboxyl-terminal hydrolase domain containing proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_146800 OR ubiquitin carboxyl-terminal hydrolase domain containing protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_148040 | EHI_148040A | 1 | 1 | 1 | | | forward | protein coding | No | 789 | EHI_148040 | proteasome subunit beta type 7-B precursor, putative | proteasome subunit beta type 7-B precursor, putative | 3411831 | C4LSX4 | Not Assigned | DS571146:7,649..8,437(+) | DS571146:7649..8437(+) | DS571146 | Entamoeba histolytica HM-1:IMSS | 9 | OG6_101382 | 0 | 262 | 789 | 28655 | 6.99 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_148040ORproteasome subunit beta type 7-B precursor, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_148040 OR proteasome subunit beta type 7-B precursor, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_150100 | EHI_150100A | 1 | 1 | 1 | | | forward | protein coding | No | 615 | EHI_150100 | hypothetical protein | hypothetical protein | 6219687 | B1N3E9 | Not Assigned | DS571218:7,344..7,958(+) | DS571218:7344..7958(+) | DS571218 | Entamoeba histolytica HM-1:IMSS | 37 | OG6_113471 | 5 | 204 | 615 | 24005 | 4.52 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_150100ORhypothetical proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_150100 OR hypothetical protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_151400 | EHI_151400A | 1 | 1 | 1 | | | reverse | protein coding | No | 954 | EHI_151400 | cysteine proteinase, putative | cysteine proteinase, putative | 3411739 | Q8I8D9 | Not Assigned | DS571145:52,453..53,406(-) | DS571145:52453..53406(-) | DS571145 | Entamoeba histolytica HM-1:IMSS | 90 | OG6_100116 | 10 | 317 | 954 | 34775 | 8.01 | 0 | HMM: MFAVILLGLCANAI, NN: MFAVILLGLCANAITF | NN Sum: 2, NN D: .48, HMM Prob: .95 | | | GO:0004197;GO:0008234 | cysteine-type endopeptidase activity;cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_151400ORcysteine proteinase, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_151400 OR cysteine proteinase, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_151440 | EHI_151440A | 1 | 1 | 1 | | | reverse | protein coding | No | 963 | EHI_151440 | cysteine proteinase, putative | cysteine proteinase, putative | 3411693 | C4LSI6 | Not Assigned | DS571145:64,122..65,084(-) | DS571145:64122..65084(-) | DS571145 | Entamoeba histolytica HM-1:IMSS | 90 | OG6_100116 | 10 | 320 | 963 | 35280 | 8.51 | 0 | HMM: MFGLLFVTLISLSNAI, NN: MFGLLFVTLISLSNAI | NN Sum: 4, NN D: .82, HMM Prob: .99 | | | GO:0004197;GO:0008234 | cysteine-type endopeptidase activity;cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_151440ORcysteine proteinase, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_151440 OR cysteine proteinase, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_152100 | EHI_152100A | 1 | 1 | 1 | | | reverse | protein coding | No | 636 | EHI_152100 | hypothetical protein | hypothetical protein | 3411648 | C4LSP8 | Not Assigned | DS571145:209,159..209,794(-) | DS571145:209159..209794(-) | DS571145 | Entamoeba histolytica HM-1:IMSS | 9 | OG6_101218 | 0 | 211 | 636 | 24322 | 4.79 | 0 | | | GO:0005622 | intracellular | GO:0004221;GO:0004843 | obsolete ubiquitin thiolesterase activity;thiol-dependent ubiquitin-specific protease activity | GO:0006511 | ubiquitin-dependent protein catabolic process | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_152100ORhypothetical proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_152100 OR hypothetical protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_152110 | EHI_152110A | 1 | 1 | 1 | | | reverse | protein coding | No | 1335 | EHI_152110 | ubiquitin carboxyl-terminal hydrolase domain containing protein | ubiquitin carboxyl-terminal hydrolase domain containing protein | 3411647 | C4LSP9 | Not Assigned | DS571145:212,285..213,619(-) | DS571145:212285..213619(-) | DS571145 | Entamoeba histolytica HM-1:IMSS | 10 | OG6_102786 | 0 | 444 | 1335 | 51726 | 7.58 | 0 | | | | | GO:0004221;GO:0036459;GO:0008270 | obsolete ubiquitin thiolesterase activity;thiol-dependent ubiquitinyl hydrolase activity;zinc ion binding | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_152110ORubiquitin carboxyl-terminal hydrolase domain containing proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_152110 OR ubiquitin carboxyl-terminal hydrolase domain containing protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_152220 | EHI_152220A | 1 | 1 | 1 | | | forward | protein coding | No | 1509 | EHI_152220 | hypothetical protein | hypothetical protein | 3410123 | C4LSR0 | Not Assigned | DS571145:229,668..231,176(+) | DS571145:229668..231176(+) | DS571145 | Entamoeba histolytica HM-1:IMSS | 37 | OG6_113471 | 5 | 502 | 1509 | 58087 | 4.71 | 0 | HMM: MRIGYLLLFILLVYGK, NN: MRIGYLLLFILLVYGKLPNKWAY | NN Sum: 4, NN D: .79, HMM Prob: .99 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_152220ORhypothetical proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_152220 OR hypothetical protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_153190 | EHI_153190A | 3 | 3 | 1 | 19 | 8 | forward | protein coding | No | 756 | EHI_153190 | proteasome subunit alpha type 6, putative | proteasome subunit alpha type 6, putative | 3410702 | C4LSB1 | Not Assigned | DS571145:404,591..405,451(+) | DS571145:404599..405432(+) | DS571145 | Entamoeba histolytica HM-1:IMSS | 10 | OG6_102240 | 0 | 242 | 729 | 26912 | 6.24 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_153190ORproteasome subunit alpha type 6, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_153190 OR proteasome subunit alpha type 6, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_153350 | EHI_153350A | 1 | 1 | 1 | | | forward | protein coding | No | 2043 | EHI_153350 | prolyl oligopeptidase family protein | prolyl oligopeptidase family protein | 3410680 | C4LSC6 | Not Assigned | DS571145:428,395..430,437(+) | DS571145:428395..430437(+) | DS571145 | Entamoeba histolytica HM-1:IMSS | 22 | OG6_104931 | 3 | 680 | 2043 | 79458 | 5.15 | 0 | | | | | GO:0004254;GO:0008236 | obsolete acylaminoacyl-peptidase activity;serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.19.1 (Acylaminoacyl-peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_153350ORprolyl oligopeptidase family proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_153350 OR prolyl oligopeptidase family protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_153400 | EHI_153400A | 1 | 1 | 1 | | | forward | protein coding | No | 4818 | EHI_153400 | ubiquitin carboxyl-terminal hydrolase domain containing protein | ubiquitin carboxyl-terminal hydrolase domain containing protein | 3410698 | C4LSD1 | Not Assigned | DS571145:439,159..443,976(+) | DS571145:439159..443976(+) | DS571145 | Entamoeba histolytica HM-1:IMSS | 16 | OG6_204261 | 1 | 1605 | 4818 | 183747 | 6.01 | 0 | | | | | GO:0004221;GO:0036459 | obsolete ubiquitin thiolesterase activity;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_153400ORubiquitin carboxyl-terminal hydrolase domain containing proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_153400 OR ubiquitin carboxyl-terminal hydrolase domain containing protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_153620 | EHI_153620A | 1 | 1 | 1 | | | forward | protein coding | No | 309 | EHI_153620 | prolyl oligopeptidase family protein | prolyl oligopeptidase family protein | 6219304 | | Not Assigned | DS571145:476,593..476,901(+) | DS571145:476593..476901(+) | DS571145 | Entamoeba histolytica HM-1:IMSS | 0 | OG6_204751 | 1 | 102 | 309 | 12383 | 9.12 | 0 | | | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_153620ORprolyl oligopeptidase family proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_153620 OR prolyl oligopeptidase family protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_155060 | EHI_155060A | 1 | 1 | 1 | | | forward | protein coding | No | 792 | EHI_155060 | chaperone clpB, putative | chaperone clpB, putative | 6220340 | B1N538 | Not Assigned | DS571586:6,085..6,876(+) | DS571586:6085..6876(+) | DS571586 | Entamoeba histolytica HM-1:IMSS | 48 | OG6_100223 | 11 | 263 | 792 | 29542 | 5.33 | 0 | | | | | GO:0005524;GO:0016887 | ATP binding;ATPase activity | | | | | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_155060ORchaperone clpB, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_155060 OR chaperone clpB, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_156560 | EHI_156560A | 1 | 1 | 1 | | | forward | protein coding | No | 2601 | EHI_156560 | heat shock protein, putative | heat shock protein, putative | 6220307 | | Not Assigned | DS571555:5,802..8,402(+) | DS571555:5802..8402(+) | DS571555 | Entamoeba histolytica HM-1:IMSS | 48 | OG6_100223 | 11 | 866 | 2601 | 97623 | 5.60 | 0 | | | | | GO:0005524;GO:0016887;GO:0005515 | ATP binding;ATPase activity;protein binding | GO:0019538 | protein metabolic process | | | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_156560ORheat shock protein, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_156560 OR heat shock protein, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_158320 | EHI_158320A | 1 | 1 | 1 | | | reverse | protein coding | No | 1206 | EHI_158320 | peptidase T, putative | peptidase T, putative | 3404445 | C4M2F1 | Not Assigned | DS571223:51,972..53,177(-) | DS571223:51972..53177(-) | DS571223 | Entamoeba histolytica HM-1:IMSS | 18 | OG6_111055 | 1 | 401 | 1206 | 44946 | 5.32 | 0 | | | GO:0005737 | cytoplasm | GO:0016787;GO:0008237;GO:0045148;GO:0008270 | hydrolase activity;metallopeptidase activity;tripeptide aminopeptidase activity;zinc ion binding | GO:0008152;GO:0006518;GO:0006508 | metabolic process;peptide metabolic process;proteolysis | | | | | | | | 3.4.11.4 (Tripeptide aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_158320ORpeptidase T, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_158320 OR peptidase T, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_158580 | EHI_158580A | 1 | 1 | 1 | | | reverse | protein coding | No | 3897 | EHI_158580 | ubiquitin carboxyl-terminal hydrolase domain containing protein | ubiquitin carboxyl-terminal hydrolase domain containing protein | 3404004 | C4M7G2 | Not Assigned | DS571328:13,096..16,992(-) | DS571328:13096..16992(-) | DS571328 | Entamoeba histolytica HM-1:IMSS | 8 | OG6_502009 | 0 | 1298 | 3897 | 153913 | 5.28 | 0 | | | | | GO:0004221;GO:0036459 | obsolete ubiquitin thiolesterase activity;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_158580ORubiquitin carboxyl-terminal hydrolase domain containing proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_158580 OR ubiquitin carboxyl-terminal hydrolase domain containing protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_159610 | EHI_159610A | 1 | 1 | 1 | | | reverse | protein coding | No | 927 | EHI_159610 | cysteine protease, putative | cysteine protease, putative | 3407594 | C4LX41 | Not Assigned | DS571167:49,191..50,117(-) | DS571167:49191..50117(-) | DS571167 | Entamoeba histolytica HM-1:IMSS | 90 | OG6_100116 | 10 | 308 | 927 | 33850 | 7.31 | 0 | HMM: MFALILFVSLACAN, NN: MFALILFVSLACAN | NN Sum: 3, NN D: .68, HMM Prob: .96 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_159610ORcysteine protease, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_159610 OR cysteine protease, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_160330 | EHI_160330A | 1 | 1 | 1 | | | forward | protein coding | No | 1125 | EHI_160330 | cysteine protease, putative | cysteine protease, putative | 6220098 | B1N4H3 | Not Assigned | DS571412:72..1,196(+) | DS571412:72..1196(+) | DS571412 | Entamoeba histolytica HM-1:IMSS | 52 | OG6_123941 | 10 | 374 | 1125 | 41984 | 4.69 | 0 | | | | | GO:0008234;GO:0004215 | cysteine-type peptidase activity;obsolete cathepsin H activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.16 (Cathepsin H) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_160330ORcysteine protease, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_160330 OR cysteine protease, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_160570 | EHI_160570A | 1 | 1 | 1 | | | reverse | protein coding | No | 633 | EHI_160570 | 26S protease regulatory subunit 8, putative | 26S protease regulatory subunit 8, putative | 6220720 | B1N5Y7 | Not Assigned | DS572419:26..658(-) | DS572419:26..658(-) | DS572419 | Entamoeba histolytica HM-1:IMSS | 0 | OG6_502521 | 0 | 211 | 633 | 23912 | 7.95 | 0 | | | | | GO:0005524 | ATP binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_160570OR26S protease regulatory subunit 8, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_160570 OR 26S protease regulatory subunit 8, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_163650 | EHI_163650A | 1 | 1 | 1 | | | forward | protein coding | No | 738 | EHI_163650 | proteasome subunit alpha type 7, putative | proteasome subunit alpha type 7, putative | 3408023 | C4M3U5 | Not Assigned | DS571246:28,937..29,674(+) | DS571246:28937..29674(+) | DS571246 | Entamoeba histolytica HM-1:IMSS | 11 | OG6_101207 | 1 | 245 | 738 | 27538 | 6.81 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_163650ORproteasome subunit alpha type 7, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_163650 OR proteasome subunit alpha type 7, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_164750 | EHI_164750A | 1 | 1 | 1 | | | reverse | protein coding | No | 897 | EHI_164750 | 26S proteasome non-ATPase regulatory subunit 14, putative | 26S proteasome non-ATPase regulatory subunit 14, putative | 3404795 | C4M1W8 | Not Assigned | DS571216:4,867..5,763(-) | DS571216:4867..5763(-) | DS571216 | Entamoeba histolytica HM-1:IMSS | 10 | OG6_101835 | 0 | 298 | 897 | 33486 | 6.69 | 0 | | | | | GO:0003824;GO:0005515 | catalytic activity;protein binding | GO:0008152 | metabolic process | | | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_164750OR26S proteasome non-ATPase regulatory subunit 14, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_164750 OR 26S proteasome non-ATPase regulatory subunit 14, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_166820 | EHI_166820A | 1 | 1 | 1 | | | reverse | protein coding | No | 594 | EHI_166820 | Ulp1 protease family, C-terminal catalytic domain containing protein | Ulp1 protease family, C-terminal catalytic domain containing protein | 3404830 | C4LY86 | Not Assigned | DS571177:16,529..17,122(-) | DS571177:16529..17122(-) | DS571177 | Entamoeba histolytica HM-1:IMSS | 11 | OG6_103852 | 0 | 197 | 594 | 22456 | 5.83 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_166820ORUlp1 protease family, C-terminal catalytic domain containing proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_166820 OR Ulp1 protease family, C-terminal catalytic domain containing protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_166850 | EHI_166850A | 1 | 1 | 1 | 39 | 19 | forward | protein coding | No | 778 | EHI_166850 | proteasome subunit alpha type 4, putative | proteasome subunit alpha type 4, putative | 3404819 | C4LY89 | Not Assigned | DS571177:19,949..20,726(+) | DS571177:19968..20687(+) | DS571177 | Entamoeba histolytica HM-1:IMSS | 9 | OG6_101968 | 1 | 239 | 720 | 26922 | 5.44 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_166850ORproteasome subunit alpha type 4, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_166850 OR proteasome subunit alpha type 4, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_167720 | EHI_167720A | 1 | 1 | 1 | | | reverse | protein coding | No | 750 | EHI_167720 | proteasome subunit alpha type 4, putative | proteasome subunit alpha type 4, putative | 3409876 | C4M7Z3 | Not Assigned | DS571343:27,060..27,809(-) | DS571343:27060..27809(-) | DS571343 | Entamoeba histolytica HM-1:IMSS | 9 | OG6_101968 | 1 | 249 | 750 | 28160 | 6.29 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_167720ORproteasome subunit alpha type 4, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_167720 OR proteasome subunit alpha type 4, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_168240 | EHI_168240A | 1 | 1 | 1 | 15 | | forward | protein coding | No | 972 | EHI_168240 | cysteine proteinase, putative | cysteine proteinase, putative | 3405235 | Q95030 | Not Assigned | DS571263:14,358..15,329(+) | DS571263:14358..15314(+) | DS571263 | Entamoeba histolytica HM-1:IMSS | 90 | OG6_100116 | 10 | 318 | 957 | 34759 | 8.61 | 0 | HMM: MFTVLLLVVVAYAT, NN: MFTVLLLVVVAYAT | NN Sum: 4, NN D: .68, HMM Prob: .97 | | | GO:0004197;GO:0008234 | cysteine-type endopeptidase activity;cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.22.35 (Histolysain) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_168240ORcysteine proteinase, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_168240 OR cysteine proteinase, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_169640 | EHI_169640A | 2 | 2 | 1 | | | forward | protein coding | No | 870 | EHI_169640 | hypothetical protein | hypothetical protein | 3404682 | C4M8U5 | Not Assigned | DS571377:12,881..13,801(+) | DS571377:12881..13801(+) | DS571377 | Entamoeba histolytica HM-1:IMSS | 8 | OG6_501753 | 0 | 289 | 870 | 33870 | 4.90 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_169640ORhypothetical proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_169640 OR hypothetical protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_171550 | EHI_171550A | 1 | 1 | 1 | | | reverse | protein coding | No | 627 | EHI_171550 | hypothetical protein | hypothetical protein | 6220728 | B1N5Z4 | Not Assigned | DS572460:513..1,139(-) | DS572460:513..1139(-) | DS572460 | Entamoeba histolytica HM-1:IMSS | 6 | OG6_144711 | 3 | 208 | 627 | 23804 | 4.63 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_171550ORhypothetical proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_171550 OR hypothetical protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_172140 | EHI_172140A | 1 | 1 | 1 | | | forward | protein coding | No | 405 | EHI_172140 | hypothetical protein, conserved | hypothetical protein, conserved | 3404233 | C4MAE2 | Not Assigned | DS571471:2,581..2,985(+) | DS571471:2581..2985(+) | DS571471 | Entamoeba histolytica HM-1:IMSS | 11 | OG6_100707 | 1 | 134 | 405 | 15294 | 5.26 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_172140ORhypothetical protein, conservedANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_172140 OR hypothetical protein, conserved AND Entamoeba histolytica HM-1:IMSS |
|
EHI_174670 | EHI_174670A | 3 | 3 | 1 | | | forward | protein coding | No | 681 | EHI_174670 | proteasome subunit beta type 1, putative | proteasome subunit beta type 1, putative | 3407650 | C4LZL2 | Not Assigned | DS571189:25,818..26,597(+) | DS571189:25818..26597(+) | DS571189 | Entamoeba histolytica HM-1:IMSS | 9 | OG6_101631 | 0 | 226 | 681 | 25528 | 5.74 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_174670ORproteasome subunit beta type 1, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_174670 OR proteasome subunit beta type 1, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_175020 | EHI_175020A | 1 | 1 | 1 | 15 | | reverse | protein coding | No | 1134 | EHI_175020 | peptidase, putative | peptidase, putative | 3404196 | C4LZM7 | Not Assigned | DS571189:54,695..55,828(-) | DS571189:54710..55828(-) | DS571189 | Entamoeba histolytica HM-1:IMSS | 10 | OG6_101895 | 0 | 372 | 1119 | 41610 | 5.29 | 0 | | | | | GO:0008235;GO:0004239 | metalloexopeptidase activity;obsolete methionyl aminopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_175020ORpeptidase, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_175020 OR peptidase, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_177160 | EHI_177160A | 1 | 1 | 1 | | | forward | protein coding | No | 951 | EHI_177160 | signal peptide peptidase family protein | signal peptide peptidase family protein | 3407130 | C4LY30 | Not Assigned | DS571175:21,613..22,563(+) | DS571175:21613..22563(+) | DS571175 | Entamoeba histolytica HM-1:IMSS | 14 | OG6_184292 | 1 | 316 | 951 | 36286 | 8.80 | 9 | HMM: MDELLYLIVTLIVIHHVSSK, NN: MDELLYLIVTLIVIHHVSSK | NN Sum: 3, NN D: .67, HMM Prob: .86 | GO:0016021 | integral component of membrane | GO:0004190;GO:0008717 | aspartic-type endopeptidase activity;obsolete D-alanyl-D-alanine endopeptidase activity | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_177160ORsignal peptide peptidase family proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_177160 OR signal peptide peptidase family protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_177320 | EHI_177320A | 1 | 1 | 1 | | | reverse | protein coding | No | 1170 | EHI_177320 | 26S protease regulatory subunit, putative | 26S protease regulatory subunit, putative | 3402999 | C4LY36 | Not Assigned | DS571175:38,514..39,683(-) | DS571175:38514..39683(-) | DS571175 | Entamoeba histolytica HM-1:IMSS | 10 | OG6_101965 | 0 | 389 | 1170 | 43781 | 7.71 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016887;GO:0016787 | ATP binding;ATPase activity;hydrolase activity | GO:0030163;GO:0006508 | protein catabolic process;proteolysis | | | | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_177320OR26S protease regulatory subunit, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_177320 OR 26S protease regulatory subunit, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_178230 | EHI_178230A | 1 | 1 | 1 | 1 | | reverse | protein coding | No | 757 | EHI_178230 | heat shock protein 101, putative | heat shock protein 101, putative | 6220460 | B1N5D4 | Not Assigned | DS571744:1..757(-) | DS571744:2..757(-) | DS571744 | Entamoeba histolytica HM-1:IMSS | 3 | OG6_148837 | 4 | 252 | 756 | 28115 | 7.51 | 0 | | | | | GO:0005515 | protein binding | GO:0019538 | protein metabolic process | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_178230ORheat shock protein 101, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_178230 OR heat shock protein 101, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_179400 | EHI_179400A | 1 | 1 | 1 | | | reverse | protein coding | No | 1053 | EHI_179400 | nuclear pore protein, putative | nuclear pore protein, putative | 3405300 | C4M9Y0 | Not Assigned | DS571431:16,067..17,119(-) | DS571431:16067..17119(-) | DS571431 | Entamoeba histolytica HM-1:IMSS | 12 | OG6_101756 | 0 | 350 | 1053 | 39154 | 4.67 | 0 | | | GO:0005643 | nuclear pore | GO:0017056 | structural constituent of nuclear pore | GO:0006913;GO:0006810 | nucleocytoplasmic transport;transport | | | | | | | | 3.4.21.- (Serine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_179400ORnuclear pore protein, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_179400 OR nuclear pore protein, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_179600 | EHI_179600A | 1 | 1 | 1 | | | forward | protein coding | No | 1296 | EHI_179600 | cysteine protease, putative | cysteine protease, putative | 6220425 | | Not Assigned | DS571687:1,055..2,350(+) | DS571687:1055..2350(+) | DS571687 | Entamoeba histolytica HM-1:IMSS | 52 | OG6_123941 | 10 | 431 | 1296 | 48611 | 4.68 | 0 | HMM: MIGVVLVLLVLGSEGN, NN: MIGVVLVLLVLGSEGNSF | NN Sum: 4, NN D: .66, HMM Prob: .99 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.16 (Cathepsin H) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_179600ORcysteine protease, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_179600 OR cysteine protease, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_180170 | EHI_180170A | 1 | 1 | 1 | | | reverse | protein coding | No | 954 | EHI_180170 | cysteine protease, putative | cysteine protease, putative | 3408136 | C4M277 | Not Assigned | DS571221:9,177..10,130(-) | DS571221:9177..10130(-) | DS571221 | Entamoeba histolytica HM-1:IMSS | 6 | OG6_501781 | 0 | 317 | 954 | 36978 | 5.33 | 0 | HMM: MLFILLFTLSFAFTF, NN: MLFILLFTLSFAFTFDD | NN Sum: 2, NN D: .56, HMM Prob: .89 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.16 (Cathepsin H) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_180170ORcysteine protease, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_180170 OR cysteine protease, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_180350 | EHI_180350A | 1 | 1 | 1 | | | reverse | protein coding | No | 1233 | EHI_180350 | 26S protease regulatory subunit, putative | 26S protease regulatory subunit, putative | 3408146 | C4M285 | Not Assigned | DS571221:29,966..31,198(-) | DS571221:29966..31198(-) | DS571221 | Entamoeba histolytica HM-1:IMSS | 10 | OG6_101477 | 0 | 410 | 1233 | 46304 | 6.45 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016887;GO:0016787 | ATP binding;ATPase activity;hydrolase activity | GO:0030163;GO:0006508 | protein catabolic process;proteolysis | | | | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_180350OR26S protease regulatory subunit, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_180350 OR 26S protease regulatory subunit, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_180650 | EHI_180650A | 1 | 1 | 1 | | 1 | forward | protein coding | No | 1021 | EHI_180650 | cysteine protease, putative | cysteine protease, putative | 3402529 | C4MA38 | Not Assigned | DS571443:1..1,021(+) | DS571443:2..1021(+) | DS571443 | Entamoeba histolytica HM-1:IMSS | 40 | OG6_159415 | 3 | 339 | 1020 | 37699 | 5.14 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.50 (V-cath endopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_180650ORcysteine protease, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_180650 OR cysteine protease, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_181230 | EHI_181230A | 1 | 1 | 1 | | | reverse | protein coding | No | 1341 | EHI_181230 | cysteine protease, putative | cysteine protease, putative | 3407309 | C4M5Z5 | Not Assigned | DS571288:32,770..34,110(-) | DS571288:32770..34110(-) | DS571288 | Entamoeba histolytica HM-1:IMSS | 40 | OG6_159415 | 3 | 446 | 1341 | 50320 | 8.49 | 0 | HMM: MTAIVVAFLLLVSNQKTQSIAF, NN: MTAIVVAFLLLVSNQKTQSIAF | NN Sum: 4, NN D: .63, HMM Prob: .99 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.50 (V-cath endopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_181230ORcysteine protease, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_181230 OR cysteine protease, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_182260 | EHI_182260A | 1 | 1 | 1 | 2 | | forward | protein coding | No | 929 | EHI_182260 | cysteine protease, putative | cysteine protease, putative | 6220404 | B1N588 | Not Assigned | DS571660:5,994..6,922(+) | DS571660:5994..6920(+) | DS571660 | Entamoeba histolytica HM-1:IMSS | 52 | OG6_123941 | 10 | 309 | 927 | 35256 | 6.17 | 0 | HMM: MIGVVLVLLVLGSEGN, NN: MIGVVLVLLVLGSEGNSF | NN Sum: 4, NN D: .66, HMM Prob: .99 | | | GO:0008234;GO:0004215 | cysteine-type peptidase activity;obsolete cathepsin H activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.16 (Cathepsin H) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_182260ORcysteine protease, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_182260 OR cysteine protease, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_182630 | EHI_182630A | 1 | 1 | 1 | | | forward | protein coding | No | 582 | EHI_182630 | hypothetical protein | hypothetical protein | 3402316 | C4LV44 | Not Assigned | DS571156:26,678..27,259(+) | DS571156:26678..27259(+) | DS571156 | Entamoeba histolytica HM-1:IMSS | 10 | OG6_101256 | 0 | 193 | 582 | 21984 | 8.57 | 0 | | | | | | | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_182630ORhypothetical proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_182630 OR hypothetical protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_182720 | EHI_182720A | 1 | 1 | 1 | | | forward | protein coding | No | 2010 | EHI_182720 | dipeptidyl-peptidase, putative | dipeptidyl-peptidase, putative | 3402656 | C4LV53 | Not Assigned | DS571156:37,596..39,605(+) | DS571156:37596..39605(+) | DS571156 | Entamoeba histolytica HM-1:IMSS | 8 | OG6_108070 | 0 | 669 | 2010 | 75527 | 4.85 | 0 | HMM: MISLLWLAIGIVSALTAD, NN: MISLLWLAIGIVSALTAD | NN Sum: 4, NN D: .74, HMM Prob: 1 | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 1.11.1.10 (Chloride peroxidase) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_182720ORdipeptidyl-peptidase, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_182720 OR dipeptidyl-peptidase, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_182770 | EHI_182770A | 1 | 1 | 1 | | | forward | protein coding | No | 1884 | EHI_182770 | hypothetical protein | hypothetical protein | 3409796 | C4LV58 | Not Assigned | DS571156:47,055..48,938(+) | DS571156:47055..48938(+) | DS571156 | Entamoeba histolytica HM-1:IMSS | 32 | OG6_159401 | 3 | 627 | 1884 | 71881 | 4.80 | 1 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_182770ORhypothetical proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_182770 OR hypothetical protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_183680 | EHI_183680A | 1 | 1 | 1 | | | forward | protein coding | No | 1032 | EHI_183680 | heat shock protein 101, putative | heat shock protein 101, putative | 6220761 | B1N622 | Not Assigned | DS572605:1..1,032(+) | DS572605:1..1032(+) | DS572605 | Entamoeba histolytica HM-1:IMSS | 48 | OG6_100223 | 11 | 344 | 1032 | 39002 | 5.48 | 0 | | | | | GO:0005524 | ATP binding | | | | | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_183680ORheat shock protein 101, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_183680 OR heat shock protein 101, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_185410 | EHI_185410A | 1 | 1 | 1 | | | reverse | protein coding | No | 1197 | EHI_185410 | 26S protease regulatory subunit, putative | 26S protease regulatory subunit, putative | 3403376 | C4M8D7 | Not Assigned | DS571356:3,166..4,362(-) | DS571356:3166..4362(-) | DS571356 | Entamoeba histolytica HM-1:IMSS | 8 | OG6_101513 | 1 | 398 | 1197 | 44972 | 8.34 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016887;GO:0016787 | ATP binding;ATPase activity;hydrolase activity | GO:0030163;GO:0006508 | protein catabolic process;proteolysis | | | | | | | | 3.6.4.3 (Transferred entry: 5.6.1.1) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_185410OR26S protease regulatory subunit, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_185410 OR 26S protease regulatory subunit, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_185560 | EHI_185560A | 1 | 1 | 1 | | | reverse | protein coding | No | 2133 | EHI_185560 | oligopeptidase A, putative | oligopeptidase A, putative | 3403902 | C4M8D6 | Not Assigned | DS571356:12,503..14,635(-) | DS571356:12503..14635(-) | DS571356 | Entamoeba histolytica HM-1:IMSS | 21 | OG6_100561 | 1 | 710 | 2133 | 83749 | 5.58 | 0 | HMM: MLLIFELFIYGVVAQLCNTN, NN: MLLIFELFIYGVVAQ | NN Sum: 4, NN D: .76, HMM Prob: .75 | | | GO:0004222;GO:0008944 | metalloendopeptidase activity;obsolete oligopeptidase A activity | GO:0006508 | proteolysis | | | | | | | | 3.4.24.15 (Thimet oligopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_185560ORoligopeptidase A, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_185560 OR oligopeptidase A, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_186930 | EHI_186930A | 1 | 1 | 1 | | | forward | protein coding | No | 1140 | EHI_186930 | peptidase T, putative | peptidase T, putative | 3410742 | C4LVR0 | Not Assigned | DS571159:66,903..68,042(+) | DS571159:66903..68042(+) | DS571159 | Entamoeba histolytica HM-1:IMSS | 18 | OG6_111055 | 1 | 379 | 1140 | 42673 | 6.12 | 0 | | | | | GO:0016787;GO:0008237;GO:0045148 | hydrolase activity;metallopeptidase activity;tripeptide aminopeptidase activity | GO:0008152;GO:0006508 | metabolic process;proteolysis | | | | | | | | 3.4.11.4 (Tripeptide aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_186930ORpeptidase T, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_186930 OR peptidase T, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_187200 | EHI_187200A | 2 | 2 | 1 | | | forward | protein coding | No | 714 | EHI_187200 | CAAX prenyl protease family | CAAX prenyl protease family | 3410794 | C4LVT7 | Not Assigned | DS571159:119,516..120,275(+) | DS571159:119516..120275(+) | DS571159 | Entamoeba histolytica HM-1:IMSS | 9 | OG6_103186 | 0 | 237 | 714 | 26636 | 6.76 | 8 | HMM: MIVVGWFMSIIITLTLTVILLAFLGIASH, NN: MIVVGWFMSIIITLTLTVILLAFLGIASH | NN Sum: 3, NN D: .69, HMM Prob: .39 | GO:0016020 | membrane | | | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_187200ORCAAX prenyl protease familyANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_187200 OR CAAX prenyl protease family AND Entamoeba histolytica HM-1:IMSS |
|
EHI_187600 | EHI_187600A | 2 | 2 | 1 | | | reverse | protein coding | No | 1128 | EHI_187600 | 26S protease regulatory subunit, putative | 26S protease regulatory subunit, putative | 6220084 | B1N4G1 | Not Assigned | DS571404:5,329..6,611(-) | DS571404:5329..6611(-) | DS571404 | Entamoeba histolytica HM-1:IMSS | 8 | OG6_101513 | 1 | 375 | 1128 | 42405 | 8.11 | 0 | | | | | GO:0005524;GO:0016887 | ATP binding;ATPase activity | GO:0006508 | proteolysis | | | | | | | | 3.6.4.3 (Transferred entry: 5.6.1.1) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_187600OR26S protease regulatory subunit, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_187600 OR 26S protease regulatory subunit, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_188280 | EHI_188280A | 2 | 2 | 1 | | | forward | protein coding | No | 1191 | EHI_188280 | presenilin 1 peptidase, putative | presenilin 1 peptidase, putative | 3407992 | C4M1A2 | Not Assigned | DS571206:61,659..62,906(+) | DS571206:61659..62906(+) | DS571206 | Entamoeba histolytica HM-1:IMSS | 9 | OG6_101989 | 0 | 396 | 1191 | 44452 | 4.51 | 7 | | | GO:0016021 | integral component of membrane | GO:0004190 | aspartic-type endopeptidase activity | GO:0035556;GO:0016485 | intracellular signal transduction;protein processing | | | | | | | 3.4.23.- (Aspartic endopeptidases.) | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_188280ORpresenilin 1 peptidase, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_188280 OR presenilin 1 peptidase, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_188380 | EHI_188380.mRNA | 1 | 1 | 1 | | | reverse | protein coding | Yes | 924 | EHI_188380 | hypothetical protein, pseudogene | hypothetical protein, pseudogene | 6220399 | | Not Assigned | DS571656:3,494..4,417(-) | DS571656:3494..4417(-) | DS571656 | Entamoeba histolytica HM-1:IMSS | 0 | N/A (orthology not determined because poor protein quality) | 0 | 308 | 924 | 35125 | 9.88 | 3 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_188380ORhypothetical protein, pseudogeneANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_188380 OR hypothetical protein, pseudogene AND Entamoeba histolytica HM-1:IMSS |
|
EHI_189410 | EHI_189410A | 1 | 1 | 1 | | | forward | protein coding | No | 1995 | EHI_189410 | hypothetical protein, conserved | hypothetical protein, conserved | 3405600 | C4M4M5 | Not Assigned | DS571262:8,416..10,410(+) | DS571262:8416..10410(+) | DS571262 | Entamoeba histolytica HM-1:IMSS | 12 | OG6_101924 | 2 | 664 | 1995 | 76336 | 8.82 | 0 | | | | | GO:0003674 | molecular_function | GO:0008150 | biological_process | | | | | | | | 3.6.3.14 (Transferred entry: 7.1.2.2) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_189410ORhypothetical protein, conservedANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_189410 OR hypothetical protein, conserved AND Entamoeba histolytica HM-1:IMSS |
|
EHI_189430 | EHI_189430A | 2 | 2 | 1 | | | forward | protein coding | No | 1929 | EHI_189430 | ubiquitin carboxyl-terminal hydrolase domain containing protein | ubiquitin carboxyl-terminal hydrolase domain containing protein | 3405317 | C4M4M7 | Not Assigned | DS571262:11,899..13,897(+) | DS571262:11899..13897(+) | DS571262 | Entamoeba histolytica HM-1:IMSS | 9 | OG6_503175 | 0 | 642 | 1929 | 74219 | 7.86 | 0 | | | | | GO:0004221;GO:0036459 | obsolete ubiquitin thiolesterase activity;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_189430ORubiquitin carboxyl-terminal hydrolase domain containing proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_189430 OR ubiquitin carboxyl-terminal hydrolase domain containing protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_190560 | EHI_190560.mRNA | 1 | 1 | 1 | | | reverse | protein coding | Yes | 927 | EHI_190560 | hypothetical protein, pseudogene | hypothetical protein, pseudogene | 6220383 | | Not Assigned | DS571628:5,869..6,795(-) | DS571628:5869..6795(-) | DS571628 | Entamoeba histolytica HM-1:IMSS | 0 | N/A (orthology not determined because poor protein quality) | 0 | 308 | 927 | 33387 | 8.67 | 2 | HMM: LFTFFLFFYIFLSLLFQLFAF, NN: LFTFFLFFYIFLSLLFQLFAF | NN Sum: 4, NN D: .74, HMM Prob: .83 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_190560ORhypothetical protein, pseudogeneANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_190560 OR hypothetical protein, pseudogene AND Entamoeba histolytica HM-1:IMSS |
|
EHI_193470 | EHI_193470A | 2 | 2 | 1 | | | reverse | protein coding | No | 282 | EHI_193470 | signal peptidase complex subunit, putative | signal peptidase complex subunit, putative | 6219801 | | Not Assigned | DS571265:35,126..35,485(-) | DS571265:35126..35485(-) | DS571265 | Entamoeba histolytica HM-1:IMSS | 3 | OG6_103297 | 1 | 93 | 282 | 10423 | 10.47 | 2 | | | GO:0016021;GO:0005787 | integral component of membrane;signal peptidase complex | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_193470ORsignal peptidase complex subunit, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_193470 OR signal peptidase complex subunit, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_194060 | EHI_194060A | 1 | 1 | 1 | | | reverse | protein coding | No | 690 | EHI_194060 | CAAX amino terminal protease family | CAAX amino terminal protease family | 3409020 | C4LZT2 | Not Assigned | DS571191:5,822..6,511(-) | DS571191:5822..6511(-) | DS571191 | Entamoeba histolytica HM-1:IMSS | 8 | OG6_204853 | 1 | 229 | 690 | 26227 | 8.28 | 5 | HMM: MKGFGLQVYFFQTVICS, NN: MKGFGLQVYFFQTVICSLVVINFMYYRYSMSG | NN Sum: 4, NN D: .5, HMM Prob: .17 | GO:0016020 | membrane | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_194060ORCAAX amino terminal protease familyANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_194060 OR CAAX amino terminal protease family AND Entamoeba histolytica HM-1:IMSS |
|
EHI_194070 | EHI_194070A | 1 | 1 | 1 | | | reverse | protein coding | No | 744 | EHI_194070 | 26S protease regulatory subunit S10B, putative | 26S protease regulatory subunit S10B, putative | 6219590 | B1N363 | Not Assigned | DS571191:6,546..7,289(-) | DS571191:6546..7289(-) | DS571191 | Entamoeba histolytica HM-1:IMSS | 0 | OG6_501833 | 0 | 247 | 744 | 27844 | 9.28 | 0 | | | | | GO:0005524;GO:0008568 | ATP binding;microtubule-severing ATPase activity | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_194070OR26S protease regulatory subunit S10B, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_194070 OR 26S protease regulatory subunit S10B, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_194570 | EHI_194570A | 1 | 1 | 1 | | | forward | protein coding | No | 1176 | EHI_194570 | 26S protease regulatory subunit, putative | 26S protease regulatory subunit, putative | 3409019 | C4LZW8 | Not Assigned | DS571191:64,992..66,167(+) | DS571191:64992..66167(+) | DS571191 | Entamoeba histolytica HM-1:IMSS | 10 | OG6_101751 | 0 | 391 | 1176 | 44210 | 7.77 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016887;GO:0016787 | ATP binding;ATPase activity;hydrolase activity | GO:0030163;GO:0006508 | protein catabolic process;proteolysis | | | | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_194570OR26S protease regulatory subunit, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_194570 OR 26S protease regulatory subunit, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_194580 | EHI_194580A | 1 | 1 | 1 | | | forward | protein coding | No | 852 | EHI_194580 | CAAX amino terminal protease family | CAAX amino terminal protease family | 3409045 | C4LZW9 | Not Assigned | DS571191:66,241..67,092(+) | DS571191:66241..67092(+) | DS571191 | Entamoeba histolytica HM-1:IMSS | 8 | OG6_204853 | 1 | 283 | 852 | 32353 | 8.10 | 6 | | | GO:0016020 | membrane | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_194580ORCAAX amino terminal protease familyANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_194580 OR CAAX amino terminal protease family AND Entamoeba histolytica HM-1:IMSS |
|
EHI_197020 | EHI_197020A | 1 | 1 | 1 | | | reverse | protein coding | No | 570 | EHI_197020 | signal peptidase, putative | signal peptidase, putative | 3407454 | C4LVB9 | Not Assigned | DS571157:40,945..41,514(-) | DS571157:40945..41514(-) | DS571157 | Entamoeba histolytica HM-1:IMSS | 11 | OG6_100807 | 0 | 189 | 570 | 21048 | 8.95 | 2 | | | GO:0016020 | membrane | GO:0008233;GO:0008236 | peptidase activity;serine-type peptidase activity | GO:0006508;GO:0006465 | proteolysis;signal peptide processing | | | | | | | 3.4.21.89 (Signal peptidase I) | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_197020ORsignal peptidase, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_197020 OR signal peptidase, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_197460 | EHI_197460A | 1 | 1 | 1 | | 78 | forward | protein coding | No | 993 | EHI_197460 | peptidase S54 (rhomboid) family protein | peptidase S54 (rhomboid) family protein | 3405998 | C4LVG2 | Not Assigned | DS571157:132,854..133,846(+) | DS571157:132932..133846(+) | DS571157 | Entamoeba histolytica HM-1:IMSS | 11 | OG6_100562 | 0 | 304 | 915 | 33931 | 8.36 | 7 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | 3.4.21.- (Serine endopeptidases.) | 3.4.21.- (Serine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_197460ORpeptidase S54 (rhomboid) family proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_197460 OR peptidase S54 (rhomboid) family protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_197490 | EHI_197490A | 1 | 1 | 1 | 3 | | forward | protein coding | No | 978 | EHI_197490 | cysteine protease, putative | cysteine protease, putative | 3406001 | Q8I8C9 | Not Assigned | DS571157:136,475..137,452(+) | DS571157:136475..137449(+) | DS571157 | Entamoeba histolytica HM-1:IMSS | 11 | OG6_139514 | 0 | 324 | 975 | 36594 | 6.65 | 0 | HMM: MFLFLVFLLCEINAI, NN: MFLFLVFLLCEINAI | NN Sum: 3, NN D: .63, HMM Prob: .96 | | | GO:0004197;GO:0008234 | cysteine-type endopeptidase activity;cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.16 (Cathepsin H) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_197490ORcysteine protease, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_197490 OR cysteine protease, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_199610 | EHI_199610A | 1 | 1 | 1 | | | reverse | protein coding | No | 1755 | EHI_199610 | ubiquitin carboxyl-terminal hydrolase domain containing protein | ubiquitin carboxyl-terminal hydrolase domain containing protein | 3409067 | C4M772 | Not Assigned | DS571319:8,582..10,336(-) | DS571319:8582..10336(-) | DS571319 | Entamoeba histolytica HM-1:IMSS | 18 | OG6_101457 | 1 | 584 | 1755 | 69218 | 9.62 | 0 | | | | | GO:0003824;GO:0036459 | catalytic activity;thiol-dependent ubiquitinyl hydrolase activity | GO:0008152;GO:0016579 | metabolic process;protein deubiquitination | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_199610ORubiquitin carboxyl-terminal hydrolase domain containing proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_199610 OR ubiquitin carboxyl-terminal hydrolase domain containing protein AND Entamoeba histolytica HM-1:IMSS |
|
EHI_200230 | EHI_200230A | 2 | 2 | 1 | | | reverse | protein coding | No | 1932 | EHI_200230 | cell surface protease gp63, putative | cell surface protease gp63, putative | 3409717 | C4M7M4 | Not Assigned | DS571332:29,194..31,178(-) | DS571332:29194..31178(-) | DS571332 | Entamoeba histolytica HM-1:IMSS | 16 | OG6_101754 | 1 | 643 | 1932 | 71563 | 6.99 | 1 | HMM: MLIVLLLISFTFAECIFSQ, NN: MLIVLLLISFTFAECI | NN Sum: 4, NN D: .79, HMM Prob: 1 | GO:0016020 | membrane | GO:0004222;GO:0008270 | metalloendopeptidase activity;zinc ion binding | GO:0007155;GO:0006508 | cell adhesion;proteolysis | | | | | | | | 3.4.24.36 (Leishmanolysin) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_200230ORcell surface protease gp63, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_200230 OR cell surface protease gp63, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_200690 | EHI_200690A | 1 | 1 | 1 | | | forward | protein coding | No | 1125 | EHI_200690 | cysteine protease, putative | cysteine protease, putative | 3406992 | C4M3X5 | Not Assigned | DS571248:14,832..15,956(+) | DS571248:14832..15956(+) | DS571248 | Entamoeba histolytica HM-1:IMSS | 52 | OG6_123941 | 10 | 374 | 1125 | 41229 | 5.06 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.16 (Cathepsin H) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_200690ORcysteine protease, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_200690 OR cysteine protease, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_200720 | EHI_200720A | 2 | 2 | 1 | | | reverse | protein coding | No | 282 | EHI_200720 | signal peptidase complex subunit, putative | signal peptidase complex subunit, putative | 6219761 | | Not Assigned | DS571248:18,988..19,347(-) | DS571248:18988..19347(-) | DS571248 | Entamoeba histolytica HM-1:IMSS | 3 | OG6_103297 | 1 | 93 | 282 | 10423 | 10.47 | 2 | | | GO:0016021;GO:0005787 | integral component of membrane;signal peptidase complex | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_200720ORsignal peptidase complex subunit, putativeANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_200720 OR signal peptidase complex subunit, putative AND Entamoeba histolytica HM-1:IMSS |
|
EHI_200820 | EHI_200820A | 1 | 1 | 1 | | | reverse | protein coding | No | 6546 | EHI_200820 | ubiquitin carboxyl-terminal hydrolase domain containing protein | ubiquitin carboxyl-terminal hydrolase domain containing protein | 3406984 | C4M3Y7 | Not Assigned | DS571248:37,450..43,995(-) | DS571248:37450..43995(-) | DS571248 | Entamoeba histolytica HM-1:IMSS | 16 | OG6_204818 | 1 | 2181 | 6546 | 253910 | 4.91 | 0 | | | | | GO:0004221;GO:0036459 | obsolete ubiquitin thiolesterase activity;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=EHI_200820ORubiquitin carboxyl-terminal hydrolase domain containing proteinANDEntamoeba histolytica HM-1:IMSS | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=EHI_200820 OR ubiquitin carboxyl-terminal hydrolase domain containing protein AND Entamoeba histolytica HM-1:IMSS |