|
LdBPK_010630.1 | LdBPK_010630.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 732 | LdBPK_010630.1 | DNA-damage inducible protein DDI1-like protein | DNA-damage inducible protein DDI1-like protein | | E9B7C7 | 1 | Ld01_v01s1:179,084..179,815(+) | Ld01_v01s1:179084..179815(+) | Ld01_v01s1 | Leishmania donovani BPK282A1 | 50 | OG6_101685 | 0 | 243 | 732 | 27001 | 4.43 | 0 | | | | | GO:0004190 | aspartic-type endopeptidase activity | GO:0006508 | proteolysis | GO:0005654 | nucleoplasm | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_010630.1ORDNA-damage inducible protein DDI1-like proteinANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_010630.1 OR DNA-damage inducible protein DDI1-like protein AND Leishmania donovani BPK282A1 |
|
LdBPK_010670.1 | LdBPK_010670.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1485 | LdBPK_010670.1 | mitochondrial-processing peptidase subunit beta, putative | mitochondrial-processing peptidase subunit beta, putative | | E9B7D1 | 1 | Ld01_v01s1:192,591..194,075(+) | Ld01_v01s1:192591..194075(+) | Ld01_v01s1 | Leishmania donovani BPK282A1 | 49 | OG6_100777 | 0 | 494 | 1485 | 54988 | 6.56 | 0 | NN: MMRRTGAVAATAALPQNMTM, HMM: MMRRTGAVAATAALPQNMTM | NN Sum: 0, NN D: .22, HMM Prob: .58 | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | GO:0020023;GO:0017087;GO:0005739 | kinetoplast;mitochondrial processing peptidase complex;mitochondrion | GO:0004222 | metalloendopeptidase activity | GO:0030150 | protein import into mitochondrial matrix | 3.4.24.64 (Mitochondrial processing peptidase) | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_010670.1ORmitochondrial-processing peptidase subunit beta, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_010670.1 OR mitochondrial-processing peptidase subunit beta, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_010850.1 | LdBPK_010850.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 144 | LdBPK_010850.1 | peptidyl dipeptidase, putative | peptidyl dipeptidase, putative | | E9B7E8 | 1 | Ld01_v01s1:268,707..268,850(+) | Ld01_v01s1:268707..268850(+) | Ld01_v01s1 | Leishmania donovani BPK282A1 | 118 | OG6_100561 | 2 | 47 | 144 | 5324 | 6.80 | 0 | | | | | | | | | | | | | | | | 3.4.24.15 (Thimet oligopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_010850.1ORpeptidyl dipeptidase, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_010850.1 OR peptidyl dipeptidase, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_020680.1 | LdBPK_020680.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2454 | LdBPK_020680.1 | ATP-dependent Clp protease subunit, heat shock protein 78 (HSP78), putative | ATP-dependent Clp protease subunit, heat shock protein 78 (HSP78), putative | | E9B7L5 | 2 | Ld02_v01s1:317,583..320,036(+) | Ld02_v01s1:317583..320036(+) | Ld02_v01s1 | Leishmania donovani BPK282A1 | 141 | OG6_100223 | 1 | 817 | 2454 | 90824 | 7.06 | 0 | NN: MLRRRLVQASTALRCGSTAALAA, HMM: MLRRRLVQASTALRCGSTAALAAPFGPFGCGGPRKTAVAAVACSPLASSTAAH | NN Sum: 4, NN D: .55, HMM Prob: 1 | | | GO:0005524 | ATP binding | | | GO:0005739 | mitochondrion | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_020680.1ORATP-dependent Clp protease subunit, heat shock protein 78 (HSP78), putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_020680.1 OR ATP-dependent Clp protease subunit, heat shock protein 78 (HSP78), putative AND Leishmania donovani BPK282A1 |
|
LdBPK_020710.1 | LdBPK_020710.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2037 | LdBPK_020710.1 | peptidyl-dipeptidase, putative | peptidyl-dipeptidase, putative | | E9B7L8 | 2 | Ld02_v01s1:325,911..327,947(+) | Ld02_v01s1:325911..327947(+) | Ld02_v01s1 | Leishmania donovani BPK282A1 | 118 | OG6_100561 | 2 | 678 | 2037 | 76574 | 6.16 | 0 | | | | | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.24.15 (Thimet oligopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_020710.1ORpeptidyl-dipeptidase, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_020710.1 OR peptidyl-dipeptidase, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_030520.1 | LdBPK_030520.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1191 | LdBPK_030520.1 | 26S protease regulatory subunit, putative | 26S protease regulatory subunit, putative | | E9B7S0 | 3 | Ld03_v01s1:202,189..203,379(+) | Ld03_v01s1:202189..203379(+) | Ld03_v01s1 | Leishmania donovani BPK282A1 | 52 | OG6_101751 | 0 | 396 | 1191 | 44453 | 8.90 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | GO:0005838 | proteasome regulatory particle | | | GO:0006511 | ubiquitin-dependent protein catabolic process | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_030520.1OR26S protease regulatory subunit, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_030520.1 OR 26S protease regulatory subunit, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_040430.1 | LdBPK_040430.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2568 | LdBPK_040430.1 | calpain-like cysteine peptidase, putative | calpain-like cysteine peptidase, putative | | E9B809 | 4 | Ld04_v01s1:171,805..174,372(-) | Ld04_v01s1:171805..174372(-) | Ld04_v01s1 | Leishmania donovani BPK282A1 | 136 | OG6_127587 | 2 | 855 | 2568 | 94828 | 4.54 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_040430.1ORcalpain-like cysteine peptidase, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_040430.1 OR calpain-like cysteine peptidase, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_040850.1 | LdBPK_040850.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1191 | LdBPK_040850.1 | rhomboid-like protein | rhomboid-like protein | | E9B850 | 4 | Ld04_v01s1:336,876..338,066(-) | Ld04_v01s1:336876..338066(-) | Ld04_v01s1 | Leishmania donovani BPK282A1 | 48 | OG6_147170 | 0 | 396 | 1191 | 43552 | 8.83 | 4 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | GO:0031966 | mitochondrial membrane | | | GO:0030150 | protein import into mitochondrial matrix | | | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_040850.1ORrhomboid-like proteinANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_040850.1 OR rhomboid-like protein AND Leishmania donovani BPK282A1 |
|
LdBPK_044280.1 | LdBPK_044280.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 123 | LdBPK_044280.1 | lipophosphoglycan biosynthetic protein (fragment) | lipophosphoglycan biosynthetic protein (fragment) | | E9BRM6 | 34 | Ld34_v01s1:1,701,163..1,701,285(+) | Ld34_v01s1:1701163..1701285(+) | Ld34_v01s1 | Leishmania donovani BPK282A1 | 62 | OG6_101718 | 0 | 41 | 123 | 4291 | 10.33 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_044280.1ORlipophosphoglycan biosynthetic protein (fragment)ANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_044280.1 OR lipophosphoglycan biosynthetic protein (fragment) AND Leishmania donovani BPK282A1 |
|
LdBPK_050950.1 | LdBPK_050950.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2724 | LdBPK_050950.1 | glutaminyl cyclase, putative | glutaminyl cyclase, putative | | E9B8I5 | 5 | Ld05_v01s1:352,844..355,567(+) | Ld05_v01s1:352844..355567(+) | Ld05_v01s1 | Leishmania donovani BPK282A1 | 55 | OG6_151075 | 0 | 907 | 2724 | 102104 | 7.70 | 1 | | | | | | | | | | | | | | | | 2.3.2.5 (Glutaminyl-peptide cyclotransferase) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_050950.1ORglutaminyl cyclase, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_050950.1 OR glutaminyl cyclase, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_050960.1 | LdBPK_050960.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2040 | LdBPK_050960.1 | dipeptidyl-peptidase III, putative | dipeptidyl-peptidase III, putative | | E9B8I6 | 5 | Ld05_v01s1:356,842..358,881(+) | Ld05_v01s1:356842..358881(+) | Ld05_v01s1 | Leishmania donovani BPK282A1 | 28 | OG6_103290 | 0 | 679 | 2040 | 75974 | 5.12 | 0 | | | GO:0005737 | cytoplasm | GO:0008239 | dipeptidyl-peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.14.4 (Dipeptidyl-peptidase III) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_050960.1ORdipeptidyl-peptidase III, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_050960.1 OR dipeptidyl-peptidase III, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_060140.1 | LdBPK_060140.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 744 | LdBPK_060140.1 | proteasome beta 6 subunit, putative | proteasome beta 6 subunit, putative | | E9B8M5 | 6 | Ld06_v01s1:53,462..54,205(-) | Ld06_v01s1:53462..54205(-) | Ld06_v01s1 | Leishmania donovani BPK282A1 | 52 | OG6_101631 | 0 | 247 | 744 | 28002 | 6.95 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | GO:0097014;GO:0005737;GO:0031981 | ciliary plasm;cytoplasm;nuclear lumen | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_060140.1ORproteasome beta 6 subunit, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_060140.1 OR proteasome beta 6 subunit, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_060340.1 | LdBPK_060340.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2718 | LdBPK_060340.1 | oligopeptidase B-like protein | oligopeptidase B-like protein | | E9B8P5 | 6 | Ld06_v01s1:116,735..119,452(-) | Ld06_v01s1:116735..119452(-) | Ld06_v01s1 | Leishmania donovani BPK282A1 | 107 | OG6_102873 | 1 | 905 | 2718 | 104128 | 6.29 | 0 | | | | | GO:0004252;GO:0070008;GO:0008236 | serine-type endopeptidase activity;serine-type exopeptidase activity;serine-type peptidase activity | GO:0006508 | proteolysis | GO:0005739 | mitochondrion | | | | | | 3.4.21.83 (Oligopeptidase B) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_060340.1ORoligopeptidase B-like proteinANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_060340.1 OR oligopeptidase B-like protein AND Leishmania donovani BPK282A1 |
|
LdBPK_070040.1 | LdBPK_070040.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 687 | LdBPK_070040.1 | hypothetical protein, conserved | hypothetical protein, conserved | | E9B900 | 7 | Ld07_v01s1:15,046..15,732(+) | Ld07_v01s1:15046..15732(+) | Ld07_v01s1 | Leishmania donovani BPK282A1 | 13 | OG6_478828 | 0 | 228 | 687 | 24660 | 9.01 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_070040.1ORhypothetical protein, conservedANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_070040.1 OR hypothetical protein, conserved AND Leishmania donovani BPK282A1 |
|
LdBPK_070100.1 | LdBPK_070100.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2769 | LdBPK_070100.1 | Zinc finger, C3HC4 type (RING finger), putative | Zinc finger, C3HC4 type (RING finger), putative | | E9B906 | 7 | Ld07_v01s1:45,049..47,817(+) | Ld07_v01s1:45049..47817(+) | Ld07_v01s1 | Leishmania donovani BPK282A1 | 22 | OG6_166659 | 0 | 922 | 2769 | 96401 | 7.84 | 0 | | | | | GO:0046872;GO:0005515;GO:0008270 | metal ion binding;protein binding;zinc ion binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_070100.1ORZinc finger, C3HC4 type (RING finger), putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_070100.1 OR Zinc finger, C3HC4 type (RING finger), putative AND Leishmania donovani BPK282A1 |
|
LdBPK_070250.1 | LdBPK_070250.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 3099 | LdBPK_070250.1 | pitrilysin-like metalloprotease | pitrilysin-like metalloprotease | | E9B921 | 7 | Ld07_v01s1:89,609..92,707(+) | Ld07_v01s1:89609..92707(+) | Ld07_v01s1 | Leishmania donovani BPK282A1 | 51 | OG6_101809 | 0 | 1032 | 3099 | 115437 | 6.33 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | GO:0006508 | proteolysis | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_070250.1ORpitrilysin-like metalloproteaseANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_070250.1 OR pitrilysin-like metalloprotease AND Leishmania donovani BPK282A1 |
|
LdBPK_070430.1 | LdBPK_070430.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1194 | LdBPK_070430.1 | acetylornithine deacetylase-like protein | acetylornithine deacetylase-like protein | | E9B938 | 7 | Ld07_v01s1:161,756..162,949(-) | Ld07_v01s1:161756..162949(-) | Ld07_v01s1 | Leishmania donovani BPK282A1 | 698 | OG6_100626 | 0 | 397 | 1194 | 43082 | 6.06 | 0 | | | GO:0005737 | cytoplasm | GO:0008777;GO:0016787 | acetylornithine deacetylase activity;hydrolase activity | GO:0006526;GO:0008152 | arginine biosynthetic process;metabolic process | | | | | | | | 3.5.1.16 (Acetylornithine deacetylase) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_070430.1ORacetylornithine deacetylase-like proteinANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_070430.1 OR acetylornithine deacetylase-like protein AND Leishmania donovani BPK282A1 |
|
LdBPK_071300.1 | LdBPK_071300.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1038 | LdBPK_071300.1 | proteasome regulatory non-ATP-ase subunit, putative | proteasome regulatory non-ATP-ase subunit, putative | | E9B9B7 | 7 | Ld07_v01s1:578,714..579,751(+) | Ld07_v01s1:578714..579751(+) | Ld07_v01s1 | Leishmania donovani BPK282A1 | 49 | OG6_102002 | 0 | 345 | 1038 | 36273 | 4.04 | 0 | | | | | | | | | GO:0097014;GO:0005737;GO:0005654;GO:0000502;GO:0005838 | ciliary plasm;cytoplasm;nucleoplasm;proteasome complex;proteasome regulatory particle | | | GO:0016049;GO:0006511 | cell growth;ubiquitin-dependent protein catabolic process | | | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_071300.1ORproteasome regulatory non-ATP-ase subunit, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_071300.1 OR proteasome regulatory non-ATP-ase subunit, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_080240.1 | LdBPK_080240.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1569 | LdBPK_080240.1 | ABC1 family, putative | ABC1 family, putative | | E9B9C9 | 8 | Ld08_v01s1:86,511..88,079(+) | Ld08_v01s1:86511..88079(+) | Ld08_v01s1 | Leishmania donovani BPK282A1 | 108 | OG6_100510 | 1 | 522 | 1569 | 58668 | 7.27 | 0 | HMM: MTFRFSRAARYGAAAAGFMGASTVAILLPPRETI, NN: MTFRFSRAARYGAAAAGFMGASTVAILLPPRETI | NN Sum: 1, NN D: .34, HMM Prob: .78 | | | | | | | | | | | | | | 2.7.-.- (Transferring phosphorus-containing groups.) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_080240.1ORABC1 family, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_080240.1 OR ABC1 family, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_080460.1 | LdBPK_080460.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 543 | LdBPK_080460.1 | signal peptidase type I, putative | signal peptidase type I, putative | | E9B9F1 | 8 | Ld08_v01s1:186,579..187,121(+) | Ld08_v01s1:186579..187121(+) | Ld08_v01s1 | Leishmania donovani BPK282A1 | 48 | OG6_100807 | 0 | 180 | 543 | 20581 | 6.80 | 0 | HMM: MREHIDTLLSLRIRDVVQQVVTISLFLSVVLVGWRGAA, NN: MREHIDTLLSLRIRDVVQQVVTISLFLSVVLVGWRGAA | NN Sum: 3, NN D: .45, HMM Prob: .03 | GO:0016020 | membrane | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | GO:0005783 | endoplasmic reticulum | | | | | | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_080460.1ORsignal peptidase type I, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_080460.1 OR signal peptidase type I, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_080960.1 | LdBPK_080960.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1035 | LdBPK_080960.1 | cathepsin L-like protease (fragment) | cathepsin L-like protease (fragment) | | E9B9J8 | 8 | Ld08_v01s1:416,310..417,344(-) | Ld08_v01s1:416310..417344(-) | Ld08_v01s1 | Leishmania donovani BPK282A1 | 546 | OG6_100116 | 2 | 345 | 1035 | 37370 | 7.15 | 1 | HMM: MATSRAALCAVAVVCVVLAAACAPARAI, NN: MATSRAALCAVAVVCVVLAAACAPARAI | NN Sum: 4, NN D: .81, HMM Prob: 1 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_080960.1ORcathepsin L-like protease (fragment)ANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_080960.1 OR cathepsin L-like protease (fragment) AND Leishmania donovani BPK282A1 |
|
LdBPK_090390.1 | LdBPK_090390.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2850 | LdBPK_090390.1 | cysteine peptidase, Clan CA, family C19, putative | cysteine peptidase, Clan CA, family C19, putative | | E9B9S8 | 9 | Ld09_v01s1:142,806..145,655(+) | Ld09_v01s1:142806..145655(+) | Ld09_v01s1 | Leishmania donovani BPK282A1 | 50 | OG6_103732 | 0 | 949 | 2850 | 104832 | 7.19 | 0 | HMM: MRLRVLPRCRRTITSYLLSIMSATAASSR, NN: MRLRVLPRCRRTITSYLLSIMSATAASSR | NN Sum: 3, NN D: .41, HMM Prob: .91 | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | GO:0005737;GO:0005741 | cytoplasm;mitochondrial outer membrane | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_090390.1ORcysteine peptidase, Clan CA, family C19, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_090390.1 OR cysteine peptidase, Clan CA, family C19, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_090650.1 | LdBPK_090650.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1008 | LdBPK_090650.1 | cyclin 1 | cyclin 1 | | E9B9V2 | 9 | Ld09_v01s1:254,223..255,230(+) | Ld09_v01s1:254223..255230(+) | Ld09_v01s1 | Leishmania donovani BPK282A1 | 51 | OG6_127800 | 0 | 335 | 1008 | 35847 | 6.80 | 0 | | | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_090650.1ORcyclin 1ANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_090650.1 OR cyclin 1 AND Leishmania donovani BPK282A1 |
|
LdBPK_090820.1 | LdBPK_090820.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2196 | LdBPK_090820.1 | oligopeptidase b | oligopeptidase b | | E9B9W9 | 9 | Ld09_v01s1:326,225..328,420(-) | Ld09_v01s1:326225..328420(-) | Ld09_v01s1 | Leishmania donovani BPK282A1 | 107 | OG6_102873 | 1 | 731 | 2196 | 83102 | 6.08 | 0 | | | | | GO:0004252;GO:0070008;GO:0008236 | serine-type endopeptidase activity;serine-type exopeptidase activity;serine-type peptidase activity | GO:0006508 | proteolysis | GO:0005737;GO:0005829 | cytoplasm;cytosol | GO:0070012 | oligopeptidase activity | | | 3.4.21.83 (Oligopeptidase B) | 3.4.21.83 (Oligopeptidase B) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_090820.1ORoligopeptidase bANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_090820.1 OR oligopeptidase b AND Leishmania donovani BPK282A1 |
|
LdBPK_091360.1 | LdBPK_091360.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 657 | LdBPK_091360.1 | PPPDE putative peptidase domain containing protein, putative | PPPDE putative peptidase domain containing protein, putative | | E9BA21 | 9 | Ld09_v01s1:519,256..519,912(-) | Ld09_v01s1:519256..519912(-) | Ld09_v01s1 | Leishmania donovani BPK282A1 | 124 | OG6_101256 | 1 | 218 | 657 | 24208 | 6.27 | 0 | | | | | | | | | GO:0005737 | cytoplasm | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_091360.1ORPPPDE putative peptidase domain containing protein, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_091360.1 OR PPPDE putative peptidase domain containing protein, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_091370.1 | LdBPK_091370.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 765 | LdBPK_091370.1 | PPPDE putative peptidase domain containing protein, putative | PPPDE putative peptidase domain containing protein, putative | | E9BA22 | 9 | Ld09_v01s1:521,776..522,540(-) | Ld09_v01s1:521776..522540(-) | Ld09_v01s1 | Leishmania donovani BPK282A1 | 18 | OG6_199733 | 0 | 254 | 765 | 28249 | 7.47 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_091370.1ORPPPDE putative peptidase domain containing protein, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_091370.1 OR PPPDE putative peptidase domain containing protein, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_100510.1 | LdBPK_100510.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 255 | LdBPK_100510.1 | GP63, leishmanolysin (fragment) | GP63, leishmanolysin (fragment) | | E9BA96 | 10 | Ld10_v01s1:213,241..213,495(+) | Ld10_v01s1:213241..213495(+) | Ld10_v01s1 | Leishmania donovani BPK282A1 | 622 | OG6_101754 | 1 | 85 | 255 | 8670 | 12.03 | 1 | HMM: MSVDSSSTHRHRSVAARLVRLAAAGAAVIAAVGTAAAWAHAG, NN: MSVDSSSTHRHRSVAARLVRLAAAGAAVIAA | NN Sum: 2, NN D: .42, HMM Prob: .99 | GO:0016020 | membrane | GO:0004222 | metalloendopeptidase activity | GO:0007155;GO:0006508 | cell adhesion;proteolysis | | | | | | | | 3.4.24.36 (Leishmanolysin) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_100510.1ORGP63, leishmanolysin (fragment)ANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_100510.1 OR GP63, leishmanolysin (fragment) AND Leishmania donovani BPK282A1 |
|
LdBPK_100520.1 | LdBPK_100520.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 261 | LdBPK_100520.1 | GP63, leishmanolysin | GP63, leishmanolysin | | E9BA97 | 10 | Ld10_v01s1:220,588..220,848(+) | Ld10_v01s1:220588..220848(+) | Ld10_v01s1 | Leishmania donovani BPK282A1 | 0 | OG6r1_308469 | 0 | 86 | 261 | 9173 | 9.96 | 0 | HMM: MKTAGTQRVSAAAAVALEHTRARARKPIGHITVCLCVCPCTGI, NN: MKTAGTQRVSAAAAVALEHTRARARKPIGHITVCLCVCPCTGI | NN Sum: 1, NN D: .18, HMM Prob: .92 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_100520.1ORGP63, leishmanolysinANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_100520.1 OR GP63, leishmanolysin AND Leishmania donovani BPK282A1 |
|
LdBPK_110240.1 | LdBPK_110240.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 744 | LdBPK_110240.1 | proteasome alpha 7 subunit, putative | proteasome alpha 7 subunit, putative | | E9BAL2 | 11 | Ld11_v01s1:62,307..63,050(+) | Ld11_v01s1:62307..63050(+) | Ld11_v01s1 | Leishmania donovani BPK282A1 | 49 | OG6_101207 | 0 | 247 | 744 | 27818 | 5.74 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | GO:0005737;GO:0005654 | cytoplasm;nucleoplasm | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_110240.1ORproteasome alpha 7 subunit, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_110240.1 OR proteasome alpha 7 subunit, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_110630.1 | LdBPK_110630.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 855 | LdBPK_110630.1 | metallo-peptidase, Clan MF, Family M17 (fragment) | metallo-peptidase, Clan MF, Family M17 (fragment) | | E9BAQ1 | 11 | Ld11_v01s1:235,360..236,214(+) | Ld11_v01s1:235360..236214(+) | Ld11_v01s1 | Leishmania donovani BPK282A1 | 67 | OG6_142599 | 1 | 285 | 855 | 30290 | 6.41 | 0 | | | GO:0005622 | intracellular | GO:0004177 | aminopeptidase activity | GO:0006508 | proteolysis | GO:0005737 | cytoplasm | | | | | | 3.4.11.- (Aminopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_110630.1ORmetallo-peptidase, Clan MF, Family M17 (fragment)ANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_110630.1 OR metallo-peptidase, Clan MF, Family M17 (fragment) AND Leishmania donovani BPK282A1 |
|
LdBPK_110640.1 | LdBPK_110640.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1014 | LdBPK_110640.1 | metallo-peptidase, Clan MF, Family M17 (fragment) | metallo-peptidase, Clan MF, Family M17 (fragment) | | E9BAQ2 | 11 | Ld11_v01s1:239,096..240,109(+) | Ld11_v01s1:239096..240109(+) | Ld11_v01s1 | Leishmania donovani BPK282A1 | 67 | OG6_142599 | 1 | 338 | 1014 | 35816 | 8.52 | 0 | | | GO:0005622 | intracellular | GO:0004177 | aminopeptidase activity | GO:0006508 | proteolysis | GO:0005737 | cytoplasm | | | | | | 3.4.11.- (Aminopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_110640.1ORmetallo-peptidase, Clan MF, Family M17 (fragment)ANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_110640.1 OR metallo-peptidase, Clan MF, Family M17 (fragment) AND Leishmania donovani BPK282A1 |
|
LdBPK_110730.1 | LdBPK_110730.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1962 | LdBPK_110730.1 | PUF nine target 1 | PUF nine target 1 | | E9BAR1 | 11 | Ld11_v01s1:282,526..284,487(+) | Ld11_v01s1:282526..284487(+) | Ld11_v01s1 | Leishmania donovani BPK282A1 | 54 | OG6_146977 | 0 | 653 | 1962 | 71048 | 9.63 | 0 | NN: MPPRRCPNRLLVLCASINDVTAW, HMM: MPPRRCPNRLLVLCASINDVTAW | NN Sum: 3, NN D: .46, HMM Prob: .99 | | | | | | | GO:0020023 | kinetoplast | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_110730.1ORPUF nine target 1ANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_110730.1 OR PUF nine target 1 AND Leishmania donovani BPK282A1 |
|
LdBPK_120030.1 | LdBPK_120030.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 852 | LdBPK_120030.1 | proteasome beta-1 subunit, putative | proteasome beta-1 subunit, putative | | E9BAX6 | 12 | Ld12_v01s1:5,190..6,041(+) | Ld12_v01s1:5190..6041(+) | Ld12_v01s1 | Leishmania donovani BPK282A1 | 51 | OG6_101390 | 0 | 283 | 852 | 30331 | 7.26 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | GO:0097014;GO:0005737 | ciliary plasm;cytoplasm | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_120030.1ORproteasome beta-1 subunit, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_120030.1 OR proteasome beta-1 subunit, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_120170.1 | LdBPK_120170.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 4941 | LdBPK_120170.1 | ubiquitin hydrolase, putative | ubiquitin hydrolase, putative | | E9BAZ4 | 12 | Ld12_v01s1:58,061..63,001(+) | Ld12_v01s1:58061..63001(+) | Ld12_v01s1 | Leishmania donovani BPK282A1 | 26 | OG6_199649 | 0 | 1646 | 4941 | 173466 | 6.65 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_120170.1ORubiquitin hydrolase, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_120170.1 OR ubiquitin hydrolase, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_120190.1 | LdBPK_120190.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1236 | LdBPK_120190.1 | proteasome regulatory ATPase subunittcc1l8.3, putative | proteasome regulatory ATPase subunittcc1l8.3, putative | | E9BAZ6 | 12 | Ld12_v01s1:70,610..71,845(+) | Ld12_v01s1:70610..71845(+) | Ld12_v01s1 | Leishmania donovani BPK282A1 | 53 | OG6_101965 | 0 | 411 | 1236 | 45862 | 8.55 | 0 | HMM: MAISSVASVSATKASAL, NN: MAISSVASVSATKASALAA | NN Sum: 0, NN D: .11, HMM Prob: .54 | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | GO:0005838 | proteasome regulatory particle | | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_120190.1ORproteasome regulatory ATPase subunittcc1l8.3, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_120190.1 OR proteasome regulatory ATPase subunittcc1l8.3, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_120220.1 | LdBPK_120220.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2097 | LdBPK_120220.1 | hypothetical protein, unknown function | hypothetical protein, unknown function | | E9BAZ9 | 12 | Ld12_v01s1:79,878..81,974(+) | Ld12_v01s1:79878..81974(+) | Ld12_v01s1 | Leishmania donovani BPK282A1 | 44 | OG6_139763 | 0 | 698 | 2097 | 73849 | 6.83 | 2 | NN: MAPMRHGAADAAPMCLADRMKQRYRCPLSPLLMCTVLFAQFLLCSTSLPVAAD, HMM: MAPMRHGAADAAPMCLADRMKQRYRCPLSPLLMCTVLFAQFLLCSTSLPVAAD | NN Sum: 1, NN D: .34, HMM Prob: .65 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_120220.1ORhypothetical protein, unknown functionANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_120220.1 OR hypothetical protein, unknown function AND Leishmania donovani BPK282A1 |
|
LdBPK_120830.1 | LdBPK_120830.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 4119 | LdBPK_120830.1 | puromycin-sensitive aminopeptidase-like protein | puromycin-sensitive aminopeptidase-like protein | | E9BB65 | 12 | Ld12_v01s1:531,689..535,807(+) | Ld12_v01s1:531689..535807(+) | Ld12_v01s1 | Leishmania donovani BPK282A1 | 46 | OG6_156775 | 0 | 1372 | 4119 | 149048 | 6.75 | 0 | | | | | GO:0008237;GO:0008270 | metallopeptidase activity;zinc ion binding | | | | | | | | | | 3.4.11.- (Aminopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_120830.1ORpuromycin-sensitive aminopeptidase-like proteinANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_120830.1 OR puromycin-sensitive aminopeptidase-like protein AND Leishmania donovani BPK282A1 |
|
LdBPK_120920.1 | LdBPK_120920.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1863 | LdBPK_120920.1 | Alpha/beta hydrolase domain-containing protein | Alpha/beta hydrolase domain-containing protein | | E9BB74 | 12 | Ld12_v01s1:559,068..560,930(+) | Ld12_v01s1:559068..560930(+) | Ld12_v01s1 | Leishmania donovani BPK282A1 | 86 | OG6_100915 | 1 | 620 | 1863 | 69365 | 6.88 | 0 | | | | | | | | | GO:0005737 | cytoplasm | | | | | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_120920.1ORAlpha/beta hydrolase domain-containing proteinANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_120920.1 OR Alpha/beta hydrolase domain-containing protein AND Leishmania donovani BPK282A1 |
|
LdBPK_130090.1 | LdBPK_130090.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1512 | LdBPK_130090.1 | metallo-peptidase, Clan MA(E) Family M32 | metallo-peptidase, Clan MA(E) Family M32 | | E9BB84 | 13 | Ld13_v01s1:23,391..24,902(-) | Ld13_v01s1:23391..24902(-) | Ld13_v01s1 | Leishmania donovani BPK282A1 | 152 | OG6_105939 | 3 | 503 | 1512 | 57195 | 5.33 | 0 | | | | | GO:0004181 | metallocarboxypeptidase activity | GO:0006508 | proteolysis | | | GO:0004181 | metallocarboxypeptidase activity | GO:0006508 | proteolysis | | 3.4.17.19 (Carboxypeptidase Taq) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_130090.1ORmetallo-peptidase, Clan MA(E) Family M32ANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_130090.1 OR metallo-peptidase, Clan MA(E) Family M32 AND Leishmania donovani BPK282A1 |
|
LdBPK_130570.1 | LdBPK_130570.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1725 | LdBPK_130570.1 | Metallopeptidase family M24, putative | Metallopeptidase family M24, putative | | E9BBD1 | 13 | Ld13_v01s1:197,907..199,631(+) | Ld13_v01s1:197907..199631(+) | Ld13_v01s1 | Leishmania donovani BPK282A1 | 49 | OG6_146697 | 0 | 574 | 1725 | 61524 | 9.46 | 0 | | | | | | | | | GO:0005634 | nucleus | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_130570.1ORMetallopeptidase family M24, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_130570.1 OR Metallopeptidase family M24, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_130760.1 | LdBPK_130760.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1587 | LdBPK_130760.1 | mitochondrial processing peptidase alpha subunit, putative | mitochondrial processing peptidase alpha subunit, putative | | E9BBF0 | 13 | Ld13_v01s1:276,214..277,800(-) | Ld13_v01s1:276214..277800(-) | Ld13_v01s1 | Leishmania donovani BPK282A1 | 51 | OG6_146937 | 0 | 528 | 1587 | 57786 | 8.09 | 0 | NN: MFRRVVAPAPVAATAACAGQARSI, HMM: MFRRVVAPAPVAATAACAGQAR | NN Sum: 1, NN D: .33, HMM Prob: .98 | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | GO:0005739 | mitochondrion | | | | | | 3.4.99.41 (Transferred entry: 3.4.24.64) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_130760.1ORmitochondrial processing peptidase alpha subunit, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_130760.1 OR mitochondrial processing peptidase alpha subunit, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_130940.1 | LdBPK_130940.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 5235 | LdBPK_130940.1 | subtilisin peptidase | subtilisin peptidase | | E9BBG7 | 13 | Ld13_v01s1:331,478..336,712(-) | Ld13_v01s1:331478..336712(-) | Ld13_v01s1 | Leishmania donovani BPK282A1 | 53 | OG6_136864 | 0 | 1744 | 5235 | 184655 | 7.96 | 2 | NN: MEAVVALRLLTIHILAALLLVLPSFPLAEGP, HMM: MEAVVALRLLTIHILAALLLVLPSFPLAEGP | NN Sum: 4, NN D: .71, HMM Prob: .98 | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | | | GO:0004252 | serine-type endopeptidase activity | GO:0030154;GO:0045454;GO:0009405 | cell differentiation;cell redox homeostasis;pathogenesis | | 3.4.21.112 (Site-1 protease) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_130940.1ORsubtilisin peptidaseANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_130940.1 OR subtilisin peptidase AND Leishmania donovani BPK282A1 |
|
LdBPK_130990.1 | LdBPK_130990.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1317 | LdBPK_130990.1 | proteasome regulatory ATPase subunit 2, putative | proteasome regulatory ATPase subunit 2, putative | | E9BBH3 | 13 | Ld13_v01s1:362,081..363,397(-) | Ld13_v01s1:362081..363397(-) | Ld13_v01s1 | Leishmania donovani BPK282A1 | 54 | OG6_101477 | 0 | 438 | 1317 | 49289 | 5.60 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | GO:0005737;GO:0005654;GO:0005838 | cytoplasm;nucleoplasm;proteasome regulatory particle | | | GO:0006511 | ubiquitin-dependent protein catabolic process | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_130990.1ORproteasome regulatory ATPase subunit 2, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_130990.1 OR proteasome regulatory ATPase subunit 2, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_131040.1 | LdBPK_131040.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1212 | LdBPK_131040.1 | Alpha/beta hydrolase family, putative | Alpha/beta hydrolase family, putative | | E9BBH8 | 13 | Ld13_v01s1:377,502..378,713(-) | Ld13_v01s1:377502..378713(-) | Ld13_v01s1 | Leishmania donovani BPK282A1 | 52 | OG6_101420 | 0 | 403 | 1212 | 43599 | 8.49 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_131040.1ORAlpha/beta hydrolase family, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_131040.1 OR Alpha/beta hydrolase family, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_140180.1 | LdBPK_140180.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1515 | LdBPK_140180.1 | carboxypeptidase, putative | carboxypeptidase, putative | | E9BBQ3 | 14 | Ld14_v01s1:46,667..48,181(+) | Ld14_v01s1:46667..48181(+) | Ld14_v01s1 | Leishmania donovani BPK282A1 | 152 | OG6_105939 | 3 | 504 | 1515 | 57256 | 6.15 | 0 | | | | | GO:0004181 | metallocarboxypeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.17.19 (Carboxypeptidase Taq) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_140180.1ORcarboxypeptidase, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_140180.1 OR carboxypeptidase, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_140310.1 | LdBPK_140310.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 858 | LdBPK_140310.1 | proteasome alpha 3 subunit, putative | proteasome alpha 3 subunit, putative | | E9BBR6 | 14 | Ld14_v01s1:86,309..87,166(+) | Ld14_v01s1:86309..87166(+) | Ld14_v01s1 | Leishmania donovani BPK282A1 | 50 | OG6_101968 | 0 | 285 | 858 | 32191 | 5.22 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | GO:0005737;GO:0005654 | cytoplasm;nucleoplasm | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_140310.1ORproteasome alpha 3 subunit, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_140310.1 OR proteasome alpha 3 subunit, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_150090.1 | LdBPK_150090.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1272 | LdBPK_150090.1 | ATP-dependent protease ATPase subunit HslU1, putative | ATP-dependent protease ATPase subunit HslU1, putative | | E9BC50 | 15 | Ld15_v01s1:27,697..28,968(-) | Ld15_v01s1:27697..28968(-) | Ld15_v01s1 | Leishmania donovani BPK282A1 | 50 | OG6_106348 | 0 | 423 | 1272 | 47494 | 6.54 | 0 | | | GO:0009376;GO:0005737 | HslUV protease complex;cytoplasm | GO:0005524;GO:0016887;GO:0070011 | ATP binding;ATPase activity;peptidase activity, acting on L-amino acid peptides | | | GO:0009376;GO:0005737;GO:0042645 | HslUV protease complex;cytoplasm;mitochondrial nucleoid | | | GO:0006264;GO:0070581 | mitochondrial DNA replication;rolling circle DNA replication | | 2.7.1.71 (Shikimate kinase) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_150090.1ORATP-dependent protease ATPase subunit HslU1, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_150090.1 OR ATP-dependent protease ATPase subunit HslU1, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_150600.1 | LdBPK_150600.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 978 | LdBPK_150600.1 | signal peptidase subunit, putative | signal peptidase subunit, putative | | E9BCA1 | 15 | Ld15_v01s1:221,962..222,939(+) | Ld15_v01s1:221962..222939(+) | Ld15_v01s1 | Leishmania donovani BPK282A1 | 27 | OG6_165119 | 0 | 325 | 978 | 36525 | 9.47 | 1 | HMM: MHSMRQRSCDIFASTVSALLVTAVLTA, NN: MHSMRQRSCDIFASTVSALLVTAVLTA | NN Sum: 3, NN D: .51, HMM Prob: .63 | GO:0016021;GO:0005787 | integral component of membrane;signal peptidase complex | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_150600.1ORsignal peptidase subunit, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_150600.1 OR signal peptidase subunit, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_151320.1 | LdBPK_151320.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 4242 | LdBPK_151320.1 | ubiquitin hydrolase, putative | ubiquitin hydrolase, putative | | E9BCH1 | 15 | Ld15_v01s1:527,898..532,139(-) | Ld15_v01s1:527898..532139(-) | Ld15_v01s1 | Leishmania donovani BPK282A1 | 52 | OG6_145141 | 0 | 1413 | 4242 | 154736 | 5.60 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | GO:0097014;GO:0005737;GO:0031981 | ciliary plasm;cytoplasm;nuclear lumen | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_151320.1ORubiquitin hydrolase, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_151320.1 OR ubiquitin hydrolase, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_151600.1 | LdBPK_151600.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1059 | LdBPK_151600.1 | presenilin-like aspartic peptidase, putative | presenilin-like aspartic peptidase, putative | | E9BCJ9 | 15 | Ld15_v01s1:599,799..600,857(-) | Ld15_v01s1:599799..600857(-) | Ld15_v01s1 | Leishmania donovani BPK282A1 | 49 | OG6_101989 | 0 | 352 | 1059 | 38820 | 7.23 | 7 | | | GO:0016021 | integral component of membrane | GO:0004190 | aspartic-type endopeptidase activity | GO:0016485 | protein processing | GO:0005737 | cytoplasm | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_151600.1ORpresenilin-like aspartic peptidase, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_151600.1 OR presenilin-like aspartic peptidase, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_160300.1 | LdBPK_160300.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 774 | LdBPK_160300.1 | proteasome 26S non-ATPase subunit 9, putative | proteasome 26S non-ATPase subunit 9, putative | | E9BCN4 | 16 | Ld16_v01s1:99,743..100,516(-) | Ld16_v01s1:99743..100516(-) | Ld16_v01s1 | Leishmania donovani BPK282A1 | 52 | OG6_102356 | 0 | 257 | 774 | 28383 | 4.54 | 0 | | | | | GO:0005515 | protein binding | | | GO:0005737 | cytoplasm | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_160300.1ORproteasome 26S non-ATPase subunit 9, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_160300.1 OR proteasome 26S non-ATPase subunit 9, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_160730.1 | LdBPK_160730.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 5688 | LdBPK_160730.1 | ubiquitin hydrolase, putative | ubiquitin hydrolase, putative | | E9BCS6 | 16 | Ld16_v01s1:250,518..256,205(-) | Ld16_v01s1:250518..256205(-) | Ld16_v01s1 | Leishmania donovani BPK282A1 | 54 | OG6_154037 | 0 | 1895 | 5688 | 200912 | 6.37 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | GO:0005737;GO:0031981;GO:0005634 | cytoplasm;nuclear lumen;nucleus | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_160730.1ORubiquitin hydrolase, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_160730.1 OR ubiquitin hydrolase, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_161460.1 | LdBPK_161460.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2805 | LdBPK_161460.1 | hypothetical protein, conserved | hypothetical protein, conserved | | E9BCZ8 | 16 | Ld16_v01s1:565,081..567,885(-) | Ld16_v01s1:565081..567885(-) | Ld16_v01s1 | Leishmania donovani BPK282A1 | 30 | OG6_110278 | 0 | 934 | 2805 | 99123 | 8.51 | 0 | | | | | | | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_161460.1ORhypothetical protein, conservedANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_161460.1 OR hypothetical protein, conserved AND Leishmania donovani BPK282A1 |
|
LdBPK_161650.1 | LdBPK_161650.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 3696 | LdBPK_161650.1 | hypothetical protein, conserved | hypothetical protein, conserved | | E9BD16 | 16 | Ld16_v01s1:646,304..649,999(+) | Ld16_v01s1:646304..649999(+) | Ld16_v01s1 | Leishmania donovani BPK282A1 | 51 | OG6_102663 | 0 | 1231 | 3696 | 138806 | 6.48 | 0 | | | | | GO:0005515 | protein binding | | | GO:0005930;GO:0005737 | axoneme;cytoplasm | | | GO:0060285 | cilium-dependent cell motility | | | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_161650.1ORhypothetical protein, conservedANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_161650.1 OR hypothetical protein, conserved AND Leishmania donovani BPK282A1 |
|
LdBPK_170250.1 | LdBPK_170250.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1269 | LdBPK_170250.1 | peptidase t, putative | peptidase t, putative | | E9BD46 | 17 | Ld17_v01s1:92,479..93,747(-) | Ld17_v01s1:92479..93747(-) | Ld17_v01s1 | Leishmania donovani BPK282A1 | 53 | OG6_111055 | 0 | 422 | 1269 | 46826 | 6.88 | 0 | | | GO:0005737 | cytoplasm | GO:0016787;GO:0045148;GO:0008270 | hydrolase activity;tripeptide aminopeptidase activity;zinc ion binding | GO:0008152;GO:0006518 | metabolic process;peptide metabolic process | | | | | | | | 3.4.11.4 (Tripeptide aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_170250.1ORpeptidase t, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_170250.1 OR peptidase t, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_171190.1 | LdBPK_171190.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1740 | LdBPK_171190.1 | Peptidase C19, ubiquitin carboxyl-terminal hydrolase, putative | Peptidase C19, ubiquitin carboxyl-terminal hydrolase, putative | | E9BDE1 | 17 | Ld17_v01s1:521,421..523,160(+) | Ld17_v01s1:521421..523160(+) | Ld17_v01s1 | Leishmania donovani BPK282A1 | 25 | OG6_199796 | 0 | 579 | 1740 | 63719 | 5.25 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | GO:0005634 | nucleus | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_171190.1ORPeptidase C19, ubiquitin carboxyl-terminal hydrolase, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_171190.1 OR Peptidase C19, ubiquitin carboxyl-terminal hydrolase, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_171210.1 | LdBPK_171210.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 4293 | LdBPK_171210.1 | kinesin, putative | kinesin, putative | | E9BDE3 | 17 | Ld17_v01s1:526,498..530,790(+) | Ld17_v01s1:526498..530790(+) | Ld17_v01s1 | Leishmania donovani BPK282A1 | 54 | OG6_146515 | 0 | 1430 | 4293 | 158299 | 6.91 | 0 | | | | | GO:0005524;GO:0005488;GO:0008017;GO:0003777;GO:0005515 | ATP binding;binding;microtubule binding;microtubule motor activity;protein binding | GO:0007018 | microtubule-based movement | GO:0005930;GO:0097542 | axoneme;ciliary tip | | | GO:0010608 | posttranscriptional regulation of gene expression | | 3.6.4.4 (Transferred entry: 5.6.1.3) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_171210.1ORkinesin, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_171210.1 OR kinesin, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_171390.1 | LdBPK_171390.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2130 | LdBPK_171390.1 | eukaryotic translation initiation factor 3 subunit b | eukaryotic translation initiation factor 3 subunit b | | E9BDG1 | 17 | Ld17_v01s1:601,169..603,298(+) | Ld17_v01s1:601169..603298(+) | Ld17_v01s1 | Leishmania donovani BPK282A1 | 55 | OG6_101924 | 0 | 709 | 2130 | 80810 | 8.01 | 0 | | | | | | | | | GO:0005737;GO:0005852 | cytoplasm;eukaryotic translation initiation factor 3 complex | | | | | | 3.6.3.14 (Transferred entry: 7.1.2.2) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_171390.1OReukaryotic translation initiation factor 3 subunit bANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_171390.1 OR eukaryotic translation initiation factor 3 subunit b AND Leishmania donovani BPK282A1 |
|
LdBPK_171520.1 | LdBPK_171520.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 813 | LdBPK_171520.1 | otubain cysteine peptidase, Clan CA, family C65, putative | otubain cysteine peptidase, Clan CA, family C65, putative | | E9BDH4 | 17 | Ld17_v01s1:638,654..639,466(+) | Ld17_v01s1:638654..639466(+) | Ld17_v01s1 | Leishmania donovani BPK282A1 | 51 | OG6_102549 | 0 | 270 | 813 | 30249 | 4.33 | 0 | | | | | | | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_171520.1ORotubain cysteine peptidase, Clan CA, family C65, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_171520.1 OR otubain cysteine peptidase, Clan CA, family C65, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_180360.1 | LdBPK_180360.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1071 | LdBPK_180360.1 | GPI-anchor transamidase subunit 8 (GPI8), putative | GPI-anchor transamidase subunit 8 (GPI8), putative | | E9BDL7 | 18 | Ld18_v01s1:147,742..148,812(-) | Ld18_v01s1:147742..148812(-) | Ld18_v01s1 | Leishmania donovani BPK282A1 | 49 | OG6_101767 | 0 | 356 | 1071 | 39684 | 5.87 | 1 | NN: MTFPTRCTATTLLVVVLVLTASSCLSDAYAA, HMM: MTFPTRCTATTLLVVVLVLTASSCLSDAYAA | NN Sum: 4, NN D: .76, HMM Prob: 1 | | | GO:0008233 | peptidase activity | GO:0006508 | proteolysis | GO:0005783;GO:0005635 | endoplasmic reticulum;nuclear envelope | | | | | | 3.-.-.- (Hydrolases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_180360.1ORGPI-anchor transamidase subunit 8 (GPI8), putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_180360.1 OR GPI-anchor transamidase subunit 8 (GPI8), putative AND Leishmania donovani BPK282A1 |
|
LdBPK_180450.1 | LdBPK_180450.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1389 | LdBPK_180450.1 | serine carboxypeptidase (CBP1), putative | serine carboxypeptidase (CBP1), putative | | E9BDM6 | 18 | Ld18_v01s1:182,635..184,023(-) | Ld18_v01s1:182635..184023(-) | Ld18_v01s1 | Leishmania donovani BPK282A1 | 158 | OG6_100109 | 0 | 462 | 1389 | 51967 | 5.83 | 1 | HMM: MASSLSTTALLVALFVTMVPWACVRTVYAS, NN: MASSLSTTALLVALFVTMVPWACVRTVYAS | NN Sum: 4, NN D: .79, HMM Prob: 1 | | | GO:0004185 | serine-type carboxypeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.16.- (Serine-type carboxypeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_180450.1ORserine carboxypeptidase (CBP1), putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_180450.1 OR serine carboxypeptidase (CBP1), putative AND Leishmania donovani BPK282A1 |
|
LdBPK_180620.1 | LdBPK_180620.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1797 | LdBPK_180620.1 | ATP-dependent zinc metallopeptidase, putative | ATP-dependent zinc metallopeptidase, putative | | E9BDP3 | 18 | Ld18_v01s1:251,498..253,294(+) | Ld18_v01s1:251498..253294(+) | Ld18_v01s1 | Leishmania donovani BPK282A1 | 50 | OG6_139899 | 0 | 598 | 1797 | 64906 | 6.26 | 1 | | | | | GO:0005524;GO:0004222 | ATP binding;metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_180620.1ORATP-dependent zinc metallopeptidase, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_180620.1 OR ATP-dependent zinc metallopeptidase, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_181070.1 | LdBPK_181070.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2292 | LdBPK_181070.1 | cysteine peptidase, Clan CA, family C2, putative | cysteine peptidase, Clan CA, family C2, putative | | E9BDT7 | 18 | Ld18_v01s1:446,533..448,824(+) | Ld18_v01s1:446533..448824(+) | Ld18_v01s1 | Leishmania donovani BPK282A1 | 39 | OG6_158065 | 0 | 763 | 2292 | 84344 | 5.36 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_181070.1ORcysteine peptidase, Clan CA, family C2, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_181070.1 OR cysteine peptidase, Clan CA, family C2, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_181300.1 | LdBPK_181300.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 4407 | LdBPK_181300.1 | hypothetical protein, conserved | hypothetical protein, conserved | | E9BDW1 | 18 | Ld18_v01s1:539,422..543,828(+) | Ld18_v01s1:539422..543828(+) | Ld18_v01s1 | Leishmania donovani BPK282A1 | 53 | OG6_156926 | 0 | 1468 | 4407 | 159805 | 6.38 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_181300.1ORhypothetical protein, conservedANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_181300.1 OR hypothetical protein, conserved AND Leishmania donovani BPK282A1 |
|
LdBPK_190120.1 | LdBPK_190120.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 762 | LdBPK_190120.1 | Der1-like family, putative | Der1-like family, putative | | E9BE08 | 19 | Ld19_v01s1:23,770..24,531(-) | Ld19_v01s1:23770..24531(-) | Ld19_v01s1 | Leishmania donovani BPK282A1 | 95 | OG6_101672 | 1 | 253 | 762 | 28474 | 8.83 | 4 | HMM: MSQNFGDWFNQLGLVTRASLVASVGLSAACSL, NN: MSQNFGDWFNQLGLVTRASLVASVGLSAACSLN | NN Sum: 1, NN D: .37, HMM Prob: .52 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_190120.1ORDer1-like family, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_190120.1 OR Der1-like family, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_190150.1 | LdBPK_190150.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1143 | LdBPK_190150.1 | metallo-peptidase, Clan MG, Family M24 | metallo-peptidase, Clan MG, Family M24 | | E9BE11 | 19 | Ld19_v01s1:33,007..34,149(-) | Ld19_v01s1:33007..34149(-) | Ld19_v01s1 | Leishmania donovani BPK282A1 | 52 | OG6_101895 | 0 | 380 | 1143 | 42529 | 5.85 | 0 | | | | | | | | | GO:0005737 | cytoplasm | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_190150.1ORmetallo-peptidase, Clan MG, Family M24ANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_190150.1 OR metallo-peptidase, Clan MG, Family M24 AND Leishmania donovani BPK282A1 |
|
LdBPK_190540.1 | LdBPK_190540.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1206 | LdBPK_190540.1 | metallo- peptidase, Clan MG, Family M24 | metallo- peptidase, Clan MG, Family M24 | | E9BE49 | 19 | Ld19_v01s1:212,880..214,085(+) | Ld19_v01s1:212880..214085(+) | Ld19_v01s1 | Leishmania donovani BPK282A1 | 55 | OG6_100342 | 0 | 401 | 1206 | 44939 | 6.45 | 0 | | | | | GO:0004177;GO:0008235 | aminopeptidase activity;metalloexopeptidase activity | GO:0006508 | proteolysis | GO:0005737 | cytoplasm | | | | | 3.4.11.18 (Methionyl aminopeptidase) | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_190540.1ORmetallo- peptidase, Clan MG, Family M24ANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_190540.1 OR metallo- peptidase, Clan MG, Family M24 AND Leishmania donovani BPK282A1 |
|
LdBPK_191460.1 | LdBPK_191460.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1065 | LdBPK_191460.1 | cysteine peptidase A (CBA) | cysteine peptidase A (CBA) | | E9BED5 | 19 | Ld19_v01s1:626,399..627,463(+) | Ld19_v01s1:626399..627463(+) | Ld19_v01s1 | Leishmania donovani BPK282A1 | 546 | OG6_100116 | 2 | 354 | 1065 | 38902 | 6.87 | 1 | NN: MARRNPFFFAIVVTILFVVCYGSAL, HMM: MARRNPFFFAIVVTILFVVCYGSAL | NN Sum: 4, NN D: .82, HMM Prob: .52 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_191460.1ORcysteine peptidase A (CBA)ANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_191460.1 OR cysteine peptidase A (CBA) AND Leishmania donovani BPK282A1 |
|
LdBPK_191620.1 | LdBPK_191620.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1797 | LdBPK_191620.1 | ATP-dependent zinc metallopeptidase, putative | ATP-dependent zinc metallopeptidase, putative | | E9BEF2 | 19 | Ld19_v01s1:681,191..682,987(+) | Ld19_v01s1:681191..682987(+) | Ld19_v01s1 | Leishmania donovani BPK282A1 | 67 | OG6_139691 | 0 | 598 | 1797 | 64613 | 6.96 | 1 | | | | | GO:0005524;GO:0004222 | ATP binding;metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_191620.1ORATP-dependent zinc metallopeptidase, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_191620.1 OR ATP-dependent zinc metallopeptidase, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_191660.1 | LdBPK_191660.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 378 | LdBPK_191660.1 | ATG8/AUT7/APG8/PAZ2, putative | ATG8/AUT7/APG8/PAZ2, putative | | E9BEF6 | 19 | Ld19_v01s1:687,990..688,367(+) | Ld19_v01s1:687990..688367(+) | Ld19_v01s1 | Leishmania donovani BPK282A1 | 66 | OG6_100707 | 0 | 125 | 378 | 14072 | 7.51 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_191660.1ORATG8/AUT7/APG8/PAZ2, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_191660.1 OR ATG8/AUT7/APG8/PAZ2, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_201210.1 | LdBPK_201210.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 369 | LdBPK_201210.1 | calpain-like cysteine peptidase, putative (fragment) | calpain-like cysteine peptidase, putative (fragment) | | E9BES0 | 20 | Ld20_v01s1:537,799..538,167(+) | Ld20_v01s1:537799..538167(+) | Ld20_v01s1 | Leishmania donovani BPK282A1 | 136 | OG6_127587 | 2 | 123 | 369 | 13470 | 3.17 | 0 | | | | | | | | | | | | | | | | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_201210.1ORcalpain-like cysteine peptidase, putative (fragment)ANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_201210.1 OR calpain-like cysteine peptidase, putative (fragment) AND Leishmania donovani BPK282A1 |
|
LdBPK_201220.1 | LdBPK_201220.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 342 | LdBPK_201220.1 | calpain-like cysteine peptidase, putative (fragment) | calpain-like cysteine peptidase, putative (fragment) | | E9BES1 | 20 | Ld20_v01s1:544,143..544,484(+) | Ld20_v01s1:544143..544484(+) | Ld20_v01s1 | Leishmania donovani BPK282A1 | 136 | OG6_127587 | 2 | 114 | 342 | 12593 | 4.41 | 0 | | | | | | | | | | | | | | | | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_201220.1ORcalpain-like cysteine peptidase, putative (fragment)ANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_201220.1 OR calpain-like cysteine peptidase, putative (fragment) AND Leishmania donovani BPK282A1 |
|
LdBPK_201230.1 | LdBPK_201230.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2064 | LdBPK_201230.1 | cysteine peptidase, Clan CA, family C2, putative | cysteine peptidase, Clan CA, family C2, putative | | E9BES2 | 20 | Ld20_v01s1:549,284..551,347(+) | Ld20_v01s1:549284..551347(+) | Ld20_v01s1 | Leishmania donovani BPK282A1 | 50 | OG6_155901 | 0 | 687 | 2064 | 78297 | 4.73 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0005930;GO:0005737 | axoneme;cytoplasm | | | | | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_201230.1ORcysteine peptidase, Clan CA, family C2, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_201230.1 OR cysteine peptidase, Clan CA, family C2, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_201240.1 | LdBPK_201240.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2232 | LdBPK_201240.1 | calpain-like cysteine peptidase, putative | calpain-like cysteine peptidase, putative | | E9BES3 | 20 | Ld20_v01s1:555,493..557,724(+) | Ld20_v01s1:555493..557724(+) | Ld20_v01s1 | Leishmania donovani BPK282A1 | 28 | OG6_199937 | 0 | 743 | 2232 | 82457 | 6.76 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_201240.1ORcalpain-like cysteine peptidase, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_201240.1 OR calpain-like cysteine peptidase, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_201250.1 | LdBPK_201250.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 3318 | LdBPK_201250.1 | calpain-like cysteine peptidase, putative | calpain-like cysteine peptidase, putative | | E9BES4 | 20 | Ld20_v01s1:560,824..564,141(+) | Ld20_v01s1:560824..564141(+) | Ld20_v01s1 | Leishmania donovani BPK282A1 | 36 | OG6_199938 | 0 | 1105 | 3318 | 119759 | 8.21 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_201250.1ORcalpain-like cysteine peptidase, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_201250.1 OR calpain-like cysteine peptidase, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_201280.1 | LdBPK_201280.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 8274 | LdBPK_201280.1 | Raptor N-terminal CASPase like domain containing protein, putative | Raptor N-terminal CASPase like domain containing protein, putative | | E9BES7 | 20 | Ld20_v01s1:572,027..580,300(+) | Ld20_v01s1:572027..580300(+) | Ld20_v01s1 | Leishmania donovani BPK282A1 | 55 | OG6_147359 | 0 | 2757 | 8274 | 293966 | 6.99 | 0 | | | | | GO:0005515 | protein binding | | | GO:0005737 | cytoplasm | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_201280.1ORRaptor N-terminal CASPase like domain containing protein, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_201280.1 OR Raptor N-terminal CASPase like domain containing protein, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_201720.1 | LdBPK_201720.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 312 | LdBPK_201720.1 | amidohydrolase, putative (fragment) | amidohydrolase, putative (fragment) | | E9BEX0 | 20 | Ld20_v01s1:733,119..733,430(-) | Ld20_v01s1:733119..733430(-) | Ld20_v01s1 | Leishmania donovani BPK282A1 | 183 | OG6_101553 | 2 | 104 | 312 | 11530 | 4.59 | 0 | | | | | | | | | GO:0097014;GO:0005737;GO:0005654 | ciliary plasm;cytoplasm;nucleoplasm | | | | | | 3.5.1.14 (N-acyl-aliphatic-L-amino acid amidohydrolase) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_201720.1ORamidohydrolase, putative (fragment)ANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_201720.1 OR amidohydrolase, putative (fragment) AND Leishmania donovani BPK282A1 |
|
LdBPK_201740.1 | LdBPK_201740.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 819 | LdBPK_201740.1 | amidohydrolase, putative (fragment) | amidohydrolase, putative (fragment) | | E9BEX2 | 20 | Ld20_v01s1:739,929..740,747(-) | Ld20_v01s1:739929..740747(-) | Ld20_v01s1 | Leishmania donovani BPK282A1 | 183 | OG6_101553 | 2 | 273 | 819 | 30561 | 8.19 | 0 | NN: MCMCSCLSPHAAASLLHRLASGS, HMM: MCMCSCLSPHAAASLLHRLASGSAV | NN Sum: 0, NN D: .35, HMM Prob: .82 | | | GO:0016787 | hydrolase activity | GO:0008152 | metabolic process | GO:0097014;GO:0005737;GO:0005654 | ciliary plasm;cytoplasm;nucleoplasm | | | | | | 3.5.1.14 (N-acyl-aliphatic-L-amino acid amidohydrolase) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_201740.1ORamidohydrolase, putative (fragment)ANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_201740.1 OR amidohydrolase, putative (fragment) AND Leishmania donovani BPK282A1 |
|
LdBPK_210160.1 | LdBPK_210160.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 4881 | LdBPK_210160.1 | cysteine peptidase, Clan CA, family C2, putative | cysteine peptidase, Clan CA, family C2, putative | | E9BF01,E9BF02 | 21 | Ld21_v01s1:28,980..33,860(+) | Ld21_v01s1:28980..33860(+) | Ld21_v01s1 | Leishmania donovani BPK282A1 | 54 | OG6_148289 | 0 | 1626 | 4881 | 180160 | 6.41 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0005930 | axoneme | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_210160.1ORcysteine peptidase, Clan CA, family C2, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_210160.1 OR cysteine peptidase, Clan CA, family C2, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_210400.1 | LdBPK_210400.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1404 | LdBPK_210400.1 | mitochondrial processing peptidase alpha subunit, putative | mitochondrial processing peptidase alpha subunit, putative | | E9BF25 | 21 | Ld21_v01s1:108,373..109,776(+) | Ld21_v01s1:108373..109776(+) | Ld21_v01s1 | Leishmania donovani BPK282A1 | 44 | OG6_155541 | 0 | 467 | 1404 | 51266 | 7.47 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_210400.1ORmitochondrial processing peptidase alpha subunit, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_210400.1 OR mitochondrial processing peptidase alpha subunit, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_210460.1 | LdBPK_210460.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2166 | LdBPK_210460.1 | Peptidase C19, ubiquitin carboxyl-terminal hydrolase, putative | Peptidase C19, ubiquitin carboxyl-terminal hydrolase, putative | | E9BF31 | 21 | Ld21_v01s1:121,934..124,099(+) | Ld21_v01s1:121934..124099(+) | Ld21_v01s1 | Leishmania donovani BPK282A1 | 27 | OG6_101733 | 0 | 721 | 2166 | 78344 | 8.11 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | GO:0004197;GO:0004221 | cysteine-type endopeptidase activity;obsolete ubiquitin thiolesterase activity | GO:0006511 | ubiquitin-dependent protein catabolic process | 3.1.2.15 (Deleted entry) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_210460.1ORPeptidase C19, ubiquitin carboxyl-terminal hydrolase, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_210460.1 OR Peptidase C19, ubiquitin carboxyl-terminal hydrolase, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_210960.1 | LdBPK_210960.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1398 | LdBPK_210960.1 | metallo-peptidase, Clan MG, Family M24 | metallo-peptidase, Clan MG, Family M24 | | E9BF82 | 21 | Ld21_v01s1:307,032..308,429(+) | Ld21_v01s1:307032..308429(+) | Ld21_v01s1 | Leishmania donovani BPK282A1 | 52 | OG6_100815 | 0 | 465 | 1398 | 51301 | 7.14 | 0 | | | | | GO:0004177;GO:0008235 | aminopeptidase activity;metalloexopeptidase activity | GO:0006508 | proteolysis | GO:0005737 | cytoplasm | GO:0008237 | metallopeptidase activity | GO:0006508 | proteolysis | | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_210960.1ORmetallo-peptidase, Clan MG, Family M24ANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_210960.1 OR metallo-peptidase, Clan MG, Family M24 AND Leishmania donovani BPK282A1 |
|
LdBPK_212070.1 | LdBPK_212070.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 696 | LdBPK_212070.1 | proteasome alpha 2 subunit, putative | proteasome alpha 2 subunit, putative | | E9BFJ3 | 21 | Ld21_v01s1:729,656..730,351(-) | Ld21_v01s1:729656..730351(-) | Ld21_v01s1 | Leishmania donovani BPK282A1 | 49 | OG6_101969 | 0 | 231 | 696 | 25073 | 5.33 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | GO:0005737 | cytoplasm | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_212070.1ORproteasome alpha 2 subunit, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_212070.1 OR proteasome alpha 2 subunit, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_212200.1 | LdBPK_212200.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 735 | LdBPK_212200.1 | proteasome subunit alpha type-5, putative | proteasome subunit alpha type-5, putative | | E9BFK5 | 21 | Ld21_v01s1:753,128..753,862(+) | Ld21_v01s1:753128..753862(+) | Ld21_v01s1 | Leishmania donovani BPK282A1 | 50 | OG6_101621 | 0 | 244 | 735 | 26815 | 4.91 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | GO:0005829;GO:0005634;GO:0005839 | cytosol;nucleus;proteasome core complex | | | GO:0006511 | ubiquitin-dependent protein catabolic process | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_212200.1ORproteasome subunit alpha type-5, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_212200.1 OR proteasome subunit alpha type-5, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_220440.1 | LdBPK_220440.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1314 | LdBPK_220440.1 | proteasome regulatory ATPase subunit 1, putative | proteasome regulatory ATPase subunit 1, putative | | E9BFR3 | 22 | Ld22_v01s1:203,788..205,101(-) | Ld22_v01s1:203788..205101(-) | Ld22_v01s1 | Leishmania donovani BPK282A1 | 50 | OG6_101899 | 0 | 437 | 1314 | 49034 | 6.22 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | GO:0005737;GO:0005654 | cytoplasm;nucleoplasm | | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_220440.1ORproteasome regulatory ATPase subunit 1, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_220440.1 OR proteasome regulatory ATPase subunit 1, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_220490.1 | LdBPK_220490.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1335 | LdBPK_220490.1 | proteasome regulatory ATPase subunit 5, putative | proteasome regulatory ATPase subunit 5, putative | | E9BFR8 | 22 | Ld22_v01s1:218,020..219,354(-) | Ld22_v01s1:218020..219354(-) | Ld22_v01s1 | Leishmania donovani BPK282A1 | 53 | OG6_101915 | 0 | 444 | 1335 | 49500 | 5.64 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | | | | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_220490.1ORproteasome regulatory ATPase subunit 5, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_220490.1 OR proteasome regulatory ATPase subunit 5, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_230500.1 | LdBPK_230500.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 978 | LdBPK_230500.1 | trypanothione synthetase, putative | trypanothione synthetase, putative | | E9BG70 | 23 | Ld23_v01s1:177,679..178,656(+) | Ld23_v01s1:177679..178656(+) | Ld23_v01s1 | Leishmania donovani BPK282A1 | 24 | OG6_173685 | 0 | 325 | 978 | 36167 | 9.12 | 0 | | | | | | | | | | | | | | | | 6.3.1.9 (Trypanothione synthase) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_230500.1ORtrypanothione synthetase, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_230500.1 OR trypanothione synthetase, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_231120.1 | LdBPK_231120.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1698 | LdBPK_231120.1 | cytosolic leucyl aminopeptidase | cytosolic leucyl aminopeptidase | | E9BGD0 | 23 | Ld23_v01s1:465,232..466,929(-) | Ld23_v01s1:465232..466929(-) | Ld23_v01s1 | Leishmania donovani BPK282A1 | 53 | OG6_100682 | 0 | 565 | 1698 | 59996 | 9.60 | 0 | NN: MLRRVLSRGPLPRSLSV, HMM: MLRRVLSRGPLPRSLSVGPAAKLTANRGKLAKSRGVHVHFLTTAECAAAA | NN Sum: 0, NN D: .32, HMM Prob: .66 | GO:0005622 | intracellular | GO:0004177 | aminopeptidase activity | GO:0006508 | proteolysis | GO:0030863 | cortical cytoskeleton | | | | | | 3.4.11.1 (Leucyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_231120.1ORcytosolic leucyl aminopeptidaseANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_231120.1 OR cytosolic leucyl aminopeptidase AND Leishmania donovani BPK282A1 |
|
LdBPK_240420.1 | LdBPK_240420.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 924 | LdBPK_240420.1 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | | E9BGQ4 | 24 | Ld24_v01s1:143,601..144,524(+) | Ld24_v01s1:143601..144524(+) | Ld24_v01s1 | Leishmania donovani BPK282A1 | 53 | OG6_102753 | 0 | 307 | 924 | 34353 | 4.79 | 0 | | | GO:0005622 | intracellular | GO:0004843 | thiol-dependent ubiquitin-specific protease activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_240420.1ORubiquitin carboxyl-terminal hydrolase, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_240420.1 OR ubiquitin carboxyl-terminal hydrolase, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_240630.1 | LdBPK_240630.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2433 | LdBPK_240630.1 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | | E9BGS5 | 24 | Ld24_v01s1:228,422..230,854(+) | Ld24_v01s1:228422..230854(+) | Ld24_v01s1 | Leishmania donovani BPK282A1 | 50 | OG6_101457 | 0 | 810 | 2433 | 89932 | 8.88 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | GO:0005634 | nucleus | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_240630.1ORubiquitin carboxyl-terminal hydrolase, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_240630.1 OR ubiquitin carboxyl-terminal hydrolase, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_240660.1 | LdBPK_240660.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2904 | LdBPK_240660.1 | PPPDE putative peptidase domain containing protein, putative | PPPDE putative peptidase domain containing protein, putative | | E9BGS8 | 24 | Ld24_v01s1:238,291..241,194(+) | Ld24_v01s1:238291..241194(+) | Ld24_v01s1 | Leishmania donovani BPK282A1 | 124 | OG6_101256 | 1 | 967 | 2904 | 102153 | 6.46 | 0 | | | | | | | | | GO:0005737 | cytoplasm | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_240660.1ORPPPDE putative peptidase domain containing protein, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_240660.1 OR PPPDE putative peptidase domain containing protein, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_250190.1 | LdBPK_250190.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 702 | LdBPK_250190.1 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | | E9BHC3 | 25 | Ld25_v01s1:51,644..52,345(-) | Ld25_v01s1:51644..52345(-) | Ld25_v01s1 | Leishmania donovani BPK282A1 | 49 | OG6_101218 | 0 | 233 | 702 | 25153 | 4.69 | 0 | | | GO:0005622 | intracellular | GO:0004843 | thiol-dependent ubiquitin-specific protease activity | GO:0006511 | ubiquitin-dependent protein catabolic process | GO:0097014;GO:0005737;GO:0031981 | ciliary plasm;cytoplasm;nuclear lumen | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_250190.1ORubiquitin carboxyl-terminal hydrolase, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_250190.1 OR ubiquitin carboxyl-terminal hydrolase, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_251540.1 | LdBPK_251540.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2121 | LdBPK_251540.1 | calpain family cysteine protease-like protein | calpain family cysteine protease-like protein | | E9BHQ8 | 25 | Ld25_v01s1:578,682..580,802(-) | Ld25_v01s1:578682..580802(-) | Ld25_v01s1 | Leishmania donovani BPK282A1 | 29 | OG6_163536 | 0 | 706 | 2121 | 80467 | 9.69 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_251540.1ORcalpain family cysteine protease-like proteinANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_251540.1 OR calpain family cysteine protease-like protein AND Leishmania donovani BPK282A1 |
|
LdBPK_251870.1 | LdBPK_251870.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 903 | LdBPK_251870.1 | hypothetical protein, conserved | hypothetical protein, conserved | | E9BHU1 | 25 | Ld25_v01s1:695,959..696,861(-) | Ld25_v01s1:695959..696861(-) | Ld25_v01s1 | Leishmania donovani BPK282A1 | 98 | OG6_158192 | 0 | 300 | 903 | 34333 | 6.51 | 1 | NN: MNLVRVALLCACTTLLCLGA, HMM: MNLVRVALLCACTTLLCLGA | NN Sum: 3, NN D: .73, HMM Prob: .94 | | | | | | | GO:0005737 | cytoplasm | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_251870.1ORhypothetical protein, conservedANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_251870.1 OR hypothetical protein, conserved AND Leishmania donovani BPK282A1 |
|
LdBPK_252430.1 | LdBPK_252430.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 438 | LdBPK_252430.1 | Microsomal signal peptidase 12 kDa subunit (SPC12), putative | Microsomal signal peptidase 12 kDa subunit (SPC12), putative | | E9BHZ7 | 25 | Ld25_v01s1:844,863..845,300(+) | Ld25_v01s1:844863..845300(+) | Ld25_v01s1 | Leishmania donovani BPK282A1 | 43 | OG6_147500 | 0 | 145 | 438 | 15706 | 7.85 | 1 | | | GO:0016021;GO:0005787 | integral component of membrane;signal peptidase complex | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | GO:0005783 | endoplasmic reticulum | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_252430.1ORMicrosomal signal peptidase 12 kDa subunit (SPC12), putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_252430.1 OR Microsomal signal peptidase 12 kDa subunit (SPC12), putative AND Leishmania donovani BPK282A1 |
|
LdBPK_252500.1 | LdBPK_252500.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2160 | LdBPK_252500.1 | glutathionylspermidine synthase, putative | glutathionylspermidine synthase, putative | | E9BI04 | 25 | Ld25_v01s1:866,483..868,642(+) | Ld25_v01s1:866483..868642(+) | Ld25_v01s1 | Leishmania donovani BPK282A1 | 49 | OG6_200119 | 0 | 719 | 2160 | 80718 | 5.65 | 0 | | | | | | | | | | | | | | | | 6.3.1.8 (Glutathionylspermidine synthase) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_252500.1ORglutathionylspermidine synthase, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_252500.1 OR glutathionylspermidine synthase, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_252540.1 | LdBPK_252540.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 270 | LdBPK_252540.1 | Xaa-Pro aminopeptidase, putative (fragment) | Xaa-Pro aminopeptidase, putative (fragment) | | E9BI08 | 25 | Ld25_v01s1:879,644..879,913(+) | Ld25_v01s1:879644..879913(+) | Ld25_v01s1 | Leishmania donovani BPK282A1 | 61 | OG6_100896 | 0 | 90 | 270 | 10287 | 5.13 | 0 | | | | | | | | | | | | | | | 3.4.11.9 (Xaa-Pro aminopeptidase) | 3.4.11.9 (Xaa-Pro aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_252540.1ORXaa-Pro aminopeptidase, putative (fragment)ANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_252540.1 OR Xaa-Pro aminopeptidase, putative (fragment) AND Leishmania donovani BPK282A1 |
|
LdBPK_260290.1 | LdBPK_260290.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2652 | LdBPK_260290.1 | aminopeptidase-like protein | aminopeptidase-like protein | | E9BI42 | 26 | Ld26_v01s1:74,319..76,970(-) | Ld26_v01s1:74319..76970(-) | Ld26_v01s1 | Leishmania donovani BPK282A1 | 59 | OG6_100948 | 0 | 883 | 2652 | 98057 | 5.71 | 0 | | | | | GO:0008237;GO:0008270 | metallopeptidase activity;zinc ion binding | | | | | | | | | | 3.4.11.- (Aminopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_260290.1ORaminopeptidase-like proteinANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_260290.1 OR aminopeptidase-like protein AND Leishmania donovani BPK282A1 |
|
LdBPK_261550.1 | LdBPK_261550.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2058 | LdBPK_261550.1 | thimet oligopeptidase, putative | thimet oligopeptidase, putative | | E9BIG7 | 26 | Ld26_v01s1:571,112..573,169(+) | Ld26_v01s1:571112..573169(+) | Ld26_v01s1 | Leishmania donovani BPK282A1 | 118 | OG6_100561 | 2 | 685 | 2058 | 77185 | 6.06 | 0 | | | | | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.24.15 (Thimet oligopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_261550.1ORthimet oligopeptidase, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_261550.1 OR thimet oligopeptidase, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_262070.1 | LdBPK_262070.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 4068 | LdBPK_262070.1 | SUMO1/Ulp2, putative | SUMO1/Ulp2, putative | | E9BIL8 | 26 | Ld26_v01s1:779,941..784,008(+) | Ld26_v01s1:779941..784008(+) | Ld26_v01s1 | Leishmania donovani BPK282A1 | 51 | OG6_101235 | 0 | 1355 | 4068 | 143547 | 8.81 | 0 | NN: MNSQPSTRRHRSAEGVPPNSSSLLAFATTADAA, HMM: MNSQPSTRRHRSAEGVPPNSSSLLAFATTADAA | NN Sum: 0, NN D: .12, HMM Prob: .77 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | GO:0005634 | nucleus | | | | | | 3.4.22.68 (Ulp1 peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_262070.1ORSUMO1/Ulp2, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_262070.1 OR SUMO1/Ulp2, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_262440.1 | LdBPK_262440.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1935 | LdBPK_262440.1 | hypothetical protein, conserved | hypothetical protein, conserved | | E9BIQ5 | 26 | Ld26_v01s1:951,654..953,588(+) | Ld26_v01s1:951654..953588(+) | Ld26_v01s1 | Leishmania donovani BPK282A1 | 52 | OG6_139357 | 0 | 644 | 1935 | 71244 | 7.34 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_262440.1ORhypothetical protein, conservedANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_262440.1 OR hypothetical protein, conserved AND Leishmania donovani BPK282A1 |
|
LdBPK_262720.1 | LdBPK_262720.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 675 | LdBPK_262720.1 | CAAX prenyl protease 2, putative | CAAX prenyl protease 2, putative | | E9BIT3 | 26 | Ld26_v01s1:1,052,550..1,053,224(+) | Ld26_v01s1:1052550..1053224(+) | Ld26_v01s1 | Leishmania donovani BPK282A1 | 53 | OG6_103186 | 0 | 224 | 675 | 24861 | 8.42 | 2 | HMM: MCCLVSGTYLAFGTAPPRTVQRQSTLLRPVIRSSVSTLLLFAGPIAEAC, NN: MCCLVSGTYLAFGTAPPRTVQRQSTLLRPVIRSSVSTLLLFAGPIAEAC | NN Sum: 0, NN D: .25, HMM Prob: .85 | GO:0016020 | membrane | | | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_262720.1ORCAAX prenyl protease 2, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_262720.1 OR CAAX prenyl protease 2, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_270040.1 | LdBPK_270040.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1284 | LdBPK_270040.1 | metallo- peptidase, Clan M- Family M48 | metallo- peptidase, Clan M- Family M48 | | E9BIT9 | 27 | Ld27_v01s1:10,904..12,187(-) | Ld27_v01s1:10904..12187(-) | Ld27_v01s1 | Leishmania donovani BPK282A1 | 47 | OG6_101632 | 0 | 427 | 1284 | 49104 | 8.77 | 3 | | | | | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | | | GO:0004222 | metalloendopeptidase activity | GO:0071586;GO:0006508 | CAAX-box protein processing;proteolysis | 3.4.24.84 (Ste24 endopeptidase) | 3.4.24.84 (Ste24 endopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_270040.1ORmetallo- peptidase, Clan M- Family M48ANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_270040.1 OR metallo- peptidase, Clan M- Family M48 AND Leishmania donovani BPK282A1 |
|
LdBPK_270190.1 | LdBPK_270190.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 717 | LdBPK_270190.1 | proteasome alpha 7 subunit, putative | proteasome alpha 7 subunit, putative | | E9BIV4 | 27 | Ld27_v01s1:44,985..45,701(-) | Ld27_v01s1:44985..45701(-) | Ld27_v01s1 | Leishmania donovani BPK282A1 | 52 | OG6_102011 | 0 | 238 | 717 | 25609 | 6.09 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | GO:0005737;GO:0005654 | cytoplasm;nucleoplasm | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_270190.1ORproteasome alpha 7 subunit, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_270190.1 OR proteasome alpha 7 subunit, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_270470.1 | LdBPK_270470.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1863 | LdBPK_270470.1 | Vasohibin, putative | Vasohibin, putative | | E9BIY1 | 27 | Ld27_v01s1:129,747..131,609(+) | Ld27_v01s1:129747..131609(+) | Ld27_v01s1 | Leishmania donovani BPK282A1 | 48 | OG6_105471 | 0 | 620 | 1863 | 67607 | 8.84 | 0 | | | GO:0005737 | cytoplasm | | | GO:0045765 | regulation of angiogenesis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_270470.1ORVasohibin, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_270470.1 OR Vasohibin, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_270500.1 | LdBPK_270500.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 204 | LdBPK_270500.1 | calpain-like cysteine peptidase, putative (fragment) | calpain-like cysteine peptidase, putative (fragment) | | E9BIY4 | 27 | Ld27_v01s1:145,188..145,391(+) | Ld27_v01s1:145188..145391(+) | Ld27_v01s1 | Leishmania donovani BPK282A1 | 315 | OG6_115879 | 2 | 68 | 204 | 7671 | 4.23 | 0 | | | | | | | | | GO:0005737 | cytoplasm | | | | | | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_270500.1ORcalpain-like cysteine peptidase, putative (fragment)ANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_270500.1 OR calpain-like cysteine peptidase, putative (fragment) AND Leishmania donovani BPK282A1 |
|
LdBPK_270510.1 | LdBPK_270510.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 16653 | LdBPK_270510.1 | calpain-like cysteine peptidase, putative | calpain-like cysteine peptidase, putative | | E9BIY5 | 27 | Ld27_v01s1:172,455..189,107(+) | Ld27_v01s1:172455..189107(+) | Ld27_v01s1 | Leishmania donovani BPK282A1 | 315 | OG6_115879 | 2 | 5550 | 16653 | 630957 | 4.90 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0005737 | cytoplasm | | | | | | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_270510.1ORcalpain-like cysteine peptidase, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_270510.1 OR calpain-like cysteine peptidase, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_271170.1 | LdBPK_271170.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1728 | LdBPK_271170.1 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | | E9BJ49 | 27 | Ld27_v01s1:470,064..471,791(+) | Ld27_v01s1:470064..471791(+) | Ld27_v01s1 | Leishmania donovani BPK282A1 | 57 | OG6_101021 | 0 | 575 | 1728 | 65186 | 7.58 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | GO:0097014;GO:0005737 | ciliary plasm;cytoplasm | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_271170.1ORubiquitin carboxyl-terminal hydrolase, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_271170.1 OR ubiquitin carboxyl-terminal hydrolase, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_271770.1 | LdBPK_271770.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1959 | LdBPK_271770.1 | trypanothione synthetase | trypanothione synthetase | | E9BJA7 | 27 | Ld27_v01s1:736,943..738,901(-) | Ld27_v01s1:736943..738901(-) | Ld27_v01s1 | Leishmania donovani BPK282A1 | 53 | OG6_111169 | 0 | 652 | 1959 | 74243 | 5.60 | 0 | | | | | | | | | GO:0005737 | cytoplasm | | | | | 3.5.1.78 (Glutathionylspermidine amidase);6.3.1.9 (Trypanothione synthase) | 3.5.1.78 (Glutathionylspermidine amidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_271770.1ORtrypanothione synthetaseANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_271770.1 OR trypanothione synthetase AND Leishmania donovani BPK282A1 |
|
LdBPK_272520.1 | LdBPK_272520.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 4566 | LdBPK_272520.1 | cysteine peptidase, Clan CA, family C2, putative (fragment) | cysteine peptidase, Clan CA, family C2, putative (fragment) | | E9BIY6 | 27 | Ld27_v01s1:200,354..204,919(+) | Ld27_v01s1:200354..204919(+) | Ld27_v01s1 | Leishmania donovani BPK282A1 | 315 | OG6_115879 | 2 | 1522 | 4566 | 172376 | 4.99 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0005737 | cytoplasm | | | | | | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_272520.1ORcysteine peptidase, Clan CA, family C2, putative (fragment)ANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_272520.1 OR cysteine peptidase, Clan CA, family C2, putative (fragment) AND Leishmania donovani BPK282A1 |
|
LdBPK_280110.1 | LdBPK_280110.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 618 | LdBPK_280110.1 | proteasome beta 3 subunit, putative | proteasome beta 3 subunit, putative | | E9BK51 | 28 | Ld28_v01s1:31,407..32,024(+) | Ld28_v01s1:31407..32024(+) | Ld28_v01s1 | Leishmania donovani BPK282A1 | 52 | OG6_101970 | 0 | 205 | 618 | 22462 | 5.09 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | GO:0005737;GO:0005654 | cytoplasm;nucleoplasm | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_280110.1ORproteasome beta 3 subunit, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_280110.1 OR proteasome beta 3 subunit, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_280600.1 | LdBPK_280600.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1701 | LdBPK_280600.1 | major surface protease gp63, putative | major surface protease gp63, putative | | E9BK98 | 28 | Ld28_v01s1:209,904..211,604(-) | Ld28_v01s1:209904..211604(-) | Ld28_v01s1 | Leishmania donovani BPK282A1 | 622 | OG6_101754 | 1 | 566 | 1701 | 60626 | 7.51 | 1 | HMM: MRRTLLGIAVTFALVCCVVGAGAAQ, NN: MRRTLLGIAVTFALVCCVVGAGAA | NN Sum: 4, NN D: .84, HMM Prob: 1 | GO:0016020 | membrane | GO:0004222 | metalloendopeptidase activity | GO:0007155;GO:0006508 | cell adhesion;proteolysis | | | | | | | | 3.4.24.36 (Leishmanolysin) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_280600.1ORmajor surface protease gp63, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_280600.1 OR major surface protease gp63, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_282080.1 | LdBPK_282080.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2061 | LdBPK_282080.1 | X-pro, dipeptidyl-peptidase,serine peptidase, Clan SC, family S15, putative | X-pro, dipeptidyl-peptidase,serine peptidase, Clan SC, family S15, putative | | E9BJS9 | 28 | Ld28_v01s1:769,594..771,654(-) | Ld28_v01s1:769594..771654(-) | Ld28_v01s1 | Leishmania donovani BPK282A1 | 53 | OG6_111836 | 0 | 686 | 2061 | 76281 | 5.85 | 0 | | | | | GO:0008239;GO:0016787 | dipeptidyl-peptidase activity;hydrolase activity | | | | | | | | | | 3.1.1.43 (Alpha-amino-acid esterase) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_282080.1ORX-pro, dipeptidyl-peptidase,serine peptidase, Clan SC, family S15, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_282080.1 OR X-pro, dipeptidyl-peptidase,serine peptidase, Clan SC, family S15, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_283020.1 | LdBPK_283020.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1497 | LdBPK_283020.1 | beta-lactamase, putative | beta-lactamase, putative | | E9BK20 | 28 | Ld28_v01s1:1,096,369..1,097,865(-) | Ld28_v01s1:1096369..1097865(-) | Ld28_v01s1 | Leishmania donovani BPK282A1 | 50 | OG6_147553 | 0 | 498 | 1497 | 55609 | 8.37 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_283020.1ORbeta-lactamase, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_283020.1 OR beta-lactamase, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_290020.1 | LdBPK_290020.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3138 | LdBPK_290020.1 | transcription factor-like protein | transcription factor-like protein | | E9BKE9 | 29 | Ld29_v01s1:8,149..11,286(-) | Ld29_v01s1:8149..11286(-) | Ld29_v01s1 | Leishmania donovani BPK282A1 | 53 | OG6_102309 | 0 | 1045 | 3138 | 114822 | 4.96 | 0 | NN: MQPSANHTISASRLSAVLAQWRAAAAR, HMM: MQPSANHTISASRLSAVLAQWRAAAAR | NN Sum: 1, NN D: .33, HMM Prob: .75 | | | | | | | GO:0005634 | nucleus | | | | | | 1.1.1.27 (L-lactate dehydrogenase) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_290020.1ORtranscription factor-like proteinANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_290020.1 OR transcription factor-like protein AND Leishmania donovani BPK282A1 |
|
LdBPK_290860.1 | LdBPK_290860.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1023 | LdBPK_290860.1 | cysteine peptidase C (CPC) | cysteine peptidase C (CPC) | | E9BKN2 | 29 | Ld29_v01s1:311,269..312,291(-) | Ld29_v01s1:311269..312291(-) | Ld29_v01s1 | Leishmania donovani BPK282A1 | 79 | OG6_101151 | 0 | 340 | 1023 | 37018 | 5.03 | 1 | NN: MALRAKSALCLVAVFAVLLATTVSGLYAK, HMM: MALRAKSALCLVAVFAVLLATTVSGLYAK | NN Sum: 4, NN D: .84, HMM Prob: 1 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.1 (Cathepsin B) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_290860.1ORcysteine peptidase C (CPC)ANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_290860.1 OR cysteine peptidase C (CPC) AND Leishmania donovani BPK282A1 |
|
LdBPK_290990.1 | LdBPK_290990.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 933 | LdBPK_290990.1 | signal peptide peptidase, putative | signal peptide peptidase, putative | | E9BKP5 | 29 | Ld29_v01s1:358,424..359,356(+) | Ld29_v01s1:358424..359356(+) | Ld29_v01s1 | Leishmania donovani BPK282A1 | 49 | OG6_102328 | 0 | 310 | 933 | 34061 | 5.09 | 6 | | | GO:0016021 | integral component of membrane | GO:0004190 | aspartic-type endopeptidase activity | | | | | | | | | | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_290990.1ORsignal peptide peptidase, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_290990.1 OR signal peptide peptidase, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_291360.1 | LdBPK_291360.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2604 | LdBPK_291360.1 | ATP-dependent Clp protease subunit, heat shock protein 100 (HSP100), putative | ATP-dependent Clp protease subunit, heat shock protein 100 (HSP100), putative | | E9BKT2 | 29 | Ld29_v01s1:519,122..521,725(+) | Ld29_v01s1:519122..521725(+) | Ld29_v01s1 | Leishmania donovani BPK282A1 | 141 | OG6_100223 | 1 | 867 | 2604 | 96956 | 7.20 | 0 | | | | | GO:0005524 | ATP binding | GO:0019538 | protein metabolic process | | | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_291360.1ORATP-dependent Clp protease subunit, heat shock protein 100 (HSP100), putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_291360.1 OR ATP-dependent Clp protease subunit, heat shock protein 100 (HSP100), putative AND Leishmania donovani BPK282A1 |
|
LdBPK_291680.1 | LdBPK_291680.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1206 | LdBPK_291680.1 | glutamamyl carboxypeptidase, putative | glutamamyl carboxypeptidase, putative | | E9BKW6 | 29 | Ld29_v01s1:745,996..747,201(-) | Ld29_v01s1:745996..747201(-) | Ld29_v01s1 | Leishmania donovani BPK282A1 | 34 | OG6_152783 | 0 | 401 | 1206 | 44053 | 5.69 | 0 | | | GO:0005737 | cytoplasm | GO:0008777;GO:0016787 | acetylornithine deacetylase activity;hydrolase activity | GO:0006526;GO:0008152 | arginine biosynthetic process;metabolic process | | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_291680.1ORglutamamyl carboxypeptidase, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_291680.1 OR glutamamyl carboxypeptidase, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_292350.1 | LdBPK_292350.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2607 | LdBPK_292350.1 | Aminopeptidase M1, putative | Aminopeptidase M1, putative | | E9BL32 | 29 | Ld29_v01s1:1,013,704..1,016,310(-) | Ld29_v01s1:1013704..1016310(-) | Ld29_v01s1 | Leishmania donovani BPK282A1 | 60 | OG6_137617 | 0 | 868 | 2607 | 96190 | 5.97 | 0 | | | | | GO:0008237;GO:0008270 | metallopeptidase activity;zinc ion binding | | | | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_292350.1ORAminopeptidase M1, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_292350.1 OR Aminopeptidase M1, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_292410.1 | LdBPK_292410.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2247 | LdBPK_292410.1 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | | E9BL38 | 29 | Ld29_v01s1:1,046,009..1,048,255(-) | Ld29_v01s1:1046009..1048255(-) | Ld29_v01s1 | Leishmania donovani BPK282A1 | 53 | OG6_101380 | 0 | 748 | 2247 | 81665 | 5.27 | 0 | | | | | GO:0004843;GO:0036459;GO:0008270 | thiol-dependent ubiquitin-specific protease activity;thiol-dependent ubiquitinyl hydrolase activity;zinc ion binding | GO:0016579 | protein deubiquitination | GO:0005654 | nucleoplasm | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_292410.1ORubiquitin carboxyl-terminal hydrolase, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_292410.1 OR ubiquitin carboxyl-terminal hydrolase, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_292470.1 | LdBPK_292470.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1362 | LdBPK_292470.1 | aspartyl aminopeptidase, putative | aspartyl aminopeptidase, putative | | E9BL44 | 29 | Ld29_v01s1:1,060,792..1,062,153(+) | Ld29_v01s1:1060792..1062153(+) | Ld29_v01s1 | Leishmania donovani BPK282A1 | 50 | OG6_102047 | 0 | 453 | 1362 | 49478 | 6.55 | 0 | | | | | GO:0004177;GO:0008270 | aminopeptidase activity;zinc ion binding | GO:0006508 | proteolysis | GO:0005737;GO:0031514 | cytoplasm;motile cilium | | | | | 3.4.11.21 (Aspartyl aminopeptidase) | 3.4.11.21 (Aspartyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_292470.1ORaspartyl aminopeptidase, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_292470.1 OR aspartyl aminopeptidase, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_292880.1 | LdBPK_292880.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 615 | LdBPK_292880.1 | hypothetical protein, conserved | hypothetical protein, conserved | | E9BL85 | 29 | Ld29_v01s1:1,205,493..1,206,107(+) | Ld29_v01s1:1205493..1206107(+) | Ld29_v01s1 | Leishmania donovani BPK282A1 | 47 | OG6_158140 | 0 | 204 | 615 | 21919 | 6.79 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_292880.1ORhypothetical protein, conservedANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_292880.1 OR hypothetical protein, conserved AND Leishmania donovani BPK282A1 |
|
LdBPK_300050.1 | LdBPK_300050.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2289 | LdBPK_300050.1 | MATH domain containing protein, putative | MATH domain containing protein, putative | | E9BLA0 | 30 | Ld30_v01s1:13,227..15,515(-) | Ld30_v01s1:13227..15515(-) | Ld30_v01s1 | Leishmania donovani BPK282A1 | 52 | OG6_134892 | 0 | 762 | 2289 | 86953 | 5.67 | 0 | | | | | GO:0005515 | protein binding | | | GO:0005737 | cytoplasm | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_300050.1ORMATH domain containing protein, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_300050.1 OR MATH domain containing protein, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_300250.1 | LdBPK_300250.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3399 | LdBPK_300250.1 | ubiquitin hydrolase, putative | ubiquitin hydrolase, putative | | E9BLC0 | 30 | Ld30_v01s1:72,687..76,085(-) | Ld30_v01s1:72687..76085(-) | Ld30_v01s1 | Leishmania donovani BPK282A1 | 52 | OG6_102772 | 0 | 1132 | 3399 | 126254 | 5.10 | 0 | | | | | GO:0005515 | protein binding | | | | | | | GO:0000289;GO:0010608 | nuclear-transcribed mRNA poly(A) tail shortening;posttranscriptional regulation of gene expression | | 3.1.13.4 (Poly(A)-specific ribonuclease) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_300250.1ORubiquitin hydrolase, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_300250.1 OR ubiquitin hydrolase, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_300270.1 | LdBPK_300270.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1185 | LdBPK_300270.1 | AUT2/APG4/ATG4 cysteine peptidase, putative | AUT2/APG4/ATG4 cysteine peptidase, putative | | E9BLC2 | 30 | Ld30_v01s1:81,454..82,638(-) | Ld30_v01s1:81454..82638(-) | Ld30_v01s1 | Leishmania donovani BPK282A1 | 97 | OG6_100501 | 1 | 394 | 1185 | 44064 | 6.38 | 0 | | | | | | | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_300270.1ORAUT2/APG4/ATG4 cysteine peptidase, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_300270.1 OR AUT2/APG4/ATG4 cysteine peptidase, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_300400.1 | LdBPK_300400.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1491 | LdBPK_300400.1 | Alpha/beta hydrolase family, putative | Alpha/beta hydrolase family, putative | | E9BLD4 | 30 | Ld30_v01s1:134,671..136,161(-) | Ld30_v01s1:134671..136161(-) | Ld30_v01s1 | Leishmania donovani BPK282A1 | 48 | OG6_105308 | 0 | 496 | 1491 | 53180 | 6.50 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_300400.1ORAlpha/beta hydrolase family, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_300400.1 OR Alpha/beta hydrolase family, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_300800.1 | LdBPK_300800.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 591 | LdBPK_300800.1 | 4-methyl-5(beta-hydroxyethyl)-thiazole monophosphate synthesis protein, putative | 4-methyl-5(beta-hydroxyethyl)-thiazole monophosphate synthesis protein, putative | | E9BLH3 | 30 | Ld30_v01s1:237,803..238,393(+) | Ld30_v01s1:237803..238393(+) | Ld30_v01s1 | Leishmania donovani BPK282A1 | 48 | OG6_101257 | 0 | 196 | 591 | 20532 | 5.64 | 0 | | | | | | | | | GO:0097014;GO:0005737 | ciliary plasm;cytoplasm | | | | | | 2.7.1.50 (Hydroxyethylthiazole kinase) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_300800.1OR4-methyl-5(beta-hydroxyethyl)-thiazole monophosphate synthesis protein, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_300800.1 OR 4-methyl-5(beta-hydroxyethyl)-thiazole monophosphate synthesis protein, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_301440.1 | LdBPK_301440.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1326 | LdBPK_301440.1 | amidohydrolase, putative | amidohydrolase, putative | | E9BLN7 | 30 | Ld30_v01s1:480,327..481,652(+) | Ld30_v01s1:480327..481652(+) | Ld30_v01s1 | Leishmania donovani BPK282A1 | 183 | OG6_101553 | 2 | 441 | 1326 | 47859 | 6.85 | 0 | | | | | GO:0016787 | hydrolase activity | GO:0008152 | metabolic process | | | | | | | | 3.5.1.14 (N-acyl-aliphatic-L-amino acid amidohydrolase) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_301440.1ORamidohydrolase, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_301440.1 OR amidohydrolase, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_302040.1 | LdBPK_302040.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 4065 | LdBPK_302040.1 | calpain-like cysteine peptidase, putative | calpain-like cysteine peptidase, putative | | E9BLU7 | 30 | Ld30_v01s1:735,871..739,935(+) | Ld30_v01s1:735871..739935(+) | Ld30_v01s1 | Leishmania donovani BPK282A1 | 53 | OG6_146872 | 0 | 1354 | 4065 | 148544 | 6.89 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0005930 | axoneme | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_302040.1ORcalpain-like cysteine peptidase, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_302040.1 OR calpain-like cysteine peptidase, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_310110.1 | LdBPK_310110.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1095 | LdBPK_310110.1 | O-sialoglycoprotein endopeptidase, putative | O-sialoglycoprotein endopeptidase, putative | | E9BMD3 | 31 | Ld31_v01s1:26,587..27,681(-) | Ld31_v01s1:26587..27681(-) | Ld31_v01s1 | Leishmania donovani BPK282A1 | 55 | OG6_100288 | 0 | 364 | 1095 | 39771 | 7.45 | 0 | | | | | | | | | | | | | | | | 2.3.1.234 (N(6)-L-threonylcarbamoyladenine synthase) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_310110.1ORO-sialoglycoprotein endopeptidase, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_310110.1 OR O-sialoglycoprotein endopeptidase, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_310150.1 | LdBPK_310150.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1377 | LdBPK_310150.1 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | | E9BMD7 | 31 | Ld31_v01s1:35,661..37,037(-) | Ld31_v01s1:35661..37037(-) | Ld31_v01s1 | Leishmania donovani BPK282A1 | 58 | OG6_101892 | 0 | 458 | 1377 | 50850 | 6.80 | 0 | | | | | GO:0005515;GO:0036459 | protein binding;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | GO:0097014;GO:0005737;GO:0031981 | ciliary plasm;cytoplasm;nuclear lumen | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_310150.1ORubiquitin carboxyl-terminal hydrolase, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_310150.1 OR ubiquitin carboxyl-terminal hydrolase, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_310410.1 | LdBPK_310410.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2355 | LdBPK_310410.1 | Calpain-like protein 2 | Calpain-like protein 2 | | E9BMG5 | 31 | Ld31_v01s1:125,723..128,077(-) | Ld31_v01s1:125723..128077(-) | Ld31_v01s1 | Leishmania donovani BPK282A1 | 53 | OG6_156861 | 0 | 784 | 2355 | 89269 | 4.73 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0097014;GO:0005737 | ciliary plasm;cytoplasm | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_310410.1ORCalpain-like protein 2ANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_310410.1 OR Calpain-like protein 2 AND Leishmania donovani BPK282A1 |
|
LdBPK_310420.1 | LdBPK_310420.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2811 | LdBPK_310420.1 | calpain-like protein, putative | calpain-like protein, putative | | E9BMG6 | 31 | Ld31_v01s1:128,884..131,694(-) | Ld31_v01s1:128884..131694(-) | Ld31_v01s1 | Leishmania donovani BPK282A1 | 40 | OG6_200267 | 0 | 936 | 2811 | 103060 | 6.97 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_310420.1ORcalpain-like protein, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_310420.1 OR calpain-like protein, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_310430.1 | LdBPK_310430.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2265 | LdBPK_310430.1 | calpain-like cysteine peptidase, putative | calpain-like cysteine peptidase, putative | | E9BMG7 | 31 | Ld31_v01s1:135,569..137,833(-) | Ld31_v01s1:135569..137833(-) | Ld31_v01s1 | Leishmania donovani BPK282A1 | 24 | OG6_478567 | 0 | 754 | 2265 | 82690 | 6.23 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_310430.1ORcalpain-like cysteine peptidase, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_310430.1 OR calpain-like cysteine peptidase, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_310440.1 | LdBPK_310440.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2820 | LdBPK_310440.1 | calpain-like cysteine peptidase, putative | calpain-like cysteine peptidase, putative | | E9BMG8 | 31 | Ld31_v01s1:141,064..143,883(-) | Ld31_v01s1:141064..143883(-) | Ld31_v01s1 | Leishmania donovani BPK282A1 | 22 | OG6_200268 | 0 | 939 | 2820 | 101150 | 5.39 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_310440.1ORcalpain-like cysteine peptidase, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_310440.1 OR calpain-like cysteine peptidase, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_310450.1 | LdBPK_310450.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2175 | LdBPK_310450.1 | cytoskeleton-associated protein CAP5.5, putative | cytoskeleton-associated protein CAP5.5, putative | | E9BMG9 | 31 | Ld31_v01s1:146,567..148,741(-) | Ld31_v01s1:146567..148741(-) | Ld31_v01s1 | Leishmania donovani BPK282A1 | 57 | OG6_143858 | 0 | 724 | 2175 | 79998 | 5.39 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0036064;GO:0020016;GO:0030863;GO:0020038 | ciliary basal body;ciliary pocket;cortical cytoskeleton;subpellicular network | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_310450.1ORcytoskeleton-associated protein CAP5.5, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_310450.1 OR cytoskeleton-associated protein CAP5.5, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_310480.1 | LdBPK_310480.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2334 | LdBPK_310480.1 | calpain-like cysteine peptidase, putative | calpain-like cysteine peptidase, putative | | E9BMH1 | 31 | Ld31_v01s1:160,854..163,187(-) | Ld31_v01s1:160854..163187(-) | Ld31_v01s1 | Leishmania donovani BPK282A1 | 54 | OG6_104309 | 0 | 777 | 2334 | 87949 | 10.27 | 1 | HMM: MGTRRRRTIFCAASLLVVVVSLW, NN: MGTRRRRTIFCAASLLVVVVSLW | NN Sum: 3, NN D: .62, HMM Prob: .67 | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_310480.1ORcalpain-like cysteine peptidase, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_310480.1 OR calpain-like cysteine peptidase, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_311130.1 | LdBPK_311130.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1218 | LdBPK_311130.1 | amidohydrolase, putative | amidohydrolase, putative | | E9BMN8 | 31 | Ld31_v01s1:440,753..441,970(-) | Ld31_v01s1:440753..441970(-) | Ld31_v01s1 | Leishmania donovani BPK282A1 | 10 | OG6_103201 | 0 | 405 | 1218 | 44012 | 5.07 | 0 | | | | | GO:0016787 | hydrolase activity | GO:0008152 | metabolic process | | | | | | | | 3.5.1.14 (N-acyl-aliphatic-L-amino acid amidohydrolase) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_311130.1ORamidohydrolase, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_311130.1 OR amidohydrolase, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_311150.1 | LdBPK_311150.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 936 | LdBPK_311150.1 | monoglyceride lipase, putative | monoglyceride lipase, putative | | E9BMN9 | 31 | Ld31_v01s1:447,388..448,323(-) | Ld31_v01s1:447388..448323(-) | Ld31_v01s1 | Leishmania donovani BPK282A1 | 81 | OG6_100231 | 0 | 311 | 936 | 34653 | 7.79 | 0 | | | | | | | | | GO:0005737;GO:0020015 | cytoplasm;glycosome | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_311150.1ORmonoglyceride lipase, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_311150.1 OR monoglyceride lipase, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_311840.1 | LdBPK_311840.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 306 | LdBPK_311840.1 | acetylornithine deacetylase-like protein | acetylornithine deacetylase-like protein | | E9BMV7 | 31 | Ld31_v01s1:857,438..857,743(-) | Ld31_v01s1:857438..857743(-) | Ld31_v01s1 | Leishmania donovani BPK282A1 | 9 | OG6_479041 | 0 | 101 | 306 | 11059 | 6.47 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_311840.1ORacetylornithine deacetylase-like proteinANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_311840.1 OR acetylornithine deacetylase-like protein AND Leishmania donovani BPK282A1 |
|
LdBPK_312040.1 | LdBPK_312040.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1911 | LdBPK_312040.1 | GP63-like protein, leishmanolysin-like protein | GP63-like protein, leishmanolysin-like protein | | E9BMX6 | 31 | Ld31_v01s1:989,967..991,877(-) | Ld31_v01s1:989967..991877(-) | Ld31_v01s1 | Leishmania donovani BPK282A1 | 44 | OG6_101184 | 0 | 636 | 1911 | 67001 | 7.41 | 0 | HMM: MSHVPAVLWRMELWLNALFIYAAFTTVAA, NN: MSHVPAVLWRMELWLNALFIYAA | NN Sum: 4, NN D: .68, HMM Prob: .98 | GO:0016020 | membrane | GO:0004222 | metalloendopeptidase activity | GO:0007155;GO:0006508 | cell adhesion;proteolysis | | | | | | | | 3.4.24.36 (Leishmanolysin) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_312040.1ORGP63-like protein, leishmanolysin-like proteinANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_312040.1 OR GP63-like protein, leishmanolysin-like protein AND Leishmania donovani BPK282A1 |
|
LdBPK_312060.1 | LdBPK_312060.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1416 | LdBPK_312060.1 | succinyl-diaminopimelate desuccinylase-like protein | succinyl-diaminopimelate desuccinylase-like protein | | E9BMX8 | 31 | Ld31_v01s1:1,000,059..1,001,474(-) | Ld31_v01s1:1000059..1001474(-) | Ld31_v01s1 | Leishmania donovani BPK282A1 | 94 | OG6_100503 | 1 | 471 | 1416 | 50910 | 5.77 | 0 | | | | | GO:0016787 | hydrolase activity | GO:0008152 | metabolic process | | | | | | | | 3.4.13.20 (Beta-Ala-His dipeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_312060.1ORsuccinyl-diaminopimelate desuccinylase-like proteinANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_312060.1 OR succinyl-diaminopimelate desuccinylase-like protein AND Leishmania donovani BPK282A1 |
|
LdBPK_312330.1 | LdBPK_312330.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1866 | LdBPK_312330.1 | aminopeptidase, putative | aminopeptidase, putative | | E9BN04 | 31 | Ld31_v01s1:1,135,273..1,137,138(-) | Ld31_v01s1:1135273..1137138(-) | Ld31_v01s1 | Leishmania donovani BPK282A1 | 55 | OG6_158281 | 0 | 621 | 1866 | 66120 | 6.72 | 0 | | | | | GO:0008237;GO:0008270 | metallopeptidase activity;zinc ion binding | | | GO:0097014;GO:0005737 | ciliary plasm;cytoplasm | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_312330.1ORaminopeptidase, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_312330.1 OR aminopeptidase, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_313080.1 | LdBPK_313080.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 6507 | LdBPK_313080.1 | acetyl-CoA carboxylase | acetyl-CoA carboxylase | | E9BN78 | 31 | Ld31_v01s1:1,410,245..1,416,751(-) | Ld31_v01s1:1410245..1416751(-) | Ld31_v01s1 | Leishmania donovani BPK282A1 | 74 | OG6_101052 | 0 | 2168 | 6507 | 241114 | 6.40 | 0 | | | | | GO:0005524;GO:0003989;GO:0016874;GO:0046872 | ATP binding;acetyl-CoA carboxylase activity;ligase activity;metal ion binding | GO:0006633 | fatty acid biosynthetic process | GO:0009343;GO:0005737;GO:0020015 | biotin carboxylase complex;cytoplasm;glycosome | GO:0005524;GO:0003989;GO:0004075 | ATP binding;acetyl-CoA carboxylase activity;biotin carboxylase activity | GO:0030497;GO:0009372 | fatty acid elongation;quorum sensing | 6.4.1.2 (Acetyl-CoA carboxylase) | 6.4.1.2 (Acetyl-CoA carboxylase) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_313080.1ORacetyl-CoA carboxylaseANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_313080.1 OR acetyl-CoA carboxylase AND Leishmania donovani BPK282A1 |
|
LdBPK_313210.1 | LdBPK_313210.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3393 | LdBPK_313210.1 | phosphoglycan beta 1,3 galactosyltransferase 5 | phosphoglycan beta 1,3 galactosyltransferase 5 | | E9BN91 | 31 | Ld31_v01s1:1,462,472..1,465,864(-) | Ld31_v01s1:1462472..1465864(-) | Ld31_v01s1 | Leishmania donovani BPK282A1 | 59 | OG6_100422 | 0 | 1130 | 3393 | 123741 | 4.81 | 0 | NN: MATAVALPQPILSFTLCLSNPRSSCG, HMM: MATAVALPQPILSFTLCLSNPRSSCGS | NN Sum: 3, NN D: .4, HMM Prob: .96 | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | GO:0097014;GO:0005737 | ciliary plasm;cytoplasm | | | | | | 3.4.24.56 (Insulysin) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_313210.1ORphosphoglycan beta 1,3 galactosyltransferase 5ANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_313210.1 OR phosphoglycan beta 1,3 galactosyltransferase 5 AND Leishmania donovani BPK282A1 |
|
LdBPK_320400.1 | LdBPK_320400.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1080 | LdBPK_320400.1 | 19S proteasome non-atpase subunit 8 | 19S proteasome non-atpase subunit 8 | | E9BNE5 | 32 | Ld32_v01s1:139,294..140,373(-) | Ld32_v01s1:139294..140373(-) | Ld32_v01s1 | Leishmania donovani BPK282A1 | 52 | OG6_102054 | 0 | 359 | 1080 | 40143 | 5.18 | 0 | | | | | GO:0005515 | protein binding | | | GO:0005838 | proteasome regulatory particle | | | GO:0016049;GO:0006511 | cell growth;ubiquitin-dependent protein catabolic process | | 3.1.3.16 (Protein-serine/threonine phosphatase) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_320400.1OR19S proteasome non-atpase subunit 8ANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_320400.1 OR 19S proteasome non-atpase subunit 8 AND Leishmania donovani BPK282A1 |
|
LdBPK_321020.1 | LdBPK_321020.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 5667 | LdBPK_321020.1 | calpain-like cysteine peptidase, putative | calpain-like cysteine peptidase, putative | | E9BNK5 | 32 | Ld32_v01s1:369,604..375,270(+) | Ld32_v01s1:369604..375270(+) | Ld32_v01s1 | Leishmania donovani BPK282A1 | 52 | OG6_147050 | 0 | 1888 | 5667 | 199176 | 7.01 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_321020.1ORcalpain-like cysteine peptidase, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_321020.1 OR calpain-like cysteine peptidase, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_321310.1 | LdBPK_321310.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1617 | LdBPK_321310.1 | ubiquitin hydrolase, putative | ubiquitin hydrolase, putative | | E9BNN4 | 32 | Ld32_v01s1:490,542..492,158(+) | Ld32_v01s1:490542..492158(+) | Ld32_v01s1 | Leishmania donovani BPK282A1 | 47 | OG6_103260 | 0 | 538 | 1617 | 58766 | 9.11 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | GO:0005737 | cytoplasm | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_321310.1ORubiquitin hydrolase, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_321310.1 OR ubiquitin hydrolase, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_321370.1 | LdBPK_321370.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1149 | LdBPK_321370.1 | WLM domain containing protein, putative | WLM domain containing protein, putative | | E9BNP0 | 32 | Ld32_v01s1:515,293..516,441(+) | Ld32_v01s1:515293..516441(+) | Ld32_v01s1 | Leishmania donovani BPK282A1 | 26 | OG6_198984 | 0 | 382 | 1149 | 41261 | 6.92 | 0 | | | | | | | | | GO:0097014;GO:0005737;GO:0031981 | ciliary plasm;cytoplasm;nuclear lumen | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_321370.1ORWLM domain containing protein, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_321370.1 OR WLM domain containing protein, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_321390.1 | LdBPK_321390.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1893 | LdBPK_321390.1 | PPPDE putative peptidase domain containing protein, putative | PPPDE putative peptidase domain containing protein, putative | | E9BNP2 | 32 | Ld32_v01s1:520,011..521,903(+) | Ld32_v01s1:520011..521903(+) | Ld32_v01s1 | Leishmania donovani BPK282A1 | 51 | OG6_146568 | 0 | 630 | 1893 | 69544 | 8.71 | 3 | | | | | | | | | GO:0005737 | cytoplasm | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_321390.1ORPPPDE putative peptidase domain containing protein, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_321390.1 OR PPPDE putative peptidase domain containing protein, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_321570.1 | LdBPK_321570.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2151 | LdBPK_321570.1 | Metalloprotease M41 FtsH, putative | Metalloprotease M41 FtsH, putative | | E9BNR0 | 32 | Ld32_v01s1:595,863..598,013(-) | Ld32_v01s1:595863..598013(-) | Ld32_v01s1 | Leishmania donovani BPK282A1 | 49 | OG6_134869 | 0 | 716 | 2151 | 77846 | 8.56 | 1 | | | | | GO:0005524;GO:0004222 | ATP binding;metalloendopeptidase activity | GO:0006508 | proteolysis | GO:0005739 | mitochondrion | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_321570.1ORMetalloprotease M41 FtsH, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_321570.1 OR Metalloprotease M41 FtsH, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_323060.1 | LdBPK_323060.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 4026 | LdBPK_323060.1 | ubiquitin hydrolase, putative | ubiquitin hydrolase, putative | | E9BP57 | 32 | Ld32_v01s1:1,156,632..1,160,657(-) | Ld32_v01s1:1156632..1160657(-) | Ld32_v01s1 | Leishmania donovani BPK282A1 | 48 | OG6_146381 | 0 | 1341 | 4026 | 148164 | 4.99 | 0 | | | | | GO:0004843;GO:0036459 | thiol-dependent ubiquitin-specific protease activity;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | GO:0005737 | cytoplasm | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_323060.1ORubiquitin hydrolase, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_323060.1 OR ubiquitin hydrolase, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_323830.1 | LdBPK_323830.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1116 | LdBPK_323830.1 | enoyl-CoA hydratase/isomerase family protein, putative | enoyl-CoA hydratase/isomerase family protein, putative | | E9BPD3 | 32 | Ld32_v01s1:1,453,479..1,454,594(+) | Ld32_v01s1:1453479..1454594(+) | Ld32_v01s1 | Leishmania donovani BPK282A1 | 65 | OG6_102025 | 0 | 371 | 1116 | 39935 | 5.61 | 0 | | | | | GO:0003860 | 3-hydroxyisobutyryl-CoA hydrolase activity | | | GO:0097014;GO:0005737;GO:0005739;GO:0031981 | ciliary plasm;cytoplasm;mitochondrion;nuclear lumen | | | | | | 3.1.2.4 (3-hydroxyisobutyryl-CoA hydrolase) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_323830.1ORenoyl-CoA hydratase/isomerase family protein, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_323830.1 OR enoyl-CoA hydratase/isomerase family protein, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_324040.1 | LdBPK_324040.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1167 | LdBPK_324040.1 | AUT2/APG4/ATG4 cysteine peptidase, putative | AUT2/APG4/ATG4 cysteine peptidase, putative | | E9BPF4 | 32 | Ld32_v01s1:1,509,775..1,510,941(+) | Ld32_v01s1:1509775..1510941(+) | Ld32_v01s1 | Leishmania donovani BPK282A1 | 97 | OG6_100501 | 1 | 388 | 1167 | 42345 | 7.50 | 0 | | | | | | | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_324040.1ORAUT2/APG4/ATG4 cysteine peptidase, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_324040.1 OR AUT2/APG4/ATG4 cysteine peptidase, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_330210.1 | LdBPK_330210.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 4455 | LdBPK_330210.1 | metallo-peptidase, Clan MC, Family M14, putative | metallo-peptidase, Clan MC, Family M14, putative | | E9BPV0 | 33 | Ld33_v01s1:49,280..53,734(-) | Ld33_v01s1:49280..53734(-) | Ld33_v01s1 | Leishmania donovani BPK282A1 | 50 | OG6_101273 | 0 | 1484 | 4455 | 160866 | 7.71 | 0 | HMM: MVQGMLFSSLQSGSAAD, NN: MVQGMLFSSLQSGSAAD | NN Sum: 2, NN D: .31, HMM Prob: .83 | | | GO:0004181;GO:0008270 | metallocarboxypeptidase activity;zinc ion binding | GO:0006508 | proteolysis | GO:0005737 | cytoplasm | | | | | | 3.4.17.10 (Carboxypeptidase E) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_330210.1ORmetallo-peptidase, Clan MC, Family M14, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_330210.1 OR metallo-peptidase, Clan MC, Family M14, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_330410.1 | LdBPK_330410.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1221 | LdBPK_330410.1 | serine peptidase, putative | serine peptidase, putative | | E9BPX0 | 33 | Ld33_v01s1:124,079..125,299(-) | Ld33_v01s1:124079..125299(-) | Ld33_v01s1 | Leishmania donovani BPK282A1 | 86 | OG6_100915 | 1 | 406 | 1221 | 44703 | 8.30 | 0 | | | | | | | | | | | | | | | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_330410.1ORserine peptidase, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_330410.1 OR serine peptidase, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_331710.1 | LdBPK_331710.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1419 | LdBPK_331710.1 | cytosolic nonspecific dipeptidase, putative | cytosolic nonspecific dipeptidase, putative | | E9BQA2 | 33 | Ld33_v01s1:650,016..651,434(+) | Ld33_v01s1:650016..651434(+) | Ld33_v01s1 | Leishmania donovani BPK282A1 | 94 | OG6_100503 | 1 | 472 | 1419 | 51875 | 5.46 | 0 | | | | | GO:0016787 | hydrolase activity | GO:0008152 | metabolic process | GO:0005737 | cytoplasm | | | | | | 3.4.13.20 (Beta-Ala-His dipeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_331710.1ORcytosolic nonspecific dipeptidase, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_331710.1 OR cytosolic nonspecific dipeptidase, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_331900.1 | LdBPK_331900.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 648 | LdBPK_331900.1 | Der1-like family, putative | Der1-like family, putative | | E9BQC0 | 33 | Ld33_v01s1:708,479..709,126(+) | Ld33_v01s1:708479..709126(+) | Ld33_v01s1 | Leishmania donovani BPK282A1 | 95 | OG6_101672 | 1 | 215 | 648 | 24799 | 7.96 | 4 | | | | | | | | | GO:0005737 | cytoplasm | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_331900.1ORDer1-like family, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_331900.1 OR Der1-like family, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_332130.1 | LdBPK_332130.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 4140 | LdBPK_332130.1 | calpain protease-like protein | calpain protease-like protein | | E9BQE3 | 33 | Ld33_v01s1:785,148..789,287(+) | Ld33_v01s1:785148..789287(+) | Ld33_v01s1 | Leishmania donovani BPK282A1 | 52 | OG6_103851 | 0 | 1379 | 4140 | 150313 | 8.47 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_332130.1ORcalpain protease-like proteinANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_332130.1 OR calpain protease-like protein AND Leishmania donovani BPK282A1 |
|
LdBPK_332390.1 | LdBPK_332390.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 4224 | LdBPK_332390.1 | glycosyl hydrolase-like protein | glycosyl hydrolase-like protein | | E9BPH8 | 33 | Ld33_v01s1:910,337..914,560(+) | Ld33_v01s1:910337..914560(+) | Ld33_v01s1 | Leishmania donovani BPK282A1 | 52 | OG6_104188 | 0 | 1407 | 4224 | 152032 | 6.63 | 0 | | | GO:0005737 | cytoplasm | GO:0033925 | mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase activity | | | | | | | | | | 3.2.1.96 (Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_332390.1ORglycosyl hydrolase-like proteinANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_332390.1 OR glycosyl hydrolase-like protein AND Leishmania donovani BPK282A1 |
|
LdBPK_332670.1 | LdBPK_332670.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1500 | LdBPK_332670.1 | metallo-peptidase, Clan MA(E) Family M32 | metallo-peptidase, Clan MA(E) Family M32 | | E9BPK5 | 33 | Ld33_v01s1:1,032,054..1,033,553(+) | Ld33_v01s1:1032054..1033553(+) | Ld33_v01s1 | Leishmania donovani BPK282A1 | 152 | OG6_105939 | 3 | 499 | 1500 | 57020 | 5.30 | 0 | | | | | GO:0004181 | metallocarboxypeptidase activity | GO:0006508 | proteolysis | GO:0005737;GO:0005829 | cytoplasm;cytosol | GO:0004181 | metallocarboxypeptidase activity | GO:0006518;GO:0006508 | peptide metabolic process;proteolysis | 3.4.17.19 (Carboxypeptidase Taq) | 3.4.17.19 (Carboxypeptidase Taq) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_332670.1ORmetallo-peptidase, Clan MA(E) Family M32ANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_332670.1 OR metallo-peptidase, Clan MA(E) Family M32 AND Leishmania donovani BPK282A1 |
|
LdBPK_332700.1 | LdBPK_332700.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1584 | LdBPK_332700.1 | metallo-peptidase, Clan MF, Family M17 | metallo-peptidase, Clan MF, Family M17 | | E9BPK8 | 33 | Ld33_v01s1:1,050,433..1,052,016(+) | Ld33_v01s1:1050433..1052016(+) | Ld33_v01s1 | Leishmania donovani BPK282A1 | 51 | OG6_105603 | 0 | 527 | 1584 | 55679 | 7.09 | 0 | | | GO:0005622 | intracellular | GO:0004177 | aminopeptidase activity | GO:0006508 | proteolysis | GO:0005654;GO:0005634 | nucleoplasm;nucleus | | | | | | 3.4.11.1 (Leucyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_332700.1ORmetallo-peptidase, Clan MF, Family M17ANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_332700.1 OR metallo-peptidase, Clan MF, Family M17 AND Leishmania donovani BPK282A1 |
|
LdBPK_332750.1 | LdBPK_332750.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1452 | LdBPK_332750.1 | Mitochondrial-processing peptidase subunit alpha | Mitochondrial-processing peptidase subunit alpha | | E9BPL3 | 33 | Ld33_v01s1:1,065,013..1,066,464(+) | Ld33_v01s1:1065013..1066464(+) | Ld33_v01s1 | Leishmania donovani BPK282A1 | 50 | OG6_102381 | 0 | 483 | 1452 | 52928 | 7.03 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | GO:0005737;GO:0017087 | cytoplasm;mitochondrial processing peptidase complex | GO:0004222 | metalloendopeptidase activity | GO:0030150 | protein import into mitochondrial matrix | 3.4.24.64 (Mitochondrial processing peptidase) | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_332750.1ORMitochondrial-processing peptidase subunit alphaANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_332750.1 OR Mitochondrial-processing peptidase subunit alpha AND Leishmania donovani BPK282A1 |
|
LdBPK_332970.1 | LdBPK_332970.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1110 | LdBPK_332970.1 | cysteine peptidase, Clan CA, family C51, putative | cysteine peptidase, Clan CA, family C51, putative | | E9BPN5 | 33 | Ld33_v01s1:1,172,209..1,173,318(+) | Ld33_v01s1:1172209..1173318(+) | Ld33_v01s1 | Leishmania donovani BPK282A1 | 102 | OG6_115782 | 1 | 369 | 1110 | 40210 | 7.14 | 1 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_332970.1ORcysteine peptidase, Clan CA, family C51, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_332970.1 OR cysteine peptidase, Clan CA, family C51, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_333000.1 | LdBPK_333000.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1215 | LdBPK_333000.1 | cysteine peptidase, Clan CA, family C51, putative | cysteine peptidase, Clan CA, family C51, putative | | E9BPN8 | 33 | Ld33_v01s1:1,183,051..1,184,265(+) | Ld33_v01s1:1183051..1184265(+) | Ld33_v01s1 | Leishmania donovani BPK282A1 | 102 | OG6_115782 | 1 | 404 | 1215 | 44371 | 7.59 | 1 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_333000.1ORcysteine peptidase, Clan CA, family C51, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_333000.1 OR cysteine peptidase, Clan CA, family C51, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_333010.1 | LdBPK_333010.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1455 | LdBPK_333010.1 | hypothetical protein, conserved | hypothetical protein, conserved | | E9BPN9 | 33 | Ld33_v01s1:1,185,636..1,187,090(+) | Ld33_v01s1:1185636..1187090(+) | Ld33_v01s1 | Leishmania donovani BPK282A1 | 44 | OG6_173752 | 0 | 484 | 1455 | 53219 | 9.67 | 1 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_333010.1ORhypothetical protein, conservedANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_333010.1 OR hypothetical protein, conserved AND Leishmania donovani BPK282A1 |
|
LdBPK_333280.1 | LdBPK_333280.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 918 | LdBPK_333280.1 | Trypsin-like peptidase domain containing protein, putative | Trypsin-like peptidase domain containing protein, putative | | E9BPR5 | 33 | Ld33_v01s1:1,412,872..1,413,789(+) | Ld33_v01s1:1412872..1413789(+) | Ld33_v01s1 | Leishmania donovani BPK282A1 | 53 | OG6_137919 | 0 | 305 | 918 | 32857 | 7.14 | 0 | HMM: MAEGAAAVGGAGVLAAASQWRGC, NN: MAEGAAAVGGAGVLAAASQWRGCCYPILTFLHVPGKMTK | NN Sum: 0, NN D: .27, HMM Prob: .91 | | | | | | | GO:0005737 | cytoplasm | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_333280.1ORTrypsin-like peptidase domain containing protein, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_333280.1 OR Trypsin-like peptidase domain containing protein, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_340300.1 | LdBPK_340300.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 4659 | LdBPK_340300.1 | calpain-like cysteine peptidase, putative | calpain-like cysteine peptidase, putative | | E9BQI4 | 34 | Ld34_v01s1:98,008..102,666(+) | Ld34_v01s1:98008..102666(+) | Ld34_v01s1 | Leishmania donovani BPK282A1 | 26 | OG6_200421 | 0 | 1552 | 4659 | 172353 | 8.04 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_340300.1ORcalpain-like cysteine peptidase, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_340300.1 OR calpain-like cysteine peptidase, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_340670.1 | LdBPK_340670.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 930 | LdBPK_340670.1 | proteasome regulatory non-ATPase subunit 11, putative | proteasome regulatory non-ATPase subunit 11, putative | | E9BQM1 | 34 | Ld34_v01s1:280,065..280,994(+) | Ld34_v01s1:280065..280994(+) | Ld34_v01s1 | Leishmania donovani BPK282A1 | 58 | OG6_101835 | 0 | 309 | 930 | 34709 | 7.04 | 0 | | | | | GO:0005515 | protein binding | | | GO:0005737;GO:0005838 | cytoplasm;proteasome regulatory particle | | | GO:0016049;GO:0006511 | cell growth;ubiquitin-dependent protein catabolic process | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_340670.1ORproteasome regulatory non-ATPase subunit 11, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_340670.1 OR proteasome regulatory non-ATPase subunit 11, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_341130.1 | LdBPK_341130.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1872 | LdBPK_341130.1 | mitochondrial ATP-dependent zinc metallopeptidase, putative | mitochondrial ATP-dependent zinc metallopeptidase, putative | | E9BQR4 | 34 | Ld34_v01s1:479,904..481,775(+) | Ld34_v01s1:479904..481775(+) | Ld34_v01s1 | Leishmania donovani BPK282A1 | 52 | OG6_100384 | 0 | 623 | 1872 | 69145 | 7.63 | 2 | | | GO:0016020 | membrane | GO:0005524;GO:0004222 | ATP binding;metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_341130.1ORmitochondrial ATP-dependent zinc metallopeptidase, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_341130.1 OR mitochondrial ATP-dependent zinc metallopeptidase, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_341750.1 | LdBPK_341750.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 834 | LdBPK_341750.1 | pyroglutamyl-peptidase I, putative | pyroglutamyl-peptidase I, putative | | E9BQX4 | 34 | Ld34_v01s1:753,336..754,169(-) | Ld34_v01s1:753336..754169(-) | Ld34_v01s1 | Leishmania donovani BPK282A1 | 48 | OG6_101530 | 0 | 277 | 834 | 30539 | 6.37 | 0 | | | | | | | | | GO:0005737 | cytoplasm | GO:0016920 | pyroglutamyl-peptidase activity | | | | 3.4.19.3 (Pyroglutamyl-peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_341750.1ORpyroglutamyl-peptidase I, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_341750.1 OR pyroglutamyl-peptidase I, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_342670.1 | LdBPK_342670.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2532 | LdBPK_342670.1 | Carboxypeptidase-like protein | Carboxypeptidase-like protein | | E9BR65 | 34 | Ld34_v01s1:1,168,247..1,170,778(+) | Ld34_v01s1:1168247..1170778(+) | Ld34_v01s1 | Leishmania donovani BPK282A1 | 53 | OG6_105780 | 0 | 843 | 2532 | 91579 | 9.18 | 0 | | | | | GO:0004181;GO:0008270 | metallocarboxypeptidase activity;zinc ion binding | GO:0006508 | proteolysis | GO:0005737;GO:0005829 | cytoplasm;cytosol | GO:0043531;GO:0005524;GO:0004181;GO:0008270 | ADP binding;ATP binding;metallocarboxypeptidase activity;zinc ion binding | | | 3.4.17.- (Metallocarboxypeptidases.) | 3.4.17.- (Metallocarboxypeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_342670.1ORCarboxypeptidase-like proteinANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_342670.1 OR Carboxypeptidase-like protein AND Leishmania donovani BPK282A1 |
|
LdBPK_343830.1 | LdBPK_343830.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1521 | LdBPK_343830.1 | Peptidase family C78, putative | Peptidase family C78, putative | | E9BRI1 | 34 | Ld34_v01s1:1,567,825..1,569,345(+) | Ld34_v01s1:1567825..1569345(+) | Ld34_v01s1 | Leishmania donovani BPK282A1 | 52 | OG6_102601 | 0 | 506 | 1521 | 56175 | 6.62 | 0 | | | | | | | | | GO:0005634 | nucleus | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_343830.1ORPeptidase family C78, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_343830.1 OR Peptidase family C78, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_343890.1 | LdBPK_343890.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2721 | LdBPK_343890.1 | ubiquitin hydrolase, putative | ubiquitin hydrolase, putative | | E9BRI7 | 34 | Ld34_v01s1:1,580,708..1,583,428(+) | Ld34_v01s1:1580708..1583428(+) | Ld34_v01s1 | Leishmania donovani BPK282A1 | 45 | OG6_173868 | 0 | 906 | 2721 | 102626 | 5.30 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_343890.1ORubiquitin hydrolase, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_343890.1 OR ubiquitin hydrolase, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_351390.1 | LdBPK_351390.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1473 | LdBPK_351390.1 | mitochondrial processing peptidase, beta subunit, putative | mitochondrial processing peptidase, beta subunit, putative | | E9BS15 | 35 | Ld35_v01s1:584,325..585,797(+) | Ld35_v01s1:584325..585797(+) | Ld35_v01s1 | Leishmania donovani BPK282A1 | 53 | OG6_137602 | 0 | 490 | 1473 | 54587 | 7.08 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | GO:0005737;GO:0005739 | cytoplasm;mitochondrion | | | | | 3.4.24.64 (Mitochondrial processing peptidase) | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_351390.1ORmitochondrial processing peptidase, beta subunit, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_351390.1 OR mitochondrial processing peptidase, beta subunit, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_351400.1 | LdBPK_351400.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2043 | LdBPK_351400.1 | Zn-finger in Ran binding protein and others/OTU-like cysteine protease, putative | Zn-finger in Ran binding protein and others/OTU-like cysteine protease, putative | | E9BS16 | 35 | Ld35_v01s1:589,066..591,108(+) | Ld35_v01s1:589066..591108(+) | Ld35_v01s1 | Leishmania donovani BPK282A1 | 50 | OG6_124705 | 0 | 680 | 2043 | 74497 | 8.31 | 0 | | | | | | | | | GO:0051286 | cell tip | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_351400.1ORZn-finger in Ran binding protein and others/OTU-like cysteine protease, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_351400.1 OR Zn-finger in Ran binding protein and others/OTU-like cysteine protease, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_351580.1 | LdBPK_351580.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1323 | LdBPK_351580.1 | metacaspase, putative | metacaspase, putative | | E9BS34 | 35 | Ld35_v01s1:670,075..671,397(-) | Ld35_v01s1:670075..671397(-) | Ld35_v01s1 | Leishmania donovani BPK282A1 | 158 | OG6_101407 | 0 | 440 | 1323 | 47770 | 8.58 | 0 | HMM: MADLLDILGIGAVASLIPMLANGL, NN: MADLLDILGIGAVASLIPMLANGL | NN Sum: 4, NN D: .53, HMM Prob: .44 | | | | | | | GO:0051286;GO:0097014;GO:0005737;GO:0031981 | cell tip;ciliary plasm;cytoplasm;nuclear lumen | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_351580.1ORmetacaspase, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_351580.1 OR metacaspase, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_351730.1 | LdBPK_351730.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3495 | LdBPK_351730.1 | ubiquitin hydrolase, putative | ubiquitin hydrolase, putative | | E9BS48 | 35 | Ld35_v01s1:721,489..724,983(-) | Ld35_v01s1:721489..724983(-) | Ld35_v01s1 | Leishmania donovani BPK282A1 | 52 | OG6_101317 | 0 | 1164 | 3495 | 133518 | 6.75 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_351730.1ORubiquitin hydrolase, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_351730.1 OR ubiquitin hydrolase, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_351970.1 | LdBPK_351970.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1773 | LdBPK_351970.1 | hypothetical protein, conserved | hypothetical protein, conserved | | E9BS70 | 35 | Ld35_v01s1:786,684..788,456(+) | Ld35_v01s1:786684..788456(+) | Ld35_v01s1 | Leishmania donovani BPK282A1 | 54 | OG6_124708 | 0 | 590 | 1773 | 67562 | 6.80 | 0 | | | | | | | | | GO:0030964;GO:0005739 | NADH dehydrogenase complex;mitochondrion | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_351970.1ORhypothetical protein, conservedANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_351970.1 OR hypothetical protein, conserved AND Leishmania donovani BPK282A1 |
|
LdBPK_352400.1 | LdBPK_352400.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1455 | LdBPK_352400.1 | aminopeptidase P, putative | aminopeptidase P, putative | | E9BSB0 | 35 | Ld35_v01s1:973,427..974,881(+) | Ld35_v01s1:973427..974881(+) | Ld35_v01s1 | Leishmania donovani BPK282A1 | 54 | OG6_102295 | 0 | 484 | 1455 | 53724 | 5.89 | 0 | | | | | GO:0004177;GO:0030145 | aminopeptidase activity;manganese ion binding | | | GO:0005737 | cytoplasm | | | | | | 3.4.11.9 (Xaa-Pro aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_352400.1ORaminopeptidase P, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_352400.1 OR aminopeptidase P, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_352460.1 | LdBPK_352460.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1638 | LdBPK_352460.1 | ubiquitin hydrolase, putative | ubiquitin hydrolase, putative | | E9BSB6 | 35 | Ld35_v01s1:1,005,976..1,007,613(+) | Ld35_v01s1:1005976..1007613(+) | Ld35_v01s1 | Leishmania donovani BPK282A1 | 49 | OG6_136424 | 0 | 545 | 1638 | 60695 | 8.94 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_352460.1ORubiquitin hydrolase, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_352460.1 OR ubiquitin hydrolase, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_352850.1 | LdBPK_352850.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1203 | LdBPK_352850.1 | Alpha/beta hydrolase family, putative | Alpha/beta hydrolase family, putative | | E9BSF5 | 35 | Ld35_v01s1:1,164,310..1,165,512(-) | Ld35_v01s1:1164310..1165512(-) | Ld35_v01s1 | Leishmania donovani BPK282A1 | 50 | OG6_138036 | 0 | 400 | 1203 | 44276 | 8.34 | 3 | HMM: MIFGSALVLVVAALNSSAN, NN: MIFGSALVLVVAALNSSAN | NN Sum: 3, NN D: .57, HMM Prob: .91 | | | | | | | GO:0005737 | cytoplasm | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_352850.1ORAlpha/beta hydrolase family, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_352850.1 OR Alpha/beta hydrolase family, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_353500.1 | LdBPK_353500.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2523 | LdBPK_353500.1 | DNA-repair protein, putative | DNA-repair protein, putative | | E9BSM1 | 35 | Ld35_v01s1:1,410,833..1,413,355(-) | Ld35_v01s1:1410833..1413355(-) | Ld35_v01s1 | Leishmania donovani BPK282A1 | 53 | OG6_144738 | 0 | 840 | 2523 | 93238 | 9.35 | 0 | | | | | GO:0003677 | DNA binding | | | GO:0005737;GO:0031981;GO:0005634 | cytoplasm;nuclear lumen;nucleus | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_353500.1ORDNA-repair protein, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_353500.1 OR DNA-repair protein, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_353880.1 | LdBPK_353880.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 765 | LdBPK_353880.1 | proteasome beta 2 subunit, putative | proteasome beta 2 subunit, putative | | E9BSQ8 | 35 | Ld35_v01s1:1,539,355..1,540,119(-) | Ld35_v01s1:1539355..1540119(-) | Ld35_v01s1 | Leishmania donovani BPK282A1 | 47 | OG6_101382 | 0 | 254 | 765 | 27589 | 6.60 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_353880.1ORproteasome beta 2 subunit, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_353880.1 OR proteasome beta 2 subunit, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_354070.1 | LdBPK_354070.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1185 | LdBPK_354070.1 | Bem46-like serine peptidase | Bem46-like serine peptidase | | E9BSS7 | 35 | Ld35_v01s1:1,617,365..1,618,549(+) | Ld35_v01s1:1617365..1618549(+) | Ld35_v01s1 | Leishmania donovani BPK282A1 | 48 | OG6_101827 | 0 | 394 | 1185 | 42681 | 6.86 | 1 | HMM: MSFGGFLLSAGLYLVLVAVFVSLFLHIMSY, NN: MSFGGFLLSAGLYLVLVAVFVSLFLHIMSY | NN Sum: 3, NN D: .65, HMM Prob: .29 | | | | | | | GO:0005783 | endoplasmic reticulum | | | | | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_354070.1ORBem46-like serine peptidaseANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_354070.1 OR Bem46-like serine peptidase AND Leishmania donovani BPK282A1 |
|
LdBPK_354910.1 | LdBPK_354910.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 753 | LdBPK_354910.1 | proteasome alpha 1 subunit, putative | proteasome alpha 1 subunit, putative | | E9BT10 | 35 | Ld35_v01s1:1,900,105..1,900,857(+) | Ld35_v01s1:1900105..1900857(+) | Ld35_v01s1 | Leishmania donovani BPK282A1 | 48 | OG6_102240 | 0 | 250 | 753 | 27220 | 7.85 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | GO:0005737 | cytoplasm | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_354910.1ORproteasome alpha 1 subunit, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_354910.1 OR proteasome alpha 1 subunit, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_360220.1 | LdBPK_360220.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 678 | LdBPK_360220.1 | mitochondrial inner membrane signal peptidase, putative | mitochondrial inner membrane signal peptidase, putative | | E9BT81 | 36 | Ld36_v01s1:62,028..62,705(-) | Ld36_v01s1:62028..62705(-) | Ld36_v01s1 | Leishmania donovani BPK282A1 | 47 | OG6_132331 | 0 | 225 | 678 | 25593 | 6.50 | 0 | NN: MRWRQWWSALRYSKYGDVPFVLLGVLIGWNCDVSCAV, HMM: MRWRQWWSALRYSKYGDVPFVLLGVLIGWNCDVSCAV | NN Sum: 2, NN D: .42, HMM Prob: .86 | | | | | | | GO:0020023;GO:0005739 | kinetoplast;mitochondrion | | | | | | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_360220.1ORmitochondrial inner membrane signal peptidase, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_360220.1 OR mitochondrial inner membrane signal peptidase, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_360340.1 | LdBPK_360340.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 621 | LdBPK_360340.1 | proteasome subunit beta type-2, putative | proteasome subunit beta type-2, putative | | E9BT93 | 36 | Ld36_v01s1:92,820..93,440(-) | Ld36_v01s1:92820..93440(-) | Ld36_v01s1 | Leishmania donovani BPK282A1 | 51 | OG6_102061 | 0 | 206 | 621 | 23017 | 5.60 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | GO:0005737 | cytoplasm | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_360340.1ORproteasome subunit beta type-2, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_360340.1 OR proteasome subunit beta type-2, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_360840.1 | LdBPK_360840.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 3363 | LdBPK_360840.1 | Calpain family cysteine protease, putative | Calpain family cysteine protease, putative | | E9BTE3 | 36 | Ld36_v01s1:281,381..284,743(+) | Ld36_v01s1:281381..284743(+) | Ld36_v01s1 | Leishmania donovani BPK282A1 | 25 | OG6_478742 | 0 | 1120 | 3363 | 121130 | 6.53 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_360840.1ORCalpain family cysteine protease, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_360840.1 OR Calpain family cysteine protease, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_361430.1 | LdBPK_361430.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1818 | LdBPK_361430.1 | hypothetical protein, conserved | hypothetical protein, conserved | | E9BTK2 | 36 | Ld36_v01s1:508,407..510,224(-) | Ld36_v01s1:508407..510224(-) | Ld36_v01s1 | Leishmania donovani BPK282A1 | 51 | OG6_146679 | 0 | 605 | 1818 | 66976 | 7.60 | 0 | | | | | GO:0005488 | binding | | | GO:0005739 | mitochondrion | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_361430.1ORhypothetical protein, conservedANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_361430.1 OR hypothetical protein, conserved AND Leishmania donovani BPK282A1 |
|
LdBPK_361670.1 | LdBPK_361670.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 795 | LdBPK_361670.1 | proteasome subunit alpha type-1, putative | proteasome subunit alpha type-1, putative | | E9BTM6 | 36 | Ld36_v01s1:626,025..626,819(-) | Ld36_v01s1:626025..626819(-) | Ld36_v01s1 | Leishmania donovani BPK282A1 | 51 | OG6_102143 | 0 | 264 | 795 | 29691 | 4.97 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | GO:0005737;GO:0005654 | cytoplasm;nucleoplasm | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_361670.1ORproteasome subunit alpha type-1, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_361670.1 OR proteasome subunit alpha type-1, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_361730.1 | LdBPK_361730.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 909 | LdBPK_361730.1 | proteasome subunit beta type-5, putative | proteasome subunit beta type-5, putative | | E9BTN2 | 36 | Ld36_v01s1:659,120..660,028(-) | Ld36_v01s1:659120..660028(-) | Ld36_v01s1 | Leishmania donovani BPK282A1 | 52 | OG6_100897 | 0 | 302 | 909 | 33615 | 6.25 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_361730.1ORproteasome subunit beta type-5, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_361730.1 OR proteasome subunit beta type-5, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_361770.1 | LdBPK_361770.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 933 | LdBPK_361770.1 | Peptidase M76 family, putative | Peptidase M76 family, putative | | E9BTN6 | 36 | Ld36_v01s1:670,204..671,136(-) | Ld36_v01s1:670204..671136(-) | Ld36_v01s1 | Leishmania donovani BPK282A1 | 51 | OG6_102968 | 0 | 310 | 933 | 33613 | 7.67 | 0 | NN: MGLLSSSSSSSSSAGTGAGAAAA, HMM: MGLLSSSSSSSSSAGTGAGAAAAQTDAQ | NN Sum: 0, NN D: .11, HMM Prob: .87 | | | GO:0004222 | metalloendopeptidase activity | | | GO:0005737 | cytoplasm | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_361770.1ORPeptidase M76 family, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_361770.1 OR Peptidase M76 family, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_362550.1 | LdBPK_362550.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2559 | LdBPK_362550.1 | serine peptidase, Clan SC, Family S9B | serine peptidase, Clan SC, Family S9B | | E9BTW4 | 36 | Ld36_v01s1:989,343..991,901(+) | Ld36_v01s1:989343..991901(+) | Ld36_v01s1 | Leishmania donovani BPK282A1 | 57 | OG6_102236 | 0 | 852 | 2559 | 94234 | 5.79 | 0 | | | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | GO:0097014;GO:0005737 | ciliary plasm;cytoplasm | | | | | | 3.4.14.5 (Dipeptidyl-peptidase IV) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_362550.1ORserine peptidase, Clan SC, Family S9BANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_362550.1 OR serine peptidase, Clan SC, Family S9B AND Leishmania donovani BPK282A1 |
|
LdBPK_362850.1 | LdBPK_362850.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1716 | LdBPK_362850.1 | mitochondrial ATP-dependent zinc metallopeptidase, putative | mitochondrial ATP-dependent zinc metallopeptidase, putative | | E9BTZ4 | 36 | Ld36_v01s1:1,119,319..1,121,034(-) | Ld36_v01s1:1119319..1121034(-) | Ld36_v01s1 | Leishmania donovani BPK282A1 | 51 | OG6_101196 | 0 | 571 | 1716 | 62188 | 5.37 | 1 | | | GO:0016020 | membrane | GO:0005524;GO:0004222 | ATP binding;metalloendopeptidase activity | GO:0006508 | proteolysis | GO:0005737;GO:0005739 | cytoplasm;mitochondrion | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_362850.1ORmitochondrial ATP-dependent zinc metallopeptidase, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_362850.1 OR mitochondrial ATP-dependent zinc metallopeptidase, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_362980.1 | LdBPK_362980.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3438 | LdBPK_362980.1 | Flagellar Member 2 | Flagellar Member 2 | | E9BU08 | 36 | Ld36_v01s1:1,177,848..1,181,285(-) | Ld36_v01s1:1177848..1181285(-) | Ld36_v01s1 | Leishmania donovani BPK282A1 | 53 | OG6_146571 | 0 | 1145 | 3438 | 125854 | 5.52 | 0 | | | | | | | | | GO:0005930;GO:0031514 | axoneme;motile cilium | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_362980.1ORFlagellar Member 2ANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_362980.1 OR Flagellar Member 2 AND Leishmania donovani BPK282A1 |
|
LdBPK_364180.1 | LdBPK_364180.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 663 | LdBPK_364180.1 | ATP-dependent protease subunit HslV, putative | ATP-dependent protease subunit HslV, putative | | E9BUC6 | 36 | Ld36_v01s1:1,543,212..1,543,874(+) | Ld36_v01s1:1543212..1543874(+) | Ld36_v01s1 | Leishmania donovani BPK282A1 | 51 | OG6_107204 | 0 | 220 | 663 | 24124 | 6.10 | 0 | HMM: MFRRLATRSTSFVTGAAVQAR, NN: MFRRLATRSTSFVTGAAVQAR | NN Sum: 0, NN D: .37, HMM Prob: .8 | GO:0009376;GO:0005839 | HslUV protease complex;proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0006508;GO:0051603 | proteolysis;proteolysis involved in cellular protein catabolic process | GO:0009376;GO:0097014;GO:0005737;GO:0042645;GO:0005739;GO:0031981 | HslUV protease complex;ciliary plasm;cytoplasm;mitochondrial nucleoid;mitochondrion;nuclear lumen | GO:0004176 | ATP-dependent peptidase activity | GO:0033955;GO:0006264;GO:0070581 | mitochondrial DNA inheritance;mitochondrial DNA replication;rolling circle DNA replication | 3.4.25.2 (HslU--HslV peptidase) | 3.4.25.2 (HslU--HslV peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_364180.1ORATP-dependent protease subunit HslV, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_364180.1 OR ATP-dependent protease subunit HslV, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_364230.1 | LdBPK_364230.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 4668 | LdBPK_364230.1 | metallo-peptidase, Clan MC, Family M14, putative | metallo-peptidase, Clan MC, Family M14, putative | | E9BUD1 | 36 | Ld36_v01s1:1,557,163..1,561,830(+) | Ld36_v01s1:1557163..1561830(+) | Ld36_v01s1 | Leishmania donovani BPK282A1 | 50 | OG6_142418 | 0 | 1555 | 4668 | 165704 | 9.59 | 0 | | | | | GO:0004181;GO:0008270 | metallocarboxypeptidase activity;zinc ion binding | GO:0006508 | proteolysis | GO:0005737 | cytoplasm | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_364230.1ORmetallo-peptidase, Clan MC, Family M14, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_364230.1 OR metallo-peptidase, Clan MC, Family M14, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_364510.1 | LdBPK_364510.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2250 | LdBPK_364510.1 | trypanothione synthetase-like protein | trypanothione synthetase-like protein | | E9BUF9 | 36 | Ld36_v01s1:1,681,023..1,683,272(+) | Ld36_v01s1:1681023..1683272(+) | Ld36_v01s1 | Leishmania donovani BPK282A1 | 36 | OG6_173844 | 0 | 749 | 2250 | 82644 | 5.97 | 0 | | | | | | | | | | | | | | | | 6.3.1.9 (Trypanothione synthase) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_364510.1ORtrypanothione synthetase-like proteinANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_364510.1 OR trypanothione synthetase-like protein AND Leishmania donovani BPK282A1 |
|
LdBPK_364570.1 | LdBPK_364570.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1230 | LdBPK_364570.1 | Regulatory particle triple-A ATPase subunit 6 | Regulatory particle triple-A ATPase subunit 6 | | E9BUG5 | 36 | Ld36_v01s1:1,712,471..1,713,700(+) | Ld36_v01s1:1712471..1713700(+) | Ld36_v01s1 | Leishmania donovani BPK282A1 | 51 | OG6_101513 | 0 | 409 | 1230 | 45534 | 9.45 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | GO:0005737;GO:0005654;GO:0005838 | cytoplasm;nucleoplasm;proteasome regulatory particle | GO:0016887 | ATPase activity | GO:0006511 | ubiquitin-dependent protein catabolic process | | 3.6.4.3 (Transferred entry: 5.6.1.1) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_364570.1ORRegulatory particle triple-A ATPase subunit 6ANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_364570.1 OR Regulatory particle triple-A ATPase subunit 6 AND Leishmania donovani BPK282A1 |
|
LdBPK_364670.1 | LdBPK_364670.1.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2031 | LdBPK_364670.1 | mitochondrial intermediate peptidase, putative | mitochondrial intermediate peptidase, putative | | E9BUH5 | 36 | Ld36_v01s1:1,747,154..1,749,184(+) | Ld36_v01s1:1747154..1749184(+) | Ld36_v01s1 | Leishmania donovani BPK282A1 | 49 | OG6_102110 | 0 | 676 | 2031 | 75952 | 6.43 | 0 | NN: MLRRLVSCASPLRLRGCGAA, HMM: MLRRLVSCASPLRLRGCGAA | NN Sum: 1, NN D: .45, HMM Prob: .92 | | | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.24.59 (Mitochondrial intermediate peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_364670.1ORmitochondrial intermediate peptidase, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_364670.1 OR mitochondrial intermediate peptidase, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_365800.1 | LdBPK_365800.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2520 | LdBPK_365800.1 | aminopeptidase P1, putative | aminopeptidase P1, putative | | E9BUT7 | 36 | Ld36_v01s1:2,175,133..2,177,652(-) | Ld36_v01s1:2175133..2177652(-) | Ld36_v01s1 | Leishmania donovani BPK282A1 | 27 | OG6_200380 | 0 | 839 | 2520 | 90518 | 7.99 | 0 | NN: MLRRLRRAWCTAPAQRHSVPLTLGSTRWVGGSAAV, HMM: MLRRLRRAWCTAPAQRHSVPLTLGSTRWVGGSAAVAEEVSAQ | NN Sum: 0, NN D: .23, HMM Prob: .96 | | | GO:0004177;GO:0030145 | aminopeptidase activity;manganese ion binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_365800.1ORaminopeptidase P1, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_365800.1 OR aminopeptidase P1, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_366280.1 | LdBPK_366280.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1158 | LdBPK_366280.1 | OTU-like cysteine protease, putative | OTU-like cysteine protease, putative | | E9BUY5 | 36 | Ld36_v01s1:2,341,024..2,342,181(-) | Ld36_v01s1:2341024..2342181(-) | Ld36_v01s1 | Leishmania donovani BPK282A1 | 49 | OG6_102949 | 0 | 385 | 1158 | 43083 | 8.33 | 0 | HMM: MGCTAHTQTHTRSLCLTTFALLHWPVSHAC, NN: MGCTAHTQTHTRSLCLTTFALLHWPVSHAC | NN Sum: 3, NN D: .57, HMM Prob: .99 | | | | | | | GO:0097014;GO:0005737;GO:0031981 | ciliary plasm;cytoplasm;nuclear lumen | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_366280.1OROTU-like cysteine protease, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_366280.1 OR OTU-like cysteine protease, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_366520.1 | LdBPK_366520.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1116 | LdBPK_366520.1 | carboxypeptidase, putative | carboxypeptidase, putative | | E9BV09 | 36 | Ld36_v01s1:2,431,844..2,432,959(-) | Ld36_v01s1:2431844..2432959(-) | Ld36_v01s1 | Leishmania donovani BPK282A1 | 152 | OG6_105939 | 3 | 371 | 1116 | 41713 | 7.11 | 0 | | | | | GO:0004181 | metallocarboxypeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.17.19 (Carboxypeptidase Taq) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_366520.1ORcarboxypeptidase, putativeANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_366520.1 OR carboxypeptidase, putative AND Leishmania donovani BPK282A1 |
|
LdBPK_367060.1 | LdBPK_367060.1.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2094 | LdBPK_367060.1 | prolyl endopeptidase | prolyl endopeptidase | | E9BV62 | 36 | Ld36_v01s1:2,630,925..2,633,018(-) | Ld36_v01s1:2630925..2633018(-) | Ld36_v01s1 | Leishmania donovani BPK282A1 | 64 | OG6_101804 | 0 | 697 | 2094 | 78194 | 5.88 | 0 | | | | | GO:0004252;GO:0070008;GO:0008236 | serine-type endopeptidase activity;serine-type exopeptidase activity;serine-type peptidase activity | GO:0006508 | proteolysis | GO:0005737 | cytoplasm | GO:0070012 | oligopeptidase activity | | | 3.4.21.26 (Prolyl oligopeptidase) | 3.4.21.26 (Prolyl oligopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LdBPK_367060.1ORprolyl endopeptidaseANDLeishmania donovani BPK282A1 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LdBPK_367060.1 OR prolyl endopeptidase AND Leishmania donovani BPK282A1 |
