|
NF0000180 | mRNA1_NF0000180 | 5 | 4 | 2 | | 1 | reverse | protein coding | No | 1228 | NF0000180 | cathepsin d | cathepsin d | | | Not Assigned | Nfow_scaffold00001:33,250..35,013(-) | Nfow_scaffold00001:33250..35012(-) | Nfow_scaffold00001 | Naegleria fowleri ATCC 30863 | 1 | OG6_100536 | 0 | 408 | 1227 | 43970 | 8.59 | 1 | HMM: KLPKISEQKKMNKIAILLALLSVCAFVGSVVLAK, NN: KLPKISEQKKMNKIAILLALLSVCAFVGSVVLAK | NN Sum: 4, NN D: .67, HMM Prob: .95 | | | | | | | | | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0000180ORcathepsin dANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0000180 OR cathepsin d AND Naegleria fowleri ATCC 30863 |
|
NF0000250 | mRNA1_NF0000250 | 2 | 2 | 1 | | | reverse | protein coding | No | 1332 | NF0000250 | methionine aminopeptidase | methionine aminopeptidase | | | Not Assigned | Nfow_scaffold00001:49,212..50,681(-) | Nfow_scaffold00001:49212..50681(-) | Nfow_scaffold00001 | Naegleria fowleri ATCC 30863 | 10 | OG6_100815 | 1 | 443 | 1332 | 49919 | 7.29 | 0 | | | | | GO:0004177;GO:0008235 | aminopeptidase activity;metalloexopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0000250ORmethionine aminopeptidaseANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0000250 OR methionine aminopeptidase AND Naegleria fowleri ATCC 30863 |
|
NF0000910 | mRNA1_NF0000910 | 1 | 1 | 1 | | | reverse | protein coding | No | 885 | NF0000910 | eukaryotic translation initiation factor 3 subunit f-like | eukaryotic translation initiation factor 3 subunit f-like | | | Not Assigned | Nfow_scaffold00001:202,408..203,292(-) | Nfow_scaffold00001:202408..203292(-) | Nfow_scaffold00001 | Naegleria fowleri ATCC 30863 | 1 | OG6_103242 | 0 | 294 | 885 | 34326 | 6.79 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0000910OReukaryotic translation initiation factor 3 subunit f-likeANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0000910 OR eukaryotic translation initiation factor 3 subunit f-like AND Naegleria fowleri ATCC 30863 |
|
NF0001390 | mRNA1_NF0001390 | 4 | 3 | 2 | | | reverse | protein coding | No | 1398 | NF0001390 | 26s protease regulatory subunit 6a | 26s protease regulatory subunit 6a | | | Not Assigned | Nfow_scaffold00001:302,833..304,489(-) | Nfow_scaffold00001:302833..304489(-) | Nfow_scaffold00001 | Naegleria fowleri ATCC 30863 | 10 | OG6_101915 | 0 | 465 | 1398 | 52653 | 6.69 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | | | | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0001390OR26s protease regulatory subunit 6aANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0001390 OR 26s protease regulatory subunit 6a AND Naegleria fowleri ATCC 30863 |
|
NF0003240 | mRNA1_NF0003240 | 2 | 2 | 1 | | | reverse | protein coding | No | 1203 | NF0003240 | peptidase c26 family protein | peptidase c26 family protein | | | Not Assigned | Nfow_scaffold00002:293,199..294,478(-) | Nfow_scaffold00002:293199..294478(-) | Nfow_scaffold00002 | Naegleria fowleri ATCC 30863 | 3 | OG6_101559 | 1 | 400 | 1203 | 45694 | 7.76 | 1 | | | | | GO:0016787;GO:0008242 | hydrolase activity;omega peptidase activity | | | | | | | | | | 3.4.19.9 (Folate gamma-glutamyl hydrolase) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0003240ORpeptidase c26 family proteinANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0003240 OR peptidase c26 family protein AND Naegleria fowleri ATCC 30863 |
|
NF0004020 | mRNA1_NF0004020 | 6 | 6 | 1 | | | forward | protein coding | No | 2973 | NF0004020 | insulin-degrading enzyme isoform x3 | insulin-degrading enzyme isoform x3 | | | Not Assigned | Nfow_scaffold00003:2,008..5,263(+) | Nfow_scaffold00003:2008..5263(+) | Nfow_scaffold00003 | Naegleria fowleri ATCC 30863 | 1 | OG6_100422 | 1 | 990 | 2973 | 114858 | 6.23 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.56 (Insulysin) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0004020ORinsulin-degrading enzyme isoform x3ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0004020 OR insulin-degrading enzyme isoform x3 AND Naegleria fowleri ATCC 30863 |
|
NF0004560 | mRNA1_NF0004560 | 5 | 3 | 2 | 82 | | reverse | protein coding | No | 769 | NF0004560 | hypothetical protein NAEGRDRAFT 78521 | hypothetical protein NAEGRDRAFT 78521 | | | Not Assigned | Nfow_scaffold00003:97,175..98,076(-) | Nfow_scaffold00003:97390..98076(-) | Nfow_scaffold00003 | Naegleria fowleri ATCC 30863 | 0 | OG6_113993 | 0 | 228 | 687 | 26250 | 7.86 | 0 | | | | | GO:0005515;GO:0008270 | protein binding;zinc ion binding | | | | | | | | | | 3.4.17.12 (Carboxypeptidase M) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0004560ORhypothetical protein NAEGRDRAFT 78521ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0004560 OR hypothetical protein NAEGRDRAFT 78521 AND Naegleria fowleri ATCC 30863 |
|
NF0004670 | mRNA1_NF0004670 | 3 | 3 | 1 | | | forward | protein coding | No | 1848 | NF0004670 | creatinase aminopeptidase | creatinase aminopeptidase | | | Not Assigned | Nfow_scaffold00003:119,702..121,852(+) | Nfow_scaffold00003:119702..121852(+) | Nfow_scaffold00003 | Naegleria fowleri ATCC 30863 | 20 | OG6_100896 | 1 | 615 | 1848 | 69565 | 6.00 | 0 | | | | | GO:0016787 | hydrolase activity | | | | | | | | | | 3.4.11.9 (Xaa-Pro aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0004670ORcreatinase aminopeptidaseANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0004670 OR creatinase aminopeptidase AND Naegleria fowleri ATCC 30863 |
|
NF0005290 | mRNA1_NF0005290 | 1 | 1 | 1 | | | forward | protein coding | No | 2604 | NF0005290 | endoplasmic reticulum metallopeptidase 1 | endoplasmic reticulum metallopeptidase 1 | | | Not Assigned | Nfow_scaffold00003:275,231..277,834(+) | Nfow_scaffold00003:275231..277834(+) | Nfow_scaffold00003 | Naegleria fowleri ATCC 30863 | 1 | OG6_101747 | 1 | 867 | 2604 | 98328 | 7.46 | 8 | | | | | | | | | | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0005290ORendoplasmic reticulum metallopeptidase 1ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0005290 OR endoplasmic reticulum metallopeptidase 1 AND Naegleria fowleri ATCC 30863 |
|
NF0005860 | mRNA1_NF0005860 | 3 | 1 | 2 | | | reverse | protein coding | No | 1326 | NF0005860 | glutaryl- mitochondrial-like | glutaryl- mitochondrial-like | | | Not Assigned | Nfow_scaffold00003:388,125..389,450(-) | Nfow_scaffold00003:388125..389450(-) | Nfow_scaffold00003 | Naegleria fowleri ATCC 30863 | 2 | OG6_101810 | 0 | 441 | 1326 | 48741 | 8.99 | 0 | | | | | GO:0050660;GO:0016627 | flavin adenine dinucleotide binding;oxidoreductase activity, acting on the CH-CH group of donors | GO:0055114 | oxidation-reduction process | | | | | | | | 1.3.8.6 (Glutaryl-CoA dehydrogenase (ETF)) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0005860ORglutaryl- mitochondrial-likeANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0005860 OR glutaryl- mitochondrial-like AND Naegleria fowleri ATCC 30863 |
|
NF0005940 | mRNA1_NF0005940 | 2 | 2 | 1 | | | forward | protein coding | No | 2817 | NF0005940 | atp-dependent zinc metalloprotease ftsh mitochondrial-like | atp-dependent zinc metalloprotease ftsh mitochondrial-like | | | Not Assigned | Nfow_scaffold00003:402,596..405,478(+) | Nfow_scaffold00003:402596..405478(+) | Nfow_scaffold00003 | Naegleria fowleri ATCC 30863 | 2 | OG6_100384 | 3 | 938 | 2817 | 105210 | 8.52 | 2 | | | GO:0016020 | membrane | GO:0005524;GO:0004222 | ATP binding;metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0005940ORatp-dependent zinc metalloprotease ftsh mitochondrial-likeANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0005940 OR atp-dependent zinc metalloprotease ftsh mitochondrial-like AND Naegleria fowleri ATCC 30863 |
|
NF0005950 | mRNA1_NF0005950 | 3 | 3 | 1 | | | reverse | protein coding | No | 1284 | NF0005950 | gpi-anchor transamidase-like isoform x1 | gpi-anchor transamidase-like isoform x1 | | | Not Assigned | Nfow_scaffold00003:405,556..406,993(-) | Nfow_scaffold00003:405556..406993(-) | Nfow_scaffold00003 | Naegleria fowleri ATCC 30863 | 10 | OG6_101767 | 0 | 427 | 1284 | 48939 | 6.46 | 1 | HMM: MTTSSSHRGNDQSSNNRRSTSVFFIVLIITSIIIIISVRAQ, NN: MTTSSSHRGNDQSSNNRRSTSVFFIVLIITSIIIIISVRAQ | NN Sum: 3, NN D: .5, HMM Prob: .01 | | | GO:0008233 | peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.-.-.- (Hydrolases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0005950ORgpi-anchor transamidase-like isoform x1ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0005950 OR gpi-anchor transamidase-like isoform x1 AND Naegleria fowleri ATCC 30863 |
|
NF0006690 | mRNA1_NF0006690 | 1 | 1 | 1 | | | forward | protein coding | No | 2103 | NF0006690 | gamma-glutamyltranspeptidase 1-like | gamma-glutamyltranspeptidase 1-like | | | Not Assigned | Nfow_scaffold00004:118,117..120,219(+) | Nfow_scaffold00004:118117..120219(+) | Nfow_scaffold00004 | Naegleria fowleri ATCC 30863 | 3 | OG6_100578 | 1 | 700 | 2103 | 76618 | 7.35 | 1 | | | | | GO:0036374 | glutathione hydrolase activity | GO:0006751 | glutathione catabolic process | | | | | | | | 2.3.2.2 (Gamma-glutamyltransferase) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0006690ORgamma-glutamyltranspeptidase 1-likeANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0006690 OR gamma-glutamyltranspeptidase 1-like AND Naegleria fowleri ATCC 30863 |
|
NF0007810 | mRNA1_NF0007810 | 2 | 2 | 1 | | | reverse | protein coding | No | 3111 | NF0007810 | fact complex subunit | fact complex subunit | | | Not Assigned | Nfow_scaffold00004:337,908..341,129(-) | Nfow_scaffold00004:337908..341129(-) | Nfow_scaffold00004 | Naegleria fowleri ATCC 30863 | 10 | OG6_102309 | 0 | 1036 | 3111 | 119104 | 4.89 | 0 | | | | | | | | | | | | | | | | 1.1.1.27 (L-lactate dehydrogenase) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0007810ORfact complex subunitANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0007810 OR fact complex subunit AND Naegleria fowleri ATCC 30863 |
|
NF0008250 | mRNA1_NF0008250 | 2 | 2 | 1 | | | reverse | protein coding | No | 696 | NF0008250 | probable microsomal signal peptidase 22kda subunit | probable microsomal signal peptidase 22kda subunit | | | Not Assigned | Nfow_scaffold00004:414,795..415,736(-) | Nfow_scaffold00004:414795..415736(-) | Nfow_scaffold00004 | Naegleria fowleri ATCC 30863 | 9 | OG6_102447 | 0 | 231 | 696 | 27020 | 9.06 | 1 | | | GO:0016021;GO:0005787 | integral component of membrane;signal peptidase complex | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0008250ORprobable microsomal signal peptidase 22kda subunitANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0008250 OR probable microsomal signal peptidase 22kda subunit AND Naegleria fowleri ATCC 30863 |
|
NF0008490 | mRNA1_NF0008490 | 1 | 1 | 1 | | | reverse | protein coding | No | 549 | NF0008490 | calpain family cysteine protease | calpain family cysteine protease | | | Not Assigned | Nfow_scaffold00005:49,707..50,255(-) | Nfow_scaffold00005:49707..50255(-) | Nfow_scaffold00005 | Naegleria fowleri ATCC 30863 | 0 | OG6_298147 | 0 | 182 | 549 | 20529 | 5.86 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NF0008490ORcalpain family cysteine proteaseANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0008490 OR calpain family cysteine protease AND Naegleria fowleri ATCC 30863 |
|
NF0008680 | mRNA1_NF0008680 | 2 | 2 | 1 | | | reverse | protein coding | No | 2523 | NF0008680 | peptidase s10 family protein | peptidase s10 family protein | | | Not Assigned | Nfow_scaffold00005:84,932..87,616(-) | Nfow_scaffold00005:84932..87616(-) | Nfow_scaffold00005 | Naegleria fowleri ATCC 30863 | 0 | OG6_297395 | 0 | 840 | 2523 | 95096 | 6.69 | 2 | | | | | GO:0004185 | serine-type carboxypeptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NF0008680ORpeptidase s10 family proteinANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0008680 OR peptidase s10 family protein AND Naegleria fowleri ATCC 30863 |
|
NF0009150 | mRNA1_NF0009150 | 2 | 2 | 1 | | | forward | protein coding | No | 1185 | NF0009150 | proteasome subunit | proteasome subunit | | | Not Assigned | Nfow_scaffold00005:173,146..174,509(+) | Nfow_scaffold00005:173146..174509(+) | Nfow_scaffold00005 | Naegleria fowleri ATCC 30863 | 10 | OG6_101751 | 0 | 394 | 1185 | 44753 | 9.58 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | | | | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0009150ORproteasome subunitANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0009150 OR proteasome subunit AND Naegleria fowleri ATCC 30863 |
|
NF0009360 | mRNA1_NF0009360 | 2 | 2 | 1 | | | reverse | protein coding | No | 693 | NF0009360 | sentrin-specific protease 8 | sentrin-specific protease 8 | | | Not Assigned | Nfow_scaffold00005:212,273..213,108(-) | Nfow_scaffold00005:212273..213108(-) | Nfow_scaffold00005 | Naegleria fowleri ATCC 30863 | 11 | OG6_103852 | 0 | 230 | 693 | 26701 | 5.00 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0009360ORsentrin-specific protease 8ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0009360 OR sentrin-specific protease 8 AND Naegleria fowleri ATCC 30863 |
|
NF0012410 | mRNA1_NF0012410 | 5 | 5 | 1 | | | forward | protein coding | No | 2685 | NF0012410 | puromycin-sensitive aminopeptidase | puromycin-sensitive aminopeptidase | | | Not Assigned | Nfow_scaffold00007:41,701..44,619(+) | Nfow_scaffold00007:41701..44619(+) | Nfow_scaffold00007 | Naegleria fowleri ATCC 30863 | 11 | OG6_100948 | 0 | 894 | 2685 | 101085 | 4.99 | 0 | | | | | GO:0008237;GO:0008270 | metallopeptidase activity;zinc ion binding | | | | | | | | | | 3.4.11.- (Aminopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0012410ORpuromycin-sensitive aminopeptidaseANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0012410 OR puromycin-sensitive aminopeptidase AND Naegleria fowleri ATCC 30863 |
|
NF0013180 | mRNA1_NF0013180 | 1 | 1 | 1 | | | forward | protein coding | No | 1017 | NF0013180 | peptidase a22b family protein | peptidase a22b family protein | | | Not Assigned | Nfow_scaffold00007:186,658..187,674(+) | Nfow_scaffold00007:186658..187674(+) | Nfow_scaffold00007 | Naegleria fowleri ATCC 30863 | 10 | OG6_102328 | 0 | 338 | 1017 | 37941 | 7.53 | 8 | HMM: METELFTSYIALLIHAVVPI, NN: METELFTSYIALLIHAVVPI | NN Sum: 3, NN D: .46, HMM Prob: .31 | GO:0016021 | integral component of membrane | GO:0004190 | aspartic-type endopeptidase activity | | | | | | | | | | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0013180ORpeptidase a22b family proteinANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0013180 OR peptidase a22b family protein AND Naegleria fowleri ATCC 30863 |
|
NF0013300 | mRNA1_NF0013300 | 1 | 1 | 1 | | | forward | protein coding | No | 756 | NF0013300 | proteasome subunit beta type-6-like | proteasome subunit beta type-6-like | | | Not Assigned | Nfow_scaffold00007:207,024..207,779(+) | Nfow_scaffold00007:207024..207779(+) | Nfow_scaffold00007 | Naegleria fowleri ATCC 30863 | 10 | OG6_101390 | 0 | 251 | 756 | 27502 | 6.34 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0013300ORproteasome subunit beta type-6-likeANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0013300 OR proteasome subunit beta type-6-like AND Naegleria fowleri ATCC 30863 |
|
NF0013330 | mRNA1_NF0013330 | 1 | 1 | 1 | | | forward | protein coding | No | 1059 | NF0013330 | ubiquitin carboxyl-terminal hydrolase family protein | ubiquitin carboxyl-terminal hydrolase family protein | | | Not Assigned | Nfow_scaffold00007:211,708..212,766(+) | Nfow_scaffold00007:211708..212766(+) | Nfow_scaffold00007 | Naegleria fowleri ATCC 30863 | 0 | OG6_296962 | 0 | 352 | 1059 | 40327 | 5.37 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NF0013330ORubiquitin carboxyl-terminal hydrolase family proteinANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0013330 OR ubiquitin carboxyl-terminal hydrolase family protein AND Naegleria fowleri ATCC 30863 |
|
NF0014560 | mRNA1_NF0014560 | 3 | 3 | 1 | | | forward | protein coding | No | 1419 | NF0014560 | ubiquitin carboxyl-terminal hydrolase 6-like | ubiquitin carboxyl-terminal hydrolase 6-like | | | Not Assigned | Nfow_scaffold00008:100,313..101,938(+) | Nfow_scaffold00008:100313..101938(+) | Nfow_scaffold00008 | Naegleria fowleri ATCC 30863 | 1 | OG6_101892 | 0 | 472 | 1419 | 53993 | 5.10 | 0 | | | | | GO:0005515;GO:0036459 | protein binding;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0014560ORubiquitin carboxyl-terminal hydrolase 6-likeANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0014560 OR ubiquitin carboxyl-terminal hydrolase 6-like AND Naegleria fowleri ATCC 30863 |
|
NF0014850 | mRNA1_NF0014850 | 2 | 2 | 1 | | | reverse | protein coding | No | 798 | NF0014850 | proteasome subunit beta type-1-like | proteasome subunit beta type-1-like | | | Not Assigned | Nfow_scaffold00008:181,737..182,713(-) | Nfow_scaffold00008:181737..182713(-) | Nfow_scaffold00008 | Naegleria fowleri ATCC 30863 | 9 | OG6_101631 | 0 | 265 | 798 | 29974 | 9.31 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0014850ORproteasome subunit beta type-1-likeANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0014850 OR proteasome subunit beta type-1-like AND Naegleria fowleri ATCC 30863 |
|
NF0015020 | mRNA1_NF0015020 | 2 | 2 | 1 | | | forward | protein coding | No | 1266 | NF0015020 | 26s protease regulatory subunit 8-like | 26s protease regulatory subunit 8-like | | | Not Assigned | Nfow_scaffold00008:210,284..211,698(+) | Nfow_scaffold00008:210284..211698(+) | Nfow_scaffold00008 | Naegleria fowleri ATCC 30863 | 9 | OG6_101513 | 0 | 421 | 1266 | 46865 | 10.05 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | | | | | | | | 3.6.4.3 (Transferred entry: 5.6.1.1) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0015020OR26s protease regulatory subunit 8-likeANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0015020 OR 26s protease regulatory subunit 8-like AND Naegleria fowleri ATCC 30863 |
|
NF0015380 | mRNA1_NF0015380 | 2 | 2 | 1 | | | reverse | protein coding | No | 1971 | NF0015380 | ubiquitin carboxyl-terminal hydrolase 10 | ubiquitin carboxyl-terminal hydrolase 10 | | | Not Assigned | Nfow_scaffold00008:344,873..346,865(-) | Nfow_scaffold00008:344873..346865(-) | Nfow_scaffold00008 | Naegleria fowleri ATCC 30863 | 10 | OG6_103260 | 0 | 656 | 1971 | 74299 | 9.98 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0015380ORubiquitin carboxyl-terminal hydrolase 10ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0015380 OR ubiquitin carboxyl-terminal hydrolase 10 AND Naegleria fowleri ATCC 30863 |
|
NF0016150 | mRNA1_NF0016150 | 1 | 1 | 1 | | | forward | protein coding | No | 357 | NF0016150 | signal transduction histidine kinase | signal transduction histidine kinase | | | Not Assigned | Nfow_scaffold00009:145,123..145,479(+) | Nfow_scaffold00009:145123..145479(+) | Nfow_scaffold00009 | Naegleria fowleri ATCC 30863 | 0 | OG6_119818 | 0 | 118 | 357 | 13186 | 4.48 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NF0016150ORsignal transduction histidine kinaseANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0016150 OR signal transduction histidine kinase AND Naegleria fowleri ATCC 30863 |
|
NF0016230 | mRNA1_NF0016230 | 1 | 1 | 1 | | | forward | protein coding | No | 1995 | NF0016230 | atp-dependent clp protease atp-binding protein | atp-dependent clp protease atp-binding protein | | | Not Assigned | Nfow_scaffold00009:156,449..158,443(+) | Nfow_scaffold00009:156449..158443(+) | Nfow_scaffold00009 | Naegleria fowleri ATCC 30863 | 0 | OG6_296780 | 0 | 664 | 1995 | 75973 | 8.09 | 1 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NF0016230ORatp-dependent clp protease atp-binding proteinANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0016230 OR atp-dependent clp protease atp-binding protein AND Naegleria fowleri ATCC 30863 |
|
NF0016360 | mRNA1_NF0016360 | 2 | 2 | 1 | | | reverse | protein coding | No | 420 | NF0016360 | autophagy protein | autophagy protein | | | Not Assigned | Nfow_scaffold00009:179,185..179,852(-) | Nfow_scaffold00009:179185..179852(-) | Nfow_scaffold00009 | Naegleria fowleri ATCC 30863 | 11 | OG6_100707 | 1 | 139 | 420 | 15848 | 5.34 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NF0016360ORautophagy proteinANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0016360 OR autophagy protein AND Naegleria fowleri ATCC 30863 |
|
NF0016540 | mRNA1_NF0016540 | 5 | 2 | 3 | | | forward | protein coding | No | 2904 | NF0016540 | protein disaggregation chaperone | protein disaggregation chaperone | | | Not Assigned | Nfow_scaffold00009:213,635..216,622(+) | Nfow_scaffold00009:213635..216622(+) | Nfow_scaffold00009 | Naegleria fowleri ATCC 30863 | 0 | OG6_296066 | 0 | 967 | 2904 | 108428 | 7.61 | 0 | | | | | GO:0005524 | ATP binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NF0016540ORprotein disaggregation chaperoneANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0016540 OR protein disaggregation chaperone AND Naegleria fowleri ATCC 30863 |
|
NF0017120 | mRNA1_NF0017120 | 4 | 4 | 1 | | | reverse | protein coding | No | 1344 | NF0017120 | peptidase s58 | peptidase s58 | | | Not Assigned | Nfow_scaffold00009:334,331..335,908(-) | Nfow_scaffold00009:334331..335908(-) | Nfow_scaffold00009 | Naegleria fowleri ATCC 30863 | 0 | OG6_123077 | 0 | 447 | 1344 | 48550 | 6.41 | 0 | | | | | | | | | | | | | | | | 3.4.11.- (Aminopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0017120ORpeptidase s58ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0017120 OR peptidase s58 AND Naegleria fowleri ATCC 30863 |
|
NF0017520 | mRNA1_NF0017520 | 2 | 2 | 1 | | | forward | protein coding | No | 927 | NF0017520 | ubiquitin carboxyl-terminal hydrolase isozyme l5-like | ubiquitin carboxyl-terminal hydrolase isozyme l5-like | | | Not Assigned | Nfow_scaffold00010:49,818..50,862(+) | Nfow_scaffold00010:49818..50862(+) | Nfow_scaffold00010 | Naegleria fowleri ATCC 30863 | 10 | OG6_102753 | 0 | 308 | 927 | 35254 | 4.68 | 0 | | | GO:0005622 | intracellular | GO:0004843 | thiol-dependent ubiquitin-specific protease activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0017520ORubiquitin carboxyl-terminal hydrolase isozyme l5-likeANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0017520 OR ubiquitin carboxyl-terminal hydrolase isozyme l5-like AND Naegleria fowleri ATCC 30863 |
|
NF0021030 | mRNA1_NF0021030 | 1 | 1 | 1 | | | reverse | protein coding | No | 789 | NF0021030 | proteasome subunit alpha | proteasome subunit alpha | | | Not Assigned | Nfow_scaffold00012:68,287..69,075(-) | Nfow_scaffold00012:68287..69075(-) | Nfow_scaffold00012 | Naegleria fowleri ATCC 30863 | 10 | OG6_102240 | 0 | 262 | 789 | 29231 | 6.54 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0021030ORproteasome subunit alphaANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0021030 OR proteasome subunit alpha AND Naegleria fowleri ATCC 30863 |
|
NF0021160 | mRNA1_NF0021160 | 1 | 1 | 1 | | | reverse | protein coding | No | 1305 | NF0021160 | methionine aminopeptidase | methionine aminopeptidase | | | Not Assigned | Nfow_scaffold00012:87,555..88,859(-) | Nfow_scaffold00012:87555..88859(-) | Nfow_scaffold00012 | Naegleria fowleri ATCC 30863 | 10 | OG6_100815 | 1 | 434 | 1305 | 49462 | 8.04 | 0 | | | | | GO:0004177;GO:0008235 | aminopeptidase activity;metalloexopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0021160ORmethionine aminopeptidaseANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0021160 OR methionine aminopeptidase AND Naegleria fowleri ATCC 30863 |
|
NF0021290 | mRNA1_NF0021290 | 1 | 1 | 1 | | | reverse | protein coding | No | 1848 | NF0021290 | ubiquitin carboxyl-terminal hydrolase 22 | ubiquitin carboxyl-terminal hydrolase 22 | | | Not Assigned | Nfow_scaffold00012:123,859..125,706(-) | Nfow_scaffold00012:123859..125706(-) | Nfow_scaffold00012 | Naegleria fowleri ATCC 30863 | 2 | OG6_102914 | 0 | 615 | 1848 | 70096 | 7.83 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0021290ORubiquitin carboxyl-terminal hydrolase 22ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0021290 OR ubiquitin carboxyl-terminal hydrolase 22 AND Naegleria fowleri ATCC 30863 |
|
NF0021730 | mRNA1_NF0021730 | 2 | 2 | 1 | | | forward | protein coding | No | 1656 | NF0021730 | atp-dependent protease | atp-dependent protease | | | Not Assigned | Nfow_scaffold00012:210,573..212,507(+) | Nfow_scaffold00012:210573..212507(+) | Nfow_scaffold00012 | Naegleria fowleri ATCC 30863 | 1 | OG6_106348 | 0 | 551 | 1656 | 61641 | 8.21 | 0 | | | GO:0009376;GO:0005737 | HslUV protease complex;cytoplasm | GO:0005524;GO:0016887;GO:0070011 | ATP binding;ATPase activity;peptidase activity, acting on L-amino acid peptides | | | | | | | | | | 2.7.1.71 (Shikimate kinase) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0021730ORatp-dependent proteaseANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0021730 OR atp-dependent protease AND Naegleria fowleri ATCC 30863 |
|
NF0022530 | mRNA1_NF0022530 | 2 | 2 | 1 | | | reverse | protein coding | No | 1296 | NF0022530 | 26s protease regulatory subunit 6b homolog | 26s protease regulatory subunit 6b homolog | | | Not Assigned | Nfow_scaffold00013:25,129..26,648(-) | Nfow_scaffold00013:25129..26648(-) | Nfow_scaffold00013 | Naegleria fowleri ATCC 30863 | 10 | OG6_101965 | 0 | 431 | 1296 | 48555 | 5.55 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | | | | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0022530OR26s protease regulatory subunit 6b homologANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0022530 OR 26s protease regulatory subunit 6b homolog AND Naegleria fowleri ATCC 30863 |
|
NF0023550 | mRNA1_NF0023550 | 2 | 2 | 1 | | | forward | protein coding | No | 3279 | NF0023550 | presequence mitochondrial | presequence mitochondrial | | | Not Assigned | Nfow_scaffold00013:248,956..252,353(+) | Nfow_scaffold00013:248956..252353(+) | Nfow_scaffold00013 | Naegleria fowleri ATCC 30863 | 16 | OG6_101809 | 0 | 1092 | 3279 | 124189 | 6.49 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | GO:0006508 | proteolysis | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0023550ORpresequence mitochondrialANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0023550 OR presequence mitochondrial AND Naegleria fowleri ATCC 30863 |
|
NF0023630 | mRNA1_NF0023630 | 3 | 3 | 1 | | | forward | protein coding | No | 1974 | NF0023630 | leukotriene a4 hydrolase | leukotriene a4 hydrolase | | | Not Assigned | Nfow_scaffold00013:268,643..271,004(+) | Nfow_scaffold00013:268643..271004(+) | Nfow_scaffold00013 | Naegleria fowleri ATCC 30863 | 1 | OG6_101703 | 0 | 657 | 1974 | 75570 | 5.52 | 0 | | | | | GO:0005488;GO:0008237;GO:0008270 | binding;metallopeptidase activity;zinc ion binding | | | | | | | | | | 3.3.2.10 (Soluble epoxide hydrolase) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0023630ORleukotriene a4 hydrolaseANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0023630 OR leukotriene a4 hydrolase AND Naegleria fowleri ATCC 30863 |
|
NF0023650 | mRNA1_NF0023650 | 3 | 3 | 1 | | | reverse | protein coding | No | 1125 | NF0023650 | cathepsin b | cathepsin b | | | Not Assigned | Nfow_scaffold00013:274,727..276,152(-) | Nfow_scaffold00013:274727..276152(-) | Nfow_scaffold00013 | Naegleria fowleri ATCC 30863 | 0 | OG6_177845 | 3 | 374 | 1125 | 42080 | 8.40 | 1 | HMM: MLQQLPPTRPHLIILLILILSYSLVLVHAD, NN: MLQQLPPTRPHLIILLILILSYSLVLVHAD | NN Sum: 4, NN D: .9, HMM Prob: .94 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NF0023650ORcathepsin bANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0023650 OR cathepsin b AND Naegleria fowleri ATCC 30863 |
|
NF0023760 | mRNA1_NF0023760 | 2 | 2 | 1 | | | reverse | protein coding | No | 1290 | NF0023760 | archaemetzincin-2 isoform x1 | archaemetzincin-2 isoform x1 | | | Not Assigned | Nfow_scaffold00013:300,810..302,154(-) | Nfow_scaffold00013:300810..302154(-) | Nfow_scaffold00013 | Naegleria fowleri ATCC 30863 | 2 | OG6_104922 | 1 | 429 | 1290 | 50558 | 8.19 | 0 | | | | | GO:0008270 | zinc ion binding | | | | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0023760ORarchaemetzincin-2 isoform x1ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0023760 OR archaemetzincin-2 isoform x1 AND Naegleria fowleri ATCC 30863 |
|
NF0024180 | mRNA1_NF0024180 | 1 | 1 | 1 | | | forward | protein coding | No | 3351 | NF0024180 | peptidase m16 | peptidase m16 | | | Not Assigned | Nfow_scaffold00014:49,302..52,652(+) | Nfow_scaffold00014:49302..52652(+) | Nfow_scaffold00014 | Naegleria fowleri ATCC 30863 | 1 | OG6_110270 | 0 | 1116 | 3351 | 125523 | 6.20 | 1 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0024180ORpeptidase m16ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0024180 OR peptidase m16 AND Naegleria fowleri ATCC 30863 |
|
NF0024260 | mRNA1_NF0024260 | 9 | 8 | 2 | | | reverse | protein coding | No | 1077 | NF0024260 | cathepsin b | cathepsin b | | | Not Assigned | Nfow_scaffold00014:66,935..68,638(-) | Nfow_scaffold00014:66935..68638(-) | Nfow_scaffold00014 | Naegleria fowleri ATCC 30863 | 2 | OG6_101151 | 7 | 358 | 1077 | 39753 | 7.99 | 1 | HMM: SASQSPYSSLQKNMNSRLCLLSVCFFLLVAASSLLHAK, NN: SASQSPYSSLQKNMNSRLCLLSVCFFLLVAAS | NN Sum: 2, NN D: .4, HMM Prob: .97 | | | GO:0004197;GO:0008234 | cysteine-type endopeptidase activity;cysteine-type peptidase activity | GO:0006508;GO:0050790 | proteolysis;regulation of catalytic activity | | | | | | | | 3.4.22.1 (Cathepsin B) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0024260ORcathepsin bANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0024260 OR cathepsin b AND Naegleria fowleri ATCC 30863 |
|
NF0025130 | mRNA1_NF0025130 | 1 | 1 | 1 | | | reverse | protein coding | No | 612 | NF0025130 | thioredoxin family protein | thioredoxin family protein | | | Not Assigned | Nfow_scaffold00014:233,566..234,177(-) | Nfow_scaffold00014:233566..234177(-) | Nfow_scaffold00014 | Naegleria fowleri ATCC 30863 | 0 | OG6_102579 | 0 | 204 | 612 | 22513 | 4.82 | 0 | | | | | | | | | | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0025130ORthioredoxin family proteinANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0025130 OR thioredoxin family protein AND Naegleria fowleri ATCC 30863 |
|
NF0026930 | mRNA1_NF0026930 | 1 | 1 | 1 | | | reverse | protein coding | No | 1359 | NF0026930 | otu-like cysteine protease family protein | otu-like cysteine protease family protein | | | Not Assigned | Nfow_scaffold00015:286,622..287,980(-) | Nfow_scaffold00015:286622..287980(-) | Nfow_scaffold00015 | Naegleria fowleri ATCC 30863 | 0 | OG6_294445 | 0 | 452 | 1359 | 52545 | 8.60 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NF0026930ORotu-like cysteine protease family proteinANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0026930 OR otu-like cysteine protease family protein AND Naegleria fowleri ATCC 30863 |
|
NF0026960 | mRNA1_NF0026960 | 1 | 1 | 1 | | | forward | protein coding | No | 1275 | NF0026960 | rhomboid family protein | rhomboid family protein | | | Not Assigned | Nfow_scaffold00015:294,721..295,995(+) | Nfow_scaffold00015:294721..295995(+) | Nfow_scaffold00015 | Naegleria fowleri ATCC 30863 | 0 | OG6_106921 | 0 | 424 | 1275 | 48542 | 10.53 | 6 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0026960ORrhomboid family proteinANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0026960 OR rhomboid family protein AND Naegleria fowleri ATCC 30863 |
|
NF0028030 | mRNA1_NF0028030 | 2 | 2 | 1 | | | reverse | protein coding | No | 1632 | NF0028030 | predicted protein | predicted protein | | | Not Assigned | Nfow_scaffold00016:199,427..201,207(-) | Nfow_scaffold00016:199427..201207(-) | Nfow_scaffold00016 | Naegleria fowleri ATCC 30863 | 1 | OG6_104880 | 0 | 543 | 1632 | 61235 | 9.51 | 2 | HMM: MKKKSICFFVLILWLLVAIITSTLAA, NN: MKKKSICFFVLILWLLVAIITSTLAA | NN Sum: 4, NN D: .9, HMM Prob: .99 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NF0028030ORpredicted proteinANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0028030 OR predicted protein AND Naegleria fowleri ATCC 30863 |
|
NF0028520 | mRNA1_NF0028520 | 1 | 1 | 1 | | | forward | protein coding | No | 3003 | NF0028520 | peptidase c19 family protein | peptidase c19 family protein | | | Not Assigned | Nfow_scaffold00017:5,233..8,235(+) | Nfow_scaffold00017:5233..8235(+) | Nfow_scaffold00017 | Naegleria fowleri ATCC 30863 | 19 | OG6_101457 | 0 | 1000 | 3003 | 112812 | 9.51 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0028520ORpeptidase c19 family proteinANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0028520 OR peptidase c19 family protein AND Naegleria fowleri ATCC 30863 |
|
NF0028900 | mRNA1_NF0028900 | 6 | 3 | 2 | | | forward | protein coding | No | 858 | NF0028900 | cathepsin f | cathepsin f | | | Not Assigned | Nfow_scaffold00017:81,562..83,334(+) | Nfow_scaffold00017:81562..82731(+) | Nfow_scaffold00017 | Naegleria fowleri ATCC 30863 | 98 | OG6_100116 | 1 | 285 | 858 | 32316 | 9.81 | 1 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0028900ORcathepsin fANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0028900 OR cathepsin f AND Naegleria fowleri ATCC 30863 |
|
NF0028950 | mRNA1_NF0028950 | 1 | 1 | 1 | | | forward | protein coding | No | 2652 | NF0028950 | endoplasmic reticulum metallopeptidase 1 | endoplasmic reticulum metallopeptidase 1 | | | Not Assigned | Nfow_scaffold00017:91,520..94,171(+) | Nfow_scaffold00017:91520..94171(+) | Nfow_scaffold00017 | Naegleria fowleri ATCC 30863 | 1 | OG6_101747 | 1 | 884 | 2652 | 99729 | 8.68 | 9 | HMM: FYMLPQPSNRRSTPTTTSLSPLLTLLLAVLVLTGSYLY, NN: FYMLPQPSNRRSTPTTTSLSPLLTLLLAVLVLTGSYLY | NN Sum: 3, NN D: .49, HMM Prob: .69 | | | | | | | | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0028950ORendoplasmic reticulum metallopeptidase 1ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0028950 OR endoplasmic reticulum metallopeptidase 1 AND Naegleria fowleri ATCC 30863 |
|
NF0030430 | mRNA1_NF0030430 | 1 | 1 | 1 | | | forward | protein coding | No | 576 | NF0030430 | signal peptidase complex catalytic subunit sec11c | signal peptidase complex catalytic subunit sec11c | | | Not Assigned | Nfow_scaffold00018:88,320..88,895(+) | Nfow_scaffold00018:88320..88895(+) | Nfow_scaffold00018 | Naegleria fowleri ATCC 30863 | 11 | OG6_100807 | 0 | 191 | 576 | 21856 | 9.70 | 3 | | | GO:0016020 | membrane | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | | | | | | | | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0030430ORsignal peptidase complex catalytic subunit sec11cANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0030430 OR signal peptidase complex catalytic subunit sec11c AND Naegleria fowleri ATCC 30863 |
|
NF0032000 | mRNA1_NF0032000 | 5 | 4 | 2 | | | forward | protein coding | No | 1410 | NF0032000 | aminoacyl-histidine dipeptidase | aminoacyl-histidine dipeptidase | | | Not Assigned | Nfow_scaffold00019:101,504..103,179(+) | Nfow_scaffold00019:101504..103179(+) | Nfow_scaffold00019 | Naegleria fowleri ATCC 30863 | 19 | OG6_112555 | 0 | 469 | 1410 | 51432 | 5.20 | 1 | | | | | GO:0016787 | hydrolase activity | GO:0008152;GO:0006508 | metabolic process;proteolysis | | | | | | | | 3.4.13.3 (Transferred entry: 3.4.13.18 and 3.4.13.20) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0032000ORaminoacyl-histidine dipeptidaseANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0032000 OR aminoacyl-histidine dipeptidase AND Naegleria fowleri ATCC 30863 |
|
NF0032490 | mRNA1_NF0032490 | 11 | 8 | 3 | | | forward | protein coding | No | 771 | NF0032490 | serine protease family | serine protease family | | | Not Assigned | Nfow_scaffold00019:202,409..203,577(+) | Nfow_scaffold00019:202409..203577(+) | Nfow_scaffold00019 | Naegleria fowleri ATCC 30863 | 0 | OG6_129630 | 3 | 256 | 771 | 29052 | 7.26 | 0 | | | | | GO:0016787 | hydrolase activity | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NF0032490ORserine protease familyANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0032490 OR serine protease family AND Naegleria fowleri ATCC 30863 |
|
NF0034460 | mRNA1_NF0034460 | 2 | 2 | 1 | | | forward | protein coding | No | 1938 | NF0034460 | pheromone processing endoprotease kex2 | pheromone processing endoprotease kex2 | | | Not Assigned | Nfow_scaffold00021:18,723..20,922(+) | Nfow_scaffold00021:18723..20922(+) | Nfow_scaffold00021 | Naegleria fowleri ATCC 30863 | 0 | OG6_105550 | 0 | 645 | 1938 | 69864 | 5.96 | 1 | | | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.21.94 (Proprotein convertase 2) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0034460ORpheromone processing endoprotease kex2ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0034460 OR pheromone processing endoprotease kex2 AND Naegleria fowleri ATCC 30863 |
|
NF0034660 | mRNA1_NF0034660 | 3 | 3 | 1 | | | forward | protein coding | No | 2223 | NF0034660 | creatinase aminopeptidase | creatinase aminopeptidase | | | Not Assigned | Nfow_scaffold00021:51,986..54,399(+) | Nfow_scaffold00021:51986..54399(+) | Nfow_scaffold00021 | Naegleria fowleri ATCC 30863 | 20 | OG6_100896 | 1 | 740 | 2223 | 84003 | 6.56 | 2 | HMM: TTTTTTTTVIPVLCKRRLVSFLLFSIHTILLILLFTPTTTAT, NN: TTTTTTTTVIPVLCKRRLVSFLLFSIHTILLILLFTPTTTAT | NN Sum: 4, NN D: .74, HMM Prob: .83 | | | GO:0016787 | hydrolase activity | | | | | | | | | | 3.4.11.9 (Xaa-Pro aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0034660ORcreatinase aminopeptidaseANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0034660 OR creatinase aminopeptidase AND Naegleria fowleri ATCC 30863 |
|
NF0035040 | mRNA1_NF0035040 | 5 | 5 | 1 | | | forward | protein coding | No | 639 | NF0035040 | cathepsin b | cathepsin b | | | Not Assigned | Nfow_scaffold00021:126,478..127,581(+) | Nfow_scaffold00021:126478..127581(+) | Nfow_scaffold00021 | Naegleria fowleri ATCC 30863 | 0 | OG6_114666 | 0 | 212 | 639 | 23553 | 4.49 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0035040ORcathepsin bANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0035040 OR cathepsin b AND Naegleria fowleri ATCC 30863 |
|
NF0035150 | mRNA1_NF0035150 | 1 | 1 | 1 | | | reverse | protein coding | No | 3723 | NF0035150 | membrane-bound transcription factor site-1 protease | membrane-bound transcription factor site-1 protease | | | Not Assigned | Nfow_scaffold00021:143,660..147,382(-) | Nfow_scaffold00021:143660..147382(-) | Nfow_scaffold00021 | Naegleria fowleri ATCC 30863 | 1 | OG6_105356 | 0 | 1240 | 3723 | 140019 | 7.30 | 2 | | | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.21.66 (Thermitase) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0035150ORmembrane-bound transcription factor site-1 proteaseANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0035150 OR membrane-bound transcription factor site-1 protease AND Naegleria fowleri ATCC 30863 |
|
NF0035530 | mRNA1_NF0035530 | 1 | 1 | 1 | | | forward | protein coding | No | 549 | NF0035530 | probable serine carboxypeptidase cpvl | probable serine carboxypeptidase cpvl | | | Not Assigned | Nfow_scaffold00021:233,908..234,456(+) | Nfow_scaffold00021:233908..234456(+) | Nfow_scaffold00021 | Naegleria fowleri ATCC 30863 | 6 | OG6_100109 | 10 | 182 | 549 | 21203 | 5.20 | 0 | | | | | GO:0004185 | serine-type carboxypeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.16.- (Serine-type carboxypeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0035530ORprobable serine carboxypeptidase cpvlANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0035530 OR probable serine carboxypeptidase cpvl AND Naegleria fowleri ATCC 30863 |
|
NF0036110 | mRNA1_NF0036110 | 10 | 7 | 3 | | | forward | protein coding | No | 837 | NF0036110 | alpha beta hydrolase | alpha beta hydrolase | | | Not Assigned | Nfow_scaffold00022:95,530..97,201(+) | Nfow_scaffold00022:95530..97201(+) | Nfow_scaffold00022 | Naegleria fowleri ATCC 30863 | 0 | OG6_129630 | 3 | 278 | 837 | 31212 | 8.34 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NF0036110ORalpha beta hydrolaseANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0036110 OR alpha beta hydrolase AND Naegleria fowleri ATCC 30863 |
|
NF0036270 | mRNA1_NF0036270 | 7 | 3 | 2 | | | forward | protein coding | No | 606 | NF0036270 | dipeptidyl peptidase 1 | dipeptidyl peptidase 1 | | | Not Assigned | Nfow_scaffold00022:125,342..127,379(+) | Nfow_scaffold00022:125342..126143(+) | Nfow_scaffold00022 | Naegleria fowleri ATCC 30863 | 1 | OG6_103622 | 2 | 201 | 606 | 23152 | 8.37 | 0 | | | | | | | | | | | | | | | | 3.4.14.1 (Dipeptidyl-peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0036270ORdipeptidyl peptidase 1ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0036270 OR dipeptidyl peptidase 1 AND Naegleria fowleri ATCC 30863 |
|
NF0037620 | mRNA1_NF0037620 | 1 | 1 | 1 | | | forward | protein coding | No | 1590 | NF0037620 | probable xaa-pro aminopeptidase 3 isoform x1 | probable xaa-pro aminopeptidase 3 isoform x1 | | | Not Assigned | Nfow_scaffold00023:172,165..173,754(+) | Nfow_scaffold00023:172165..173754(+) | Nfow_scaffold00023 | Naegleria fowleri ATCC 30863 | 2 | OG6_100598 | 0 | 529 | 1590 | 60797 | 7.16 | 0 | | | | | GO:0004177;GO:0030145 | aminopeptidase activity;manganese ion binding | | | | | | | | | | 3.4.11.9 (Xaa-Pro aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0037620ORprobable xaa-pro aminopeptidase 3 isoform x1ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0037620 OR probable xaa-pro aminopeptidase 3 isoform x1 AND Naegleria fowleri ATCC 30863 |
|
NF0037830 | mRNA1_NF0037830 | 3 | 1 | 2 | | | reverse | protein coding | No | 363 | NF0037830 | proteasome subunit beta type-2-like isoform x2 | proteasome subunit beta type-2-like isoform x2 | | | Not Assigned | Nfow_scaffold00023:210,704..211,449(-) | Nfow_scaffold00023:210704..211066(-) | Nfow_scaffold00023 | Naegleria fowleri ATCC 30863 | 10 | OG6_102061 | 0 | 120 | 363 | 14025 | 4.55 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0037830ORproteasome subunit beta type-2-like isoform x2ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0037830 OR proteasome subunit beta type-2-like isoform x2 AND Naegleria fowleri ATCC 30863 |
|
NF0038120 | mRNA1_NF0038120 | 1 | 1 | 1 | | | forward | protein coding | No | 708 | NF0038120 | 26s proteasome non-atpase regulatory subunit 9 | 26s proteasome non-atpase regulatory subunit 9 | | | Not Assigned | Nfow_scaffold00024:29,653..30,360(+) | Nfow_scaffold00024:29653..30360(+) | Nfow_scaffold00024 | Naegleria fowleri ATCC 30863 | 10 | OG6_102356 | 0 | 235 | 708 | 26377 | 5.90 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0038120OR26s proteasome non-atpase regulatory subunit 9ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0038120 OR 26s proteasome non-atpase regulatory subunit 9 AND Naegleria fowleri ATCC 30863 |
|
NF0038980 | mRNA1_NF0038980 | 1 | 1 | 1 | | | forward | protein coding | No | 1995 | NF0038980 | thimet oligopeptidase | thimet oligopeptidase | | | Not Assigned | Nfow_scaffold00024:204,070..206,064(+) | Nfow_scaffold00024:204070..206064(+) | Nfow_scaffold00024 | Naegleria fowleri ATCC 30863 | 22 | OG6_100561 | 0 | 664 | 1995 | 76805 | 5.24 | 0 | | | | | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.24.15 (Thimet oligopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0038980ORthimet oligopeptidaseANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0038980 OR thimet oligopeptidase AND Naegleria fowleri ATCC 30863 |
|
NF0039260 | mRNA1_NF0039260 | 3 | 3 | 1 | | | forward | protein coding | No | 1350 | NF0039260 | 26s protease regulatory subunit 7-like | 26s protease regulatory subunit 7-like | | | Not Assigned | Nfow_scaffold00025:22,860..24,550(+) | Nfow_scaffold00025:22860..24550(+) | Nfow_scaffold00025 | Naegleria fowleri ATCC 30863 | 11 | OG6_101899 | 0 | 449 | 1350 | 50730 | 5.23 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | | | | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0039260OR26s protease regulatory subunit 7-likeANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0039260 OR 26s protease regulatory subunit 7-like AND Naegleria fowleri ATCC 30863 |
|
NF0039810 | mRNA1_NF0039810 | 2 | 2 | 1 | | | forward | protein coding | No | 1062 | NF0039810 | probable 26s proteasome non-atpase regulatory subunit 8a | probable 26s proteasome non-atpase regulatory subunit 8a | | | Not Assigned | Nfow_scaffold00025:161,836..163,192(+) | Nfow_scaffold00025:161836..163192(+) | Nfow_scaffold00025 | Naegleria fowleri ATCC 30863 | 9 | OG6_102054 | 0 | 353 | 1062 | 40251 | 6.31 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 3.1.3.16 (Protein-serine/threonine phosphatase) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0039810ORprobable 26s proteasome non-atpase regulatory subunit 8aANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0039810 OR probable 26s proteasome non-atpase regulatory subunit 8a AND Naegleria fowleri ATCC 30863 |
|
NF0040310 | mRNA1_NF0040310 | 2 | 2 | 1 | | | forward | protein coding | No | 3000 | NF0040310 | ubiquitin carboxyl-terminal hydrolase 4 isoform x4 | ubiquitin carboxyl-terminal hydrolase 4 isoform x4 | | | Not Assigned | Nfow_scaffold00026:31,259..34,316(+) | Nfow_scaffold00026:31259..34316(+) | Nfow_scaffold00026 | Naegleria fowleri ATCC 30863 | 13 | OG6_100913 | 1 | 999 | 3000 | 114309 | 5.09 | 0 | | | | | GO:0004843;GO:0036459 | thiol-dependent ubiquitin-specific protease activity;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0040310ORubiquitin carboxyl-terminal hydrolase 4 isoform x4ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0040310 OR ubiquitin carboxyl-terminal hydrolase 4 isoform x4 AND Naegleria fowleri ATCC 30863 |
|
NF0041990 | mRNA1_NF0041990 | 3 | 1 | 2 | | | reverse | protein coding | No | 1341 | NF0041990 | phospholipase a-2-activating | phospholipase a-2-activating | | | Not Assigned | Nfow_scaffold00027:163,542..166,218(-) | Nfow_scaffold00027:163542..164882(-) | Nfow_scaffold00027 | Naegleria fowleri ATCC 30863 | 5 | OG6_103952 | 0 | 446 | 1341 | 51483 | 7.66 | 0 | | | | | | | | | | | | | | | | 3.5.1.52 (Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0041990ORphospholipase a-2-activatingANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0041990 OR phospholipase a-2-activating AND Naegleria fowleri ATCC 30863 |
|
NF0043020 | mRNA1_NF0043020 | 1 | 1 | 1 | | | reverse | protein coding | No | 723 | NF0043020 | proteasome subunit alpha type-2-b-like | proteasome subunit alpha type-2-b-like | | | Not Assigned | Nfow_scaffold00028:159,216..159,938(-) | Nfow_scaffold00028:159216..159938(-) | Nfow_scaffold00028 | Naegleria fowleri ATCC 30863 | 11 | OG6_101969 | 0 | 240 | 723 | 26464 | 7.87 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0043020ORproteasome subunit alpha type-2-b-likeANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0043020 OR proteasome subunit alpha type-2-b-like AND Naegleria fowleri ATCC 30863 |
|
NF0043300 | mRNA1_NF0043300 | 1 | 1 | 1 | | | reverse | protein coding | No | 3528 | NF0043300 | cytosolic endo-beta-n-acetylglucosaminidase | cytosolic endo-beta-n-acetylglucosaminidase | | | Not Assigned | Nfow_scaffold00028:209,037..212,564(-) | Nfow_scaffold00028:209037..212564(-) | Nfow_scaffold00028 | Naegleria fowleri ATCC 30863 | 0 | OG6_104188 | 0 | 1175 | 3528 | 137332 | 6.56 | 0 | | | GO:0005737 | cytoplasm | GO:0033925 | mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase activity | | | | | | | | | | 3.2.1.96 (Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0043300ORcytosolic endo-beta-n-acetylglucosaminidaseANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0043300 OR cytosolic endo-beta-n-acetylglucosaminidase AND Naegleria fowleri ATCC 30863 |
|
NF0044390 | mRNA1_NF0044390 | 5 | 4 | 2 | | | reverse | protein coding | No | 2157 | NF0044390 | endopeptidase atp-dependent hsl atp-binding subunit | endopeptidase atp-dependent hsl atp-binding subunit | | | Not Assigned | Nfow_scaffold00029:211,775..214,272(-) | Nfow_scaffold00029:211775..214272(-) | Nfow_scaffold00029 | Naegleria fowleri ATCC 30863 | 0 | OG6_101643 | 0 | 718 | 2157 | 80510 | 6.93 | 0 | | | GO:0009376;GO:0005737 | HslUV protease complex;cytoplasm | GO:0005524;GO:0016887;GO:0070011 | ATP binding;ATPase activity;peptidase activity, acting on L-amino acid peptides | | | | | | | | | | 3.4.21.- (Serine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0044390ORendopeptidase atp-dependent hsl atp-binding subunitANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0044390 OR endopeptidase atp-dependent hsl atp-binding subunit AND Naegleria fowleri ATCC 30863 |
|
NF0044480 | mRNA1_NF0044480 | 1 | 1 | 1 | | | forward | protein coding | No | 1071 | NF0044480 | peptidase c26 family protein | peptidase c26 family protein | | | Not Assigned | Nfow_scaffold00030:23,825..24,895(+) | Nfow_scaffold00030:23825..24895(+) | Nfow_scaffold00030 | Naegleria fowleri ATCC 30863 | 3 | OG6_101559 | 1 | 356 | 1071 | 40269 | 7.83 | 1 | HMM: KKMATPKSLSFTIIGTTKAFLLLLLVVTGAVILPFCDST, NN: KKMATPKSLSFTIIGTTKAFLLLLLVVTGAV | NN Sum: 4, NN D: .58, HMM Prob: .89 | | | GO:0016787;GO:0008242 | hydrolase activity;omega peptidase activity | | | | | | | | | | 3.4.19.9 (Folate gamma-glutamyl hydrolase) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0044480ORpeptidase c26 family proteinANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0044480 OR peptidase c26 family protein AND Naegleria fowleri ATCC 30863 |
|
NF0044530 | mRNA1_NF0044530 | 1 | 1 | 1 | | | reverse | protein coding | No | 2469 | NF0044530 | mitochondrial intermediate peptidase-like | mitochondrial intermediate peptidase-like | | | Not Assigned | Nfow_scaffold00030:34,818..37,286(-) | Nfow_scaffold00030:34818..37286(-) | Nfow_scaffold00030 | Naegleria fowleri ATCC 30863 | 0 | OG6_295579 | 0 | 822 | 2469 | 93059 | 9.48 | 0 | | | | | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NF0044530ORmitochondrial intermediate peptidase-likeANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0044530 OR mitochondrial intermediate peptidase-like AND Naegleria fowleri ATCC 30863 |
|
NF0044810 | mRNA1_NF0044810 | 6 | 1 | 3 | | | forward | protein coding | No | 381 | NF0044810 | probable serine protease eda2 | probable serine protease eda2 | | | Not Assigned | Nfow_scaffold00030:81,468..83,397(+) | Nfow_scaffold00030:81468..81848(+) | Nfow_scaffold00030 | Naegleria fowleri ATCC 30863 | 23 | OG6_100644 | 1 | 126 | 381 | 14936 | 9.26 | 1 | HMM: MQGNSRLFFFVLTILSFVMMTLEPYHHHGAVHAS, NN: MQGNSRLFFFVLTILSFVMMTL | NN Sum: 4, NN D: .72, HMM Prob: .71 | | | | | | | | | | | | | | 3.4.16.2 (Lysosomal Pro-Xaa carboxypeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0044810ORprobable serine protease eda2ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0044810 OR probable serine protease eda2 AND Naegleria fowleri ATCC 30863 |
|
NF0045250 | mRNA1_NF0045250 | 1 | 1 | 1 | | | forward | protein coding | No | 1668 | NF0045250 | sentrin-specific protease 1 | sentrin-specific protease 1 | | | Not Assigned | Nfow_scaffold00030:148,380..150,047(+) | Nfow_scaffold00030:148380..150047(+) | Nfow_scaffold00030 | Naegleria fowleri ATCC 30863 | 8 | OG6_101235 | 0 | 555 | 1668 | 65272 | 9.47 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.68 (Ulp1 peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0045250ORsentrin-specific protease 1ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0045250 OR sentrin-specific protease 1 AND Naegleria fowleri ATCC 30863 |
|
NF0046080 | mRNA1_NF0046080 | 1 | 1 | 1 | | | forward | protein coding | No | 2565 | NF0046080 | atpase aaa | atpase aaa | | | Not Assigned | Nfow_scaffold00031:81,207..83,771(+) | Nfow_scaffold00031:81207..83771(+) | Nfow_scaffold00031 | Naegleria fowleri ATCC 30863 | 58 | OG6_100223 | 1 | 854 | 2565 | 96748 | 8.92 | 0 | | | | | GO:0005524 | ATP binding | | | | | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0046080ORatpase aaaANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0046080 OR atpase aaa AND Naegleria fowleri ATCC 30863 |
|
NF0046120 | mRNA1_NF0046120 | 2 | 2 | 1 | | | forward | protein coding | No | 609 | NF0046120 | oxidative-stress-resistance chaperone | oxidative-stress-resistance chaperone | | | Not Assigned | Nfow_scaffold00031:87,983..88,703(+) | Nfow_scaffold00031:87983..88703(+) | Nfow_scaffold00031 | Naegleria fowleri ATCC 30863 | 10 | OG6_101257 | 0 | 202 | 609 | 22056 | 7.67 | 0 | | | | | | | | | | | | | | | | 2.7.1.50 (Hydroxyethylthiazole kinase) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0046120ORoxidative-stress-resistance chaperoneANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0046120 OR oxidative-stress-resistance chaperone AND Naegleria fowleri ATCC 30863 |
|
NF0046960 | mRNA1_NF0046960 | 4 | 3 | 2 | | | reverse | protein coding | No | 840 | NF0046960 | ubiquitin thioesterase otu1 | ubiquitin thioesterase otu1 | | | Not Assigned | Nfow_scaffold00032:58,108..59,097(-) | Nfow_scaffold00032:58108..59097(-) | Nfow_scaffold00032 | Naegleria fowleri ATCC 30863 | 11 | OG6_102949 | 0 | 279 | 840 | 31122 | 6.62 | 0 | | | | | | | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0046960ORubiquitin thioesterase otu1ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0046960 OR ubiquitin thioesterase otu1 AND Naegleria fowleri ATCC 30863 |
|
NF0047050 | mRNA1_NF0047050 | 6 | 6 | 1 | | | forward | protein coding | No | 1473 | NF0047050 | peptidase s10 family protein | peptidase s10 family protein | | | Not Assigned | Nfow_scaffold00032:75,841..77,688(+) | Nfow_scaffold00032:75841..77688(+) | Nfow_scaffold00032 | Naegleria fowleri ATCC 30863 | 6 | OG6_100109 | 10 | 490 | 1473 | 55528 | 7.72 | 1 | HMM: TSPLQKKMTKLSQLLESHSRASACLVSLWLILVLVMFTQIEAQ, NN: TSPLQKKMTKLSQLLESHSRASACLVSLWLILVLVMFTQIEAQ | NN Sum: 3, NN D: .56, HMM Prob: .73 | | | GO:0004185 | serine-type carboxypeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.16.- (Serine-type carboxypeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0047050ORpeptidase s10 family proteinANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0047050 OR peptidase s10 family protein AND Naegleria fowleri ATCC 30863 |
|
NF0048060 | mRNA1_NF0048060 | 7 | 7 | 1 | | | forward | protein coding | No | 1665 | NF0048060 | dipeptidyl peptidase 1-like | dipeptidyl peptidase 1-like | | | Not Assigned | Nfow_scaffold00033:97,414..99,770(+) | Nfow_scaffold00033:97414..99770(+) | Nfow_scaffold00033 | Naegleria fowleri ATCC 30863 | 1 | OG6_103622 | 3 | 554 | 1665 | 62961 | 8.10 | 1 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.14.1 (Dipeptidyl-peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0048060ORdipeptidyl peptidase 1-likeANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0048060 OR dipeptidyl peptidase 1-like AND Naegleria fowleri ATCC 30863 |
|
NF0048760 | mRNA1_NF0048760 | 7 | 5 | 2 | | | reverse | protein coding | No | 1791 | NF0048760 | leucine aminopeptidase | leucine aminopeptidase | | | Not Assigned | Nfow_scaffold00034:78,391..80,622(-) | Nfow_scaffold00034:78391..80622(-) | Nfow_scaffold00034 | Naegleria fowleri ATCC 30863 | 1 | OG6_100682 | 1 | 596 | 1791 | 66440 | 7.32 | 0 | | | GO:0005622 | intracellular | GO:0004177 | aminopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.11.1 (Leucyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0048760ORleucine aminopeptidaseANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0048760 OR leucine aminopeptidase AND Naegleria fowleri ATCC 30863 |
|
NF0048890 | mRNA1_NF0048890 | 2 | 2 | 1 | 698 | | forward | protein coding | No | 3293 | NF0048890 | presequence mitochondrial-like isoform x2 | presequence mitochondrial-like isoform x2 | | | Not Assigned | Nfow_scaffold00034:103,039..106,386(+) | Nfow_scaffold00034:103039..105688(+) | Nfow_scaffold00034 | Naegleria fowleri ATCC 30863 | 0 | OG6_298083 | 0 | 864 | 2595 | 100658 | 5.82 | 1 | HMM: MSIQWFLFVASLIPLLLGVYLY, NN: MSIQWFLFVASLIPLLLGV | NN Sum: 4, NN D: .86, HMM Prob: .97 | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NF0048890ORpresequence mitochondrial-like isoform x2ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0048890 OR presequence mitochondrial-like isoform x2 AND Naegleria fowleri ATCC 30863 |
|
NF0049560 | mRNA1_NF0049560 | 1 | 1 | 1 | | | reverse | protein coding | No | 816 | NF0049560 | proteasome subunit alpha type-3 isoform x1 | proteasome subunit alpha type-3 isoform x1 | | | Not Assigned | Nfow_scaffold00035:25,095..25,910(-) | Nfow_scaffold00035:25095..25910(-) | Nfow_scaffold00035 | Naegleria fowleri ATCC 30863 | 11 | OG6_102011 | 0 | 271 | 816 | 30064 | 5.66 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0049560ORproteasome subunit alpha type-3 isoform x1ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0049560 OR proteasome subunit alpha type-3 isoform x1 AND Naegleria fowleri ATCC 30863 |
|
NF0051410 | mRNA1_NF0051410 | 1 | 1 | 1 | 817 | | forward | protein coding | No | 1690 | NF0051410 | hypothetical protein NAEGRDRAFT 80571 | hypothetical protein NAEGRDRAFT 80571 | | | Not Assigned | Nfow_scaffold00037:67,728..69,417(+) | Nfow_scaffold00037:67728..68600(+) | Nfow_scaffold00037 | Naegleria fowleri ATCC 30863 | 0 | OG6_102202 | 0 | 290 | 873 | 32878 | 6.01 | 0 | | | | | GO:1990380;GO:0004843 | Lys48-specific deubiquitinase activity;thiol-dependent ubiquitin-specific protease activity | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0051410ORhypothetical protein NAEGRDRAFT 80571ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0051410 OR hypothetical protein NAEGRDRAFT 80571 AND Naegleria fowleri ATCC 30863 |
|
NF0051700 | mRNA1_NF0051700 | 2 | 2 | 1 | | | forward | protein coding | No | 1596 | NF0051700 | peptidase m32 carboxypeptidase taq metallopeptidase | peptidase m32 carboxypeptidase taq metallopeptidase | | | Not Assigned | Nfow_scaffold00037:125,304..127,071(+) | Nfow_scaffold00037:125304..127071(+) | Nfow_scaffold00037 | Naegleria fowleri ATCC 30863 | 0 | OG6_105939 | 0 | 531 | 1596 | 60927 | 6.34 | 0 | | | | | GO:0004181 | metallocarboxypeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.17.19 (Carboxypeptidase Taq) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0051700ORpeptidase m32 carboxypeptidase taq metallopeptidaseANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0051700 OR peptidase m32 carboxypeptidase taq metallopeptidase AND Naegleria fowleri ATCC 30863 |
|
NF0052020 | mRNA1_NF0052020 | 1 | 1 | 1 | | | forward | protein coding | No | 699 | NF0052020 | mitochondrial inner membrane protease atp23-like | mitochondrial inner membrane protease atp23-like | | | Not Assigned | Nfow_scaffold00037:175,483..176,181(+) | Nfow_scaffold00037:175483..176181(+) | Nfow_scaffold00037 | Naegleria fowleri ATCC 30863 | 0 | OG6_102968 | 0 | 232 | 699 | 26092 | 6.69 | 0 | | | | | GO:0004222 | metalloendopeptidase activity | | | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0052020ORmitochondrial inner membrane protease atp23-likeANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0052020 OR mitochondrial inner membrane protease atp23-like AND Naegleria fowleri ATCC 30863 |
|
NF0052090 | mRNA1_NF0052090 | 1 | 1 | 1 | | | reverse | protein coding | No | 1782 | NF0052090 | dipeptidyl peptidase 1 | dipeptidyl peptidase 1 | | | Not Assigned | Nfow_scaffold00038:33..1,814(-) | Nfow_scaffold00038:33..1814(-) | Nfow_scaffold00038 | Naegleria fowleri ATCC 30863 | 11 | OG6_139514 | 0 | 593 | 1782 | 68101 | 7.36 | 1 | HMM: LLNHSQHLFKKMTLMQGHNAIKASSSSPFRTTALLFVVSLIILIVIIGMVVEVLAD, NN: LLNHSQHLFKKMTLMQGHNAIKASSSSPFRTTALLFVVSLIILIVIIGMVVEVLAD | NN Sum: 3, NN D: .44, HMM Prob: .03 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.16 (Cathepsin H) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0052090ORdipeptidyl peptidase 1ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0052090 OR dipeptidyl peptidase 1 AND Naegleria fowleri ATCC 30863 |
|
NF0052240 | mRNA1_NF0052240 | 1 | 1 | 1 | | | reverse | protein coding | No | 1092 | NF0052240 | embryonic stem cell-specific 5-hydroxymethylcytosine-binding | embryonic stem cell-specific 5-hydroxymethylcytosine-binding | | | Not Assigned | Nfow_scaffold00038:21,277..22,368(-) | Nfow_scaffold00038:21277..22368(-) | Nfow_scaffold00038 | Naegleria fowleri ATCC 30863 | 3 | OG6_102318 | 0 | 363 | 1092 | 41242 | 7.54 | 0 | | | | | | | | | | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0052240ORembryonic stem cell-specific 5-hydroxymethylcytosine-bindingANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0052240 OR embryonic stem cell-specific 5-hydroxymethylcytosine-binding AND Naegleria fowleri ATCC 30863 |
|
NF0052280 | mRNA1_NF0052280 | 1 | 1 | 1 | | | reverse | protein coding | No | 1362 | NF0052280 | 26s proteasome regulatory subunit 4 homolog b-like | 26s proteasome regulatory subunit 4 homolog b-like | | | Not Assigned | Nfow_scaffold00038:28,864..30,225(-) | Nfow_scaffold00038:28864..30225(-) | Nfow_scaffold00038 | Naegleria fowleri ATCC 30863 | 10 | OG6_101477 | 0 | 453 | 1362 | 50810 | 8.68 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | | | | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0052280OR26s proteasome regulatory subunit 4 homolog b-likeANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0052280 OR 26s proteasome regulatory subunit 4 homolog b-like AND Naegleria fowleri ATCC 30863 |
|
NF0052360 | mRNA1_NF0052360 | 3 | 3 | 1 | | | forward | protein coding | No | 2220 | NF0052360 | membrane aaa-metalloprotease | membrane aaa-metalloprotease | | | Not Assigned | Nfow_scaffold00038:49,625..52,047(+) | Nfow_scaffold00038:49625..52047(+) | Nfow_scaffold00038 | Naegleria fowleri ATCC 30863 | 0 | OG6_101196 | 0 | 739 | 2220 | 82186 | 8.68 | 1 | | | GO:0016020 | membrane | GO:0005524;GO:0004222 | ATP binding;metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0052360ORmembrane aaa-metalloproteaseANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0052360 OR membrane aaa-metalloprotease AND Naegleria fowleri ATCC 30863 |
|
NF0052750 | mRNA1_NF0052750 | 1 | 1 | 1 | | 386 | reverse | protein coding | No | 1073 | NF0052750 | ubiquitin carboxyl-terminal hydrolase 2-like | ubiquitin carboxyl-terminal hydrolase 2-like | | | Not Assigned | Nfow_scaffold00038:119,200..120,272(-) | Nfow_scaffold00038:119200..119886(-) | Nfow_scaffold00038 | Naegleria fowleri ATCC 30863 | 0 | OG6_297653 | 0 | 228 | 687 | 26654 | 6.77 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NF0052750ORubiquitin carboxyl-terminal hydrolase 2-likeANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0052750 OR ubiquitin carboxyl-terminal hydrolase 2-like AND Naegleria fowleri ATCC 30863 |
|
NF0053400 | mRNA1_NF0053400 | 1 | 1 | 1 | | | reverse | protein coding | No | 567 | NF0053400 | desumoylating isopeptidase 2 | desumoylating isopeptidase 2 | | | Not Assigned | Nfow_scaffold00039:59,411..59,977(-) | Nfow_scaffold00039:59411..59977(-) | Nfow_scaffold00039 | Naegleria fowleri ATCC 30863 | 0 | OG6_298687 | 0 | 188 | 567 | 21360 | 9.52 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NF0053400ORdesumoylating isopeptidase 2ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0053400 OR desumoylating isopeptidase 2 AND Naegleria fowleri ATCC 30863 |
|
NF0053860 | mRNA1_NF0053860 | 3 | 3 | 1 | | | reverse | protein coding | No | 1818 | NF0053860 | cysteine protease atg4b | cysteine protease atg4b | | | Not Assigned | Nfow_scaffold00039:153,020..155,069(-) | Nfow_scaffold00039:153020..155069(-) | Nfow_scaffold00039 | Naegleria fowleri ATCC 30863 | 13 | OG6_100501 | 0 | 605 | 1818 | 68103 | 5.25 | 0 | | | | | | | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0053860ORcysteine protease atg4bANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0053860 OR cysteine protease atg4b AND Naegleria fowleri ATCC 30863 |
|
NF0053960 | mRNA1_NF0053960 | 1 | 1 | 1 | | | reverse | protein coding | No | 2286 | NF0053960 | mitochondrial intermediate | mitochondrial intermediate | | | Not Assigned | Nfow_scaffold00039:170,543..172,828(-) | Nfow_scaffold00039:170543..172828(-) | Nfow_scaffold00039 | Naegleria fowleri ATCC 30863 | 1 | OG6_102110 | 0 | 761 | 2286 | 88432 | 6.88 | 0 | | | | | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.24.59 (Mitochondrial intermediate peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0053960ORmitochondrial intermediateANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0053960 OR mitochondrial intermediate AND Naegleria fowleri ATCC 30863 |
|
NF0054840 | mRNA1_NF0054840 | 2 | 2 | 1 | | | reverse | protein coding | No | 1188 | NF0054840 | cathepsin d | cathepsin d | | | Not Assigned | Nfow_scaffold00040:182,409..183,655(-) | Nfow_scaffold00040:182409..183655(-) | Nfow_scaffold00040 | Naegleria fowleri ATCC 30863 | 0 | OG6_296279 | 0 | 395 | 1188 | 43963 | 6.65 | 1 | HMM: KMKQPFSLFLFALCIIAFCSSAMMSLATAR, NN: KMKQPFSLFLFALCIIAFCSSA | NN Sum: 4, NN D: .79, HMM Prob: 1 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NF0054840ORcathepsin dANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0054840 OR cathepsin d AND Naegleria fowleri ATCC 30863 |
|
NF0056250 | mRNA1_NF0056250 | 3 | 2 | 2 | | | forward | protein coding | No | 3615 | NF0056250 | wd repeat-containing protein 65 | wd repeat-containing protein 65 | | | Not Assigned | Nfow_scaffold00042:105,046..108,722(+) | Nfow_scaffold00042:105046..108722(+) | Nfow_scaffold00042 | Naegleria fowleri ATCC 30863 | 0 | OG6_102663 | 0 | 1204 | 3615 | 138563 | 6.70 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NF0056250ORwd repeat-containing protein 65ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0056250 OR wd repeat-containing protein 65 AND Naegleria fowleri ATCC 30863 |
|
NF0056400 | mRNA1_NF0056400 | 2 | 2 | 1 | 346 | 263 | forward | protein coding | No | 1632 | NF0056400 | hypothetical protein KAFR 0A07120 | hypothetical protein KAFR 0A07120 | | | Not Assigned | Nfow_scaffold00042:140,524..142,271(+) | Nfow_scaffold00042:140787..141925(+) | Nfow_scaffold00042 | Naegleria fowleri ATCC 30863 | 2 | OG6_101151 | 8 | 340 | 1023 | 37296 | 7.95 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.1 (Cathepsin B) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0056400ORhypothetical protein KAFR 0A07120ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0056400 OR hypothetical protein KAFR 0A07120 AND Naegleria fowleri ATCC 30863 |
|
NF0056430 | mRNA1_NF0056430 | 1 | 1 | 1 | | | reverse | protein coding | No | 711 | NF0056430 | cathepsin b | cathepsin b | | | Not Assigned | Nfow_scaffold00042:145,289..145,999(-) | Nfow_scaffold00042:145289..145999(-) | Nfow_scaffold00042 | Naegleria fowleri ATCC 30863 | 2 | OG6_101151 | 8 | 236 | 711 | 25465 | 5.59 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.1 (Cathepsin B) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0056430ORcathepsin bANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0056430 OR cathepsin b AND Naegleria fowleri ATCC 30863 |
|
NF0056560 | mRNA1_NF0056560 | 4 | 4 | 1 | | | forward | protein coding | No | 1107 | NF0056560 | rhomboid-like protein 15 | rhomboid-like protein 15 | | | Not Assigned | Nfow_scaffold00043:18,487..20,045(+) | Nfow_scaffold00043:18487..20045(+) | Nfow_scaffold00043 | Naegleria fowleri ATCC 30863 | 11 | OG6_103838 | 1 | 368 | 1107 | 41291 | 8.88 | 6 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0056560ORrhomboid-like protein 15ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0056560 OR rhomboid-like protein 15 AND Naegleria fowleri ATCC 30863 |
|
NF0057220 | mRNA1_NF0057220 | 2 | 2 | 1 | | | reverse | protein coding | No | 2310 | NF0057220 | acylamino-acid-releasing enzyme-like isoform x2 | acylamino-acid-releasing enzyme-like isoform x2 | | | Not Assigned | Nfow_scaffold00044:47,108..49,469(-) | Nfow_scaffold00044:47108..49469(-) | Nfow_scaffold00044 | Naegleria fowleri ATCC 30863 | 0 | OG6_102438 | 0 | 769 | 2310 | 86594 | 6.39 | 0 | | | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.19.1 (Acylaminoacyl-peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0057220ORacylamino-acid-releasing enzyme-like isoform x2ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0057220 OR acylamino-acid-releasing enzyme-like isoform x2 AND Naegleria fowleri ATCC 30863 |
|
NF0057860 | mRNA1_NF0057860 | 1 | 1 | 1 | | | forward | protein coding | No | 1011 | NF0057860 | ubiquitin thioesterase virion core protein | ubiquitin thioesterase virion core protein | | | Not Assigned | Nfow_scaffold00045:13,987..14,997(+) | Nfow_scaffold00045:13987..14997(+) | Nfow_scaffold00045 | Naegleria fowleri ATCC 30863 | 0 | OG6_297402 | 0 | 336 | 1011 | 38777 | 10.11 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NF0057860ORubiquitin thioesterase virion core proteinANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0057860 OR ubiquitin thioesterase virion core protein AND Naegleria fowleri ATCC 30863 |
|
NF0058120 | mRNA1_NF0058120 | 4 | 3 | 2 | | | reverse | protein coding | No | 2292 | NF0058120 | uncharacterized aarf domain-containing protein kinase 1 isoform x1 | uncharacterized aarf domain-containing protein kinase 1 isoform x1 | | | Not Assigned | Nfow_scaffold00045:66,431..68,956(-) | Nfow_scaffold00045:66431..68956(-) | Nfow_scaffold00045 | Naegleria fowleri ATCC 30863 | 3 | OG6_100510 | 6 | 763 | 2292 | 88771 | 9.00 | 1 | | | | | | | | | | | | | | | | 2.7.-.- (Transferring phosphorus-containing groups.) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0058120ORuncharacterized aarf domain-containing protein kinase 1 isoform x1ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0058120 OR uncharacterized aarf domain-containing protein kinase 1 isoform x1 AND Naegleria fowleri ATCC 30863 |
|
NF0058650 | mRNA1_NF0058650 | 2 | 2 | 1 | | | reverse | protein coding | No | 2859 | NF0058650 | insulin-degrading enzyme | insulin-degrading enzyme | | | Not Assigned | Nfow_scaffold00045:160,604..163,531(-) | Nfow_scaffold00045:160604..163531(-) | Nfow_scaffold00045 | Naegleria fowleri ATCC 30863 | 1 | OG6_100422 | 1 | 952 | 2859 | 111858 | 6.83 | 0 | HMM: MLYISIMILFMVHNIINDIVIVGH, NN: MLYISIMILFMVHNIINDI | NN Sum: 2, NN D: .52, HMM Prob: 0 | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.56 (Insulysin) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0058650ORinsulin-degrading enzymeANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0058650 OR insulin-degrading enzyme AND Naegleria fowleri ATCC 30863 |
|
NF0059180 | mRNA1_NF0059180 | 3 | 1 | 2 | | | reverse | protein coding | No | 807 | NF0059180 | proteasome subunit beta type-4 | proteasome subunit beta type-4 | | | Not Assigned | Nfow_scaffold00046:93,078..94,087(-) | Nfow_scaffold00046:93078..93884(-) | Nfow_scaffold00046 | Naegleria fowleri ATCC 30863 | 11 | OG6_101718 | 0 | 268 | 807 | 30633 | 5.88 | 1 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0059180ORproteasome subunit beta type-4ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0059180 OR proteasome subunit beta type-4 AND Naegleria fowleri ATCC 30863 |
|
NF0059840 | mRNA1_NF0059840 | 2 | 2 | 1 | 76 | | forward | protein coding | No | 2845 | NF0059840 | puromycin-sensitive aminopeptidase | puromycin-sensitive aminopeptidase | | | Not Assigned | Nfow_scaffold00047:62,425..65,334(+) | Nfow_scaffold00047:62425..65258(+) | Nfow_scaffold00047 | Naegleria fowleri ATCC 30863 | 0 | OG6_299513 | 0 | 922 | 2769 | 105298 | 5.96 | 1 | | | | | GO:0008237;GO:0008270 | metallopeptidase activity;zinc ion binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NF0059840ORpuromycin-sensitive aminopeptidaseANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0059840 OR puromycin-sensitive aminopeptidase AND Naegleria fowleri ATCC 30863 |
|
NF0060520 | mRNA1_NF0060520 | 2 | 2 | 1 | | | forward | protein coding | No | 891 | NF0060520 | derlin-2-like | derlin-2-like | | | Not Assigned | Nfow_scaffold00048:40,099..41,065(+) | Nfow_scaffold00048:40099..41065(+) | Nfow_scaffold00048 | Naegleria fowleri ATCC 30863 | 10 | OG6_101672 | 0 | 296 | 891 | 34698 | 5.15 | 4 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NF0060520ORderlin-2-likeANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0060520 OR derlin-2-like AND Naegleria fowleri ATCC 30863 |
|
NF0060530 | mRNA1_NF0060530 | 1 | 1 | 1 | | | reverse | protein coding | No | 1266 | NF0060530 | 3-hydroxyisobutyryl- mitochondrial-like | 3-hydroxyisobutyryl- mitochondrial-like | | | Not Assigned | Nfow_scaffold00048:41,120..42,385(-) | Nfow_scaffold00048:41120..42385(-) | Nfow_scaffold00048 | Naegleria fowleri ATCC 30863 | 2 | OG6_102025 | 2 | 421 | 1266 | 47365 | 8.74 | 0 | | | | | GO:0003860 | 3-hydroxyisobutyryl-CoA hydrolase activity | | | | | | | | | | 3.1.2.4 (3-hydroxyisobutyryl-CoA hydrolase) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0060530OR3-hydroxyisobutyryl- mitochondrial-likeANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0060530 OR 3-hydroxyisobutyryl- mitochondrial-like AND Naegleria fowleri ATCC 30863 |
|
NF0060580 | mRNA1_NF0060580 | 1 | 1 | 1 | | 2 | forward | protein coding | No | 2618 | NF0060580 | serine carboxypeptidase-like 50 | serine carboxypeptidase-like 50 | | | Not Assigned | Nfow_scaffold00048:47,929..50,546(+) | Nfow_scaffold00048:47931..50546(+) | Nfow_scaffold00048 | Naegleria fowleri ATCC 30863 | 0 | OG6_297367 | 0 | 871 | 2616 | 99762 | 7.11 | 3 | | | | | GO:0004185 | serine-type carboxypeptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NF0060580ORserine carboxypeptidase-like 50ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0060580 OR serine carboxypeptidase-like 50 AND Naegleria fowleri ATCC 30863 |
|
NF0060860 | mRNA1_NF0060860 | 8 | 1 | 3 | | 1 | forward | protein coding | No | 292 | NF0060860 | serine carboxypeptidase-like 20-like | serine carboxypeptidase-like 20-like | | | Not Assigned | Nfow_scaffold00048:100,420..102,385(+) | Nfow_scaffold00048:100421..100711(+) | Nfow_scaffold00048 | Naegleria fowleri ATCC 30863 | 6 | OG6_100109 | 8 | 96 | 291 | 11249 | 9.80 | 2 | HMM: QKKMKLRETVFVSLWLVSFIMMMRYVNGQ, NN: QKKMKLRETVFVSLWLVSFIMMMRYVNGQ | NN Sum: 4, NN D: .88, HMM Prob: .95 | | | GO:0004185 | serine-type carboxypeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.16.- (Serine-type carboxypeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0060860ORserine carboxypeptidase-like 20-likeANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0060860 OR serine carboxypeptidase-like 20-like AND Naegleria fowleri ATCC 30863 |
|
NF0061630 | mRNA1_NF0061630 | 4 | 4 | 1 | | | reverse | protein coding | No | 2214 | NF0061630 | leishmanolysin peptidase | leishmanolysin peptidase | | | Not Assigned | Nfow_scaffold00049:95,971..98,671(-) | Nfow_scaffold00049:95971..98671(-) | Nfow_scaffold00049 | Naegleria fowleri ATCC 30863 | 0 | OG6_101184 | 0 | 737 | 2214 | 83101 | 7.01 | 2 | | | GO:0016020 | membrane | GO:0004222 | metalloendopeptidase activity | GO:0007155;GO:0006508 | cell adhesion;proteolysis | | | | | | | | 3.4.24.36 (Leishmanolysin) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0061630ORleishmanolysin peptidaseANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0061630 OR leishmanolysin peptidase AND Naegleria fowleri ATCC 30863 |
|
NF0062180 | mRNA1_NF0062180 | 2 | 2 | 1 | | | forward | protein coding | No | 1515 | NF0062180 | acetylornithine deacetylase | acetylornithine deacetylase | | | Not Assigned | Nfow_scaffold00050:42,558..44,151(+) | Nfow_scaffold00050:42558..44151(+) | Nfow_scaffold00050 | Naegleria fowleri ATCC 30863 | 19 | OG6_100626 | 2 | 504 | 1515 | 56122 | 6.31 | 1 | HMM: MLKQGRPQQVQLAIPPMLIITGAILLLLLLLLVHHSDVVVHSE, NN: MLKQGRPQQVQLAIPPMLIITGAILLLLLLLLVHHSDVVVHSE | NN Sum: 2, NN D: .49, HMM Prob: .71 | | | GO:0016787 | hydrolase activity | GO:0008152 | metabolic process | | | | | | | | 3.5.1.16 (Acetylornithine deacetylase) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0062180ORacetylornithine deacetylaseANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0062180 OR acetylornithine deacetylase AND Naegleria fowleri ATCC 30863 |
|
NF0063990 | mRNA1_NF0063990 | 2 | 2 | 1 | | | forward | protein coding | No | 1728 | NF0063990 | acidic repeat-containing protein | acidic repeat-containing protein | | | Not Assigned | Nfow_scaffold00052:94,930..96,771(+) | Nfow_scaffold00052:94930..96771(+) | Nfow_scaffold00052 | Naegleria fowleri ATCC 30863 | 1 | OG6_105344 | 0 | 575 | 1728 | 66029 | 6.48 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NF0063990ORacidic repeat-containing proteinANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0063990 OR acidic repeat-containing protein AND Naegleria fowleri ATCC 30863 |
|
NF0064770 | mRNA1_NF0064770 | 1 | 1 | 1 | | | forward | protein coding | No | 1071 | NF0064770 | ring finger protein 5-like | ring finger protein 5-like | | | Not Assigned | Nfow_scaffold00053:87,473..88,543(+) | Nfow_scaffold00053:87473..88543(+) | Nfow_scaffold00053 | Naegleria fowleri ATCC 30863 | 10 | OG6_102074 | 0 | 356 | 1071 | 38543 | 4.71 | 2 | | | | | | | | | | | | | | | | 6.3.2.19 (Transferred entry: 2.3.2.23, 2.3.2.27 and 6.2.1.45) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0064770ORring finger protein 5-likeANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0064770 OR ring finger protein 5-like AND Naegleria fowleri ATCC 30863 |
|
NF0065490 | mRNA1_NF0065490 | 2 | 2 | 1 | | | forward | protein coding | No | 2748 | NF0065490 | heat shock protein 101 | heat shock protein 101 | | | Not Assigned | Nfow_scaffold00054:68,388..71,189(+) | Nfow_scaffold00054:68388..71189(+) | Nfow_scaffold00054 | Naegleria fowleri ATCC 30863 | 58 | OG6_100223 | 1 | 915 | 2748 | 102882 | 7.15 | 0 | | | | | GO:0005524 | ATP binding | GO:0019538 | protein metabolic process | | | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0065490ORheat shock protein 101ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0065490 OR heat shock protein 101 AND Naegleria fowleri ATCC 30863 |
|
NF0067330 | mRNA1_NF0067330 | 1 | 1 | 1 | | | forward | protein coding | No | 1650 | NF0067330 | probable trna n6-adenosine mitochondrial | probable trna n6-adenosine mitochondrial | | | Not Assigned | Nfow_scaffold00057:7,885..9,534(+) | Nfow_scaffold00057:7885..9534(+) | Nfow_scaffold00057 | Naegleria fowleri ATCC 30863 | 11 | OG6_100288 | 1 | 549 | 1650 | 61968 | 8.95 | 0 | | | | | | | | | | | | | | | | 2.3.1.234 (N(6)-L-threonylcarbamoyladenine synthase) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0067330ORprobable trna n6-adenosine mitochondrialANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0067330 OR probable trna n6-adenosine mitochondrial AND Naegleria fowleri ATCC 30863 |
|
NF0067420 | mRNA1_NF0067420 | 1 | 1 | 1 | | | forward | protein coding | No | 990 | NF0067420 | predicted protein | predicted protein | | | Not Assigned | Nfow_scaffold00057:29,177..30,166(+) | Nfow_scaffold00057:29177..30166(+) | Nfow_scaffold00057 | Naegleria fowleri ATCC 30863 | 0 | OG6_106560 | 0 | 329 | 990 | 37916 | 6.51 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NF0067420ORpredicted proteinANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0067420 OR predicted protein AND Naegleria fowleri ATCC 30863 |
|
NF0067670 | mRNA1_NF0067670 | 4 | 4 | 1 | | | forward | protein coding | No | 1272 | NF0067670 | dipeptidyl peptidase 1-like | dipeptidyl peptidase 1-like | | | Not Assigned | Nfow_scaffold00057:79,238..80,692(+) | Nfow_scaffold00057:79238..80692(+) | Nfow_scaffold00057 | Naegleria fowleri ATCC 30863 | 1 | OG6_103622 | 3 | 423 | 1272 | 48287 | 8.08 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.14.1 (Dipeptidyl-peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0067670ORdipeptidyl peptidase 1-likeANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0067670 OR dipeptidyl peptidase 1-like AND Naegleria fowleri ATCC 30863 |
|
NF0068050 | mRNA1_NF0068050 | 4 | 3 | 2 | | | reverse | protein coding | No | 2088 | NF0068050 | serine esterase | serine esterase | | | Not Assigned | Nfow_scaffold00058:5,595..8,021(-) | Nfow_scaffold00058:5595..8021(-) | Nfow_scaffold00058 | Naegleria fowleri ATCC 30863 | 0 | OG6_124529 | 0 | 695 | 2088 | 79200 | 7.73 | 1 | HMM: NLQKMHYFGIENHHRSVLWCPMMILLLFLLLVGVASSS, NN: NLQKMHYFGIENHHRSVLWCPMMILLLFLLLVGVASSS | NN Sum: 4, NN D: .61, HMM Prob: .88 | | | GO:0008239;GO:0016787 | dipeptidyl-peptidase activity;hydrolase activity | | | | | | | | | | 3.1.1.- (Carboxylic ester hydrolases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0068050ORserine esteraseANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0068050 OR serine esterase AND Naegleria fowleri ATCC 30863 |
|
NF0068180 | mRNA1_NF0068180 | 3 | 3 | 1 | | | reverse | protein coding | No | 1050 | NF0068180 | cysteine proteinase rd19a-like | cysteine proteinase rd19a-like | | | Not Assigned | Nfow_scaffold00058:29,558..30,870(-) | Nfow_scaffold00058:29558..30870(-) | Nfow_scaffold00058 | Naegleria fowleri ATCC 30863 | 98 | OG6_100116 | 2 | 349 | 1050 | 39091 | 7.35 | 0 | HMM: MRSLLIAAVLLIACVGVVLAQ, NN: MRSLLIAAVLLIACVGVVLAQ | NN Sum: 4, NN D: .94, HMM Prob: 1 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0068180ORcysteine proteinase rd19a-likeANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0068180 OR cysteine proteinase rd19a-like AND Naegleria fowleri ATCC 30863 |
|
NF0068410 | mRNA1_NF0068410 | 1 | 1 | 1 | | | forward | protein coding | No | 945 | NF0068410 | cysteine proteinase | cysteine proteinase | | | Not Assigned | Nfow_scaffold00058:71,865..72,809(+) | Nfow_scaffold00058:71865..72809(+) | Nfow_scaffold00058 | Naegleria fowleri ATCC 30863 | 0 | OG6_299021 | 0 | 314 | 945 | 36113 | 6.24 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NF0068410ORcysteine proteinaseANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0068410 OR cysteine proteinase AND Naegleria fowleri ATCC 30863 |
|
NF0068700 | mRNA1_NF0068700 | 4 | 4 | 1 | | 748 | reverse | protein coding | No | 2845 | NF0068700 | regulator of nonsense transcripts upf2-like isoform x2 | regulator of nonsense transcripts upf2-like isoform x2 | | | Not Assigned | Nfow_scaffold00058:132,925..135,986(-) | Nfow_scaffold00058:132925..135071(-) | Nfow_scaffold00058 | Naegleria fowleri ATCC 30863 | 1 | OG6_103377 | 0 | 698 | 2097 | 81038 | 5.55 | 0 | | | | | GO:0003723;GO:0005488;GO:0005515 | RNA binding;binding;protein binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NF0068700ORregulator of nonsense transcripts upf2-like isoform x2ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0068700 OR regulator of nonsense transcripts upf2-like isoform x2 AND Naegleria fowleri ATCC 30863 |
|
NF0068880 | mRNA1_NF0068880 | 3 | 2 | 2 | | 232 | forward | protein coding | No | 1327 | NF0068880 | 3-hydroxyisobutyryl- mitochondrial | 3-hydroxyisobutyryl- mitochondrial | | | Not Assigned | Nfow_scaffold00059:23,862..25,293(+) | Nfow_scaffold00059:24094..25293(+) | Nfow_scaffold00059 | Naegleria fowleri ATCC 30863 | 2 | OG6_102025 | 1 | 364 | 1095 | 41670 | 9.10 | 0 | | | | | GO:0003860 | 3-hydroxyisobutyryl-CoA hydrolase activity | | | | | | | | | | 3.1.2.4 (3-hydroxyisobutyryl-CoA hydrolase) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0068880OR3-hydroxyisobutyryl- mitochondrialANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0068880 OR 3-hydroxyisobutyryl- mitochondrial AND Naegleria fowleri ATCC 30863 |
|
NF0068990 | mRNA1_NF0068990 | 1 | 1 | 1 | | | forward | protein coding | No | 1740 | NF0068990 | metalloendopeptidase zinc ion binding protein | metalloendopeptidase zinc ion binding protein | | | Not Assigned | Nfow_scaffold00059:48,663..50,402(+) | Nfow_scaffold00059:48663..50402(+) | Nfow_scaffold00059 | Naegleria fowleri ATCC 30863 | 99 | OG6_101715 | 1 | 579 | 1740 | 64132 | 7.05 | 0 | | | GO:0016020 | membrane | GO:0004222 | metalloendopeptidase activity | GO:0007155;GO:0006508 | cell adhesion;proteolysis | | | | | | | | 3.4.24.36 (Leishmanolysin) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0068990ORmetalloendopeptidase zinc ion binding proteinANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0068990 OR metalloendopeptidase zinc ion binding protein AND Naegleria fowleri ATCC 30863 |
|
NF0069190 | mRNA1_NF0069190 | 4 | 4 | 1 | | | forward | protein coding | No | 1350 | NF0069190 | cathepsin b | cathepsin b | | | Not Assigned | Nfow_scaffold00059:117,368..119,138(+) | Nfow_scaffold00059:117368..119138(+) | Nfow_scaffold00059 | Naegleria fowleri ATCC 30863 | 2 | OG6_101151 | 8 | 449 | 1350 | 51606 | 8.16 | 1 | HMM: MMIVPPTNKTIVSFILLLIILTFVSCR, NN: MMIVPPTNKTIVSFILLLIILTFVSCR | NN Sum: 4, NN D: .79, HMM Prob: .94 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.1 (Cathepsin B) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0069190ORcathepsin bANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0069190 OR cathepsin b AND Naegleria fowleri ATCC 30863 |
|
NF0070010 | mRNA1_NF0070010 | 1 | 1 | 1 | | 52 | forward | protein coding | No | 1357 | NF0070010 | dna damage-inducible protein 1-like | dna damage-inducible protein 1-like | | | Not Assigned | Nfow_scaffold00061:15,520..16,876(+) | Nfow_scaffold00061:15572..16876(+) | Nfow_scaffold00061 | Naegleria fowleri ATCC 30863 | 8 | OG6_101685 | 0 | 434 | 1305 | 48577 | 6.68 | 0 | | | | | GO:0004190;GO:0005515 | aspartic-type endopeptidase activity;protein binding | GO:0006508 | proteolysis | | | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0070010ORdna damage-inducible protein 1-likeANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0070010 OR dna damage-inducible protein 1-like AND Naegleria fowleri ATCC 30863 |
|
NF0070730 | mRNA1_NF0070730 | 3 | 3 | 1 | | | forward | protein coding | No | 1368 | NF0070730 | methionine aminopeptidase | methionine aminopeptidase | | | Not Assigned | Nfow_scaffold00062:33,366..35,074(+) | Nfow_scaffold00062:33366..35074(+) | Nfow_scaffold00062 | Naegleria fowleri ATCC 30863 | 2 | OG6_100342 | 0 | 455 | 1368 | 52438 | 8.12 | 0 | | | | | GO:0004177;GO:0008235 | aminopeptidase activity;metalloexopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0070730ORmethionine aminopeptidaseANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0070730 OR methionine aminopeptidase AND Naegleria fowleri ATCC 30863 |
|
NF0070800 | mRNA1_NF0070800 | 4 | 4 | 1 | | | reverse | protein coding | No | 2811 | NF0070800 | calpain family cysteine protease containing protein | calpain family cysteine protease containing protein | | | Not Assigned | Nfow_scaffold00062:44,546..47,735(-) | Nfow_scaffold00062:44546..47735(-) | Nfow_scaffold00062 | Naegleria fowleri ATCC 30863 | 0 | OG6_210915 | 1 | 936 | 2811 | 105021 | 5.58 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NF0070800ORcalpain family cysteine protease containing proteinANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0070800 OR calpain family cysteine protease containing protein AND Naegleria fowleri ATCC 30863 |
|
NF0071030 | mRNA1_NF0071030 | 1 | 1 | 1 | | | forward | protein coding | No | 2355 | NF0071030 | uncharacterized aarf domain-containing protein kinase 1 | uncharacterized aarf domain-containing protein kinase 1 | | | Not Assigned | Nfow_scaffold00062:99,446..101,800(+) | Nfow_scaffold00062:99446..101800(+) | Nfow_scaffold00062 | Naegleria fowleri ATCC 30863 | 3 | OG6_100510 | 7 | 784 | 2355 | 89784 | 8.44 | 1 | | | | | | | | | | | | | | | | 2.7.-.- (Transferring phosphorus-containing groups.) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0071030ORuncharacterized aarf domain-containing protein kinase 1ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0071030 OR uncharacterized aarf domain-containing protein kinase 1 AND Naegleria fowleri ATCC 30863 |
|
NF0073410 | mRNA1_NF0073410 | 1 | 1 | 1 | | | forward | protein coding | No | 765 | NF0073410 | 20s proteasome alpha subunit f | 20s proteasome alpha subunit f | | | Not Assigned | Nfow_scaffold00066:28,543..29,307(+) | Nfow_scaffold00066:28543..29307(+) | Nfow_scaffold00066 | Naegleria fowleri ATCC 30863 | 10 | OG6_102143 | 0 | 254 | 765 | 28339 | 8.67 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0073410OR20s proteasome alpha subunit fANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0073410 OR 20s proteasome alpha subunit f AND Naegleria fowleri ATCC 30863 |
|
NF0073490 | mRNA1_NF0073490 | 1 | 1 | 1 | | | reverse | protein coding | No | 2394 | NF0073490 | prolyl endopeptidase-like | prolyl endopeptidase-like | | | Not Assigned | Nfow_scaffold00066:52,291..54,684(-) | Nfow_scaffold00066:52291..54684(-) | Nfow_scaffold00066 | Naegleria fowleri ATCC 30863 | 1 | OG6_101804 | 0 | 797 | 2394 | 90887 | 6.29 | 0 | | | | | GO:0004252;GO:0070008;GO:0008236 | serine-type endopeptidase activity;serine-type exopeptidase activity;serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.21.26 (Prolyl oligopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0073490ORprolyl endopeptidase-likeANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0073490 OR prolyl endopeptidase-like AND Naegleria fowleri ATCC 30863 |
|
NF0073860 | mRNA1_NF0073860 | 3 | 3 | 1 | | | reverse | protein coding | No | 1143 | NF0073860 | archaemetzincin-2-like isoform x1 | archaemetzincin-2-like isoform x1 | | | Not Assigned | Nfow_scaffold00066:119,810..121,280(-) | Nfow_scaffold00066:119810..121280(-) | Nfow_scaffold00066 | Naegleria fowleri ATCC 30863 | 2 | OG6_104922 | 1 | 380 | 1143 | 44300 | 9.01 | 0 | | | | | GO:0008270 | zinc ion binding | | | | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0073860ORarchaemetzincin-2-like isoform x1ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0073860 OR archaemetzincin-2-like isoform x1 AND Naegleria fowleri ATCC 30863 |
|
NF0074780 | mRNA1_NF0074780 | 5 | 2 | 2 | | | forward | protein coding | No | 717 | NF0074780 | peptidase m20 | peptidase m20 | | | Not Assigned | Nfow_scaffold00068:63,808..65,730(+) | Nfow_scaffold00068:63808..64662(+) | Nfow_scaffold00068 | Naegleria fowleri ATCC 30863 | 2 | OG6_100503 | 0 | 238 | 717 | 27358 | 6.58 | 0 | | | | | | | | | | | | | | | | 3.4.13.20 (Beta-Ala-His dipeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0074780ORpeptidase m20ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0074780 OR peptidase m20 AND Naegleria fowleri ATCC 30863 |
|
NF0075050 | mRNA1_NF0075050 | 5 | 4 | 2 | | | reverse | protein coding | No | 1272 | NF0075050 | cathepsin b | cathepsin b | | | Not Assigned | Nfow_scaffold00068:117,391..118,878(-) | Nfow_scaffold00068:117391..118878(-) | Nfow_scaffold00068 | Naegleria fowleri ATCC 30863 | 0 | OG6_177845 | 2 | 423 | 1272 | 48186 | 9.14 | 1 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NF0075050ORcathepsin bANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0075050 OR cathepsin b AND Naegleria fowleri ATCC 30863 |
|
NF0075070 | mRNA1_NF0075070 | 1 | 1 | 1 | | | forward | protein coding | No | 3273 | NF0075070 | predicted protein | predicted protein | | | Not Assigned | Nfow_scaffold00068:121,082..124,354(+) | Nfow_scaffold00068:121082..124354(+) | Nfow_scaffold00068 | Naegleria fowleri ATCC 30863 | 0 | OG6_105738 | 0 | 1090 | 3273 | 125152 | 4.93 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.56 (Insulysin) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0075070ORpredicted proteinANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0075070 OR predicted protein AND Naegleria fowleri ATCC 30863 |
|
NF0075570 | mRNA1_NF0075570 | 6 | 1 | 3 | | | forward | protein coding | No | 357 | NF0075570 | dihydroxy-acid dehydratase | dihydroxy-acid dehydratase | | | Not Assigned | Nfow_scaffold00069:102,747..103,775(+) | Nfow_scaffold00069:102747..103103(+) | Nfow_scaffold00069 | Naegleria fowleri ATCC 30863 | 0 | OG6_177888 | 1 | 118 | 357 | 13971 | 6.78 | 0 | | | | | | | | | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0075570ORdihydroxy-acid dehydrataseANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0075570 OR dihydroxy-acid dehydratase AND Naegleria fowleri ATCC 30863 |
|
NF0075900 | mRNA1_NF0075900 | 1 | 1 | 1 | | | forward | protein coding | No | 1554 | NF0075900 | peptidase t | peptidase t | | | Not Assigned | Nfow_scaffold00070:21,235..22,788(+) | Nfow_scaffold00070:21235..22788(+) | Nfow_scaffold00070 | Naegleria fowleri ATCC 30863 | 19 | OG6_111055 | 0 | 517 | 1554 | 58043 | 6.25 | 1 | HMM: MFSKVKVFFCLLVLLMLVMKALLCSSS, NN: MFSKVKVFFCLLVLLMLVMKALLC | NN Sum: 4, NN D: .72, HMM Prob: 1 | GO:0005737 | cytoplasm | GO:0045148;GO:0008270 | tripeptide aminopeptidase activity;zinc ion binding | GO:0006518 | peptide metabolic process | | | | | | | | 3.4.11.4 (Tripeptide aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0075900ORpeptidase tANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0075900 OR peptidase t AND Naegleria fowleri ATCC 30863 |
|
NF0076070 | mRNA1_NF0076070 | 1 | 1 | 1 | | | reverse | protein coding | No | 861 | NF0076070 | ubiquitin thioesterase otub1-like | ubiquitin thioesterase otub1-like | | | Not Assigned | Nfow_scaffold00070:52,860..53,720(-) | Nfow_scaffold00070:52860..53720(-) | Nfow_scaffold00070 | Naegleria fowleri ATCC 30863 | 1 | OG6_102549 | 0 | 286 | 861 | 33405 | 4.87 | 0 | | | | | | | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0076070ORubiquitin thioesterase otub1-likeANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0076070 OR ubiquitin thioesterase otub1-like AND Naegleria fowleri ATCC 30863 |
|
NF0076380 | mRNA1_NF0076380 | 2 | 2 | 1 | | | reverse | protein coding | No | 1221 | NF0076380 | sec-c motif-containing protein otu-like cysteine protease family protein | sec-c motif-containing protein otu-like cysteine protease family protein | | | Not Assigned | Nfow_scaffold00070:117,405..118,812(-) | Nfow_scaffold00070:117405..118812(-) | Nfow_scaffold00070 | Naegleria fowleri ATCC 30863 | 1 | OG6_104209 | 0 | 407 | 1221 | 46071 | 4.98 | 0 | | | | | | | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0076380ORsec-c motif-containing protein otu-like cysteine protease family proteinANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0076380 OR sec-c motif-containing protein otu-like cysteine protease family protein AND Naegleria fowleri ATCC 30863 |
|
NF0076600 | mRNA1_NF0076600 | 6 | 5 | 2 | | | reverse | protein coding | No | 2160 | NF0076600 | uncharacterized aarf domain-containing protein kinase 5-like isoform x3 | uncharacterized aarf domain-containing protein kinase 5-like isoform x3 | | | Not Assigned | Nfow_scaffold00071:22,694..25,476(-) | Nfow_scaffold00071:22694..25476(-) | Nfow_scaffold00071 | Naegleria fowleri ATCC 30863 | 3 | OG6_100510 | 6 | 719 | 2160 | 83694 | 8.69 | 2 | | | | | | | | | | | | | | | | 2.7.-.- (Transferring phosphorus-containing groups.) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0076600ORuncharacterized aarf domain-containing protein kinase 5-like isoform x3ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0076600 OR uncharacterized aarf domain-containing protein kinase 5-like isoform x3 AND Naegleria fowleri ATCC 30863 |
|
NF0076640 | mRNA1_NF0076640 | 1 | 1 | 1 | | | reverse | protein coding | No | 933 | NF0076640 | 26s proteasome non-atpase regulatory subunit 14 | 26s proteasome non-atpase regulatory subunit 14 | | | Not Assigned | Nfow_scaffold00071:36,034..36,966(-) | Nfow_scaffold00071:36034..36966(-) | Nfow_scaffold00071 | Naegleria fowleri ATCC 30863 | 10 | OG6_101835 | 0 | 310 | 933 | 34857 | 7.08 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0076640OR26s proteasome non-atpase regulatory subunit 14ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0076640 OR 26s proteasome non-atpase regulatory subunit 14 AND Naegleria fowleri ATCC 30863 |
|
NF0077300 | mRNA1_NF0077300 | 1 | 1 | 1 | | | reverse | protein coding | No | 831 | NF0077300 | atp-dependent protease subunit | atp-dependent protease subunit | | | Not Assigned | Nfow_scaffold00072:39,400..40,230(-) | Nfow_scaffold00072:39400..40230(-) | Nfow_scaffold00072 | Naegleria fowleri ATCC 30863 | 1 | OG6_107204 | 0 | 276 | 831 | 30109 | 8.46 | 0 | | | GO:0009376;GO:0005839 | HslUV protease complex;proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0006508;GO:0051603 | proteolysis;proteolysis involved in cellular protein catabolic process | | | | | | | | 3.4.25.2 (HslU--HslV peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0077300ORatp-dependent protease subunitANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0077300 OR atp-dependent protease subunit AND Naegleria fowleri ATCC 30863 |
|
NF0077320 | mRNA1_NF0077320 | 1 | 1 | 1 | | | reverse | protein coding | No | 954 | NF0077320 | proliferation-associated protein 2g4 | proliferation-associated protein 2g4 | | | Not Assigned | Nfow_scaffold00072:41,643..42,596(-) | Nfow_scaffold00072:41643..42596(-) | Nfow_scaffold00072 | Naegleria fowleri ATCC 30863 | 10 | OG6_101895 | 0 | 317 | 954 | 35355 | 7.90 | 0 | | | | | | | | | | | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0077320ORproliferation-associated protein 2g4ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0077320 OR proliferation-associated protein 2g4 AND Naegleria fowleri ATCC 30863 |
|
NF0077780 | mRNA1_NF0077780 | 3 | 3 | 1 | | | reverse | protein coding | No | 2007 | NF0077780 | peptidase s15 | peptidase s15 | | | Not Assigned | Nfow_scaffold00073:20,213..22,524(-) | Nfow_scaffold00073:20213..22524(-) | Nfow_scaffold00073 | Naegleria fowleri ATCC 30863 | 0 | OG6_111836 | 0 | 668 | 2007 | 76076 | 6.88 | 1 | | | | | GO:0008239;GO:0016787 | dipeptidyl-peptidase activity;hydrolase activity | | | | | | | | | | 3.1.1.43 (Alpha-amino-acid esterase) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0077780ORpeptidase s15ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0077780 OR peptidase s15 AND Naegleria fowleri ATCC 30863 |
|
NF0079280 | mRNA1_NF0079280 | 1 | 1 | 1 | | | forward | protein coding | No | 1932 | NF0079280 | briggsae cbr-mppa-1 protein | briggsae cbr-mppa-1 protein | | | Not Assigned | Nfow_scaffold00075:97,305..99,236(+) | Nfow_scaffold00075:97305..99236(+) | Nfow_scaffold00075 | Naegleria fowleri ATCC 30863 | 1 | OG6_102381 | 0 | 643 | 1932 | 72517 | 7.33 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0079280ORbriggsae cbr-mppa-1 proteinANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0079280 OR briggsae cbr-mppa-1 protein AND Naegleria fowleri ATCC 30863 |
|
NF0080120 | mRNA1_NF0080120 | 2 | 2 | 1 | | | reverse | protein coding | No | 1557 | NF0080120 | membrane dipeptidase | membrane dipeptidase | | | Not Assigned | Nfow_scaffold00077:15,518..17,387(-) | Nfow_scaffold00077:15518..17387(-) | Nfow_scaffold00077 | Naegleria fowleri ATCC 30863 | 1 | OG6_102004 | 0 | 518 | 1557 | 57731 | 8.95 | 1 | | | | | GO:0016805 | dipeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.13.19 (Membrane dipeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0080120ORmembrane dipeptidaseANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0080120 OR membrane dipeptidase AND Naegleria fowleri ATCC 30863 |
|
NF0080710 | mRNA1_NF0080710 | 1 | 1 | 1 | | | forward | protein coding | No | 771 | NF0080710 | proteasome subunit alpha type 5 | proteasome subunit alpha type 5 | | | Not Assigned | Nfow_scaffold00078:41,466..42,236(+) | Nfow_scaffold00078:41466..42236(+) | Nfow_scaffold00078 | Naegleria fowleri ATCC 30863 | 7 | OG6_101621 | 0 | 256 | 771 | 28021 | 4.53 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0080710ORproteasome subunit alpha type 5ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0080710 OR proteasome subunit alpha type 5 AND Naegleria fowleri ATCC 30863 |
|
NF0080940 | mRNA1_NF0080940 | 1 | 1 | 1 | | | reverse | protein coding | No | 1149 | NF0080940 | 26s proteasome non-atpase regulatory subunit 4 homolog | 26s proteasome non-atpase regulatory subunit 4 homolog | | | Not Assigned | Nfow_scaffold00078:100,766..101,914(-) | Nfow_scaffold00078:100766..101914(-) | Nfow_scaffold00078 | Naegleria fowleri ATCC 30863 | 10 | OG6_102002 | 0 | 382 | 1149 | 40801 | 4.19 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NF0080940OR26s proteasome non-atpase regulatory subunit 4 homologANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0080940 OR 26s proteasome non-atpase regulatory subunit 4 homolog AND Naegleria fowleri ATCC 30863 |
|
NF0081870 | mRNA1_NF0081870 | 1 | 1 | 1 | | | reverse | protein coding | No | 1044 | NF0081870 | caax prenyl protease 2-like | caax prenyl protease 2-like | | | Not Assigned | Nfow_scaffold00080:60,862..61,905(-) | Nfow_scaffold00080:60862..61905(-) | Nfow_scaffold00080 | Naegleria fowleri ATCC 30863 | 9 | OG6_103186 | 0 | 347 | 1044 | 38988 | 7.79 | 7 | HMM: MAFHKKMSSTTTSIVLSLFHSVILSGL, NN: MAFHKKMSSTTTSIVLSLFHSVILSG | NN Sum: 3, NN D: .54, HMM Prob: .65 | GO:0016020 | membrane | | | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0081870ORcaax prenyl protease 2-likeANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0081870 OR caax prenyl protease 2-like AND Naegleria fowleri ATCC 30863 |
|
NF0082330 | mRNA1_NF0082330 | 4 | 4 | 1 | | | forward | protein coding | No | 2181 | NF0082330 | uncharacterized aarf domain-containing protein kinase 5 | uncharacterized aarf domain-containing protein kinase 5 | | | Not Assigned | Nfow_scaffold00081:32,704..35,278(+) | Nfow_scaffold00081:32704..35278(+) | Nfow_scaffold00081 | Naegleria fowleri ATCC 30863 | 3 | OG6_100510 | 7 | 726 | 2181 | 84620 | 9.43 | 2 | | | | | | | | | | | | | | | | 2.7.-.- (Transferring phosphorus-containing groups.) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0082330ORuncharacterized aarf domain-containing protein kinase 5ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0082330 OR uncharacterized aarf domain-containing protein kinase 5 AND Naegleria fowleri ATCC 30863 |
|
NF0082860 | mRNA1_NF0082860 | 3 | 3 | 1 | | | reverse | protein coding | No | 615 | NF0082860 | mitochondrial inner membrane protease atp23 homolog isoform x1 | mitochondrial inner membrane protease atp23 homolog isoform x1 | | | Not Assigned | Nfow_scaffold00082:21,000..21,734(-) | Nfow_scaffold00082:21000..21734(-) | Nfow_scaffold00082 | Naegleria fowleri ATCC 30863 | 0 | OG6_295948 | 0 | 204 | 615 | 24028 | 6.83 | 0 | | | | | GO:0004222 | metalloendopeptidase activity | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NF0082860ORmitochondrial inner membrane protease atp23 homolog isoform x1ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0082860 OR mitochondrial inner membrane protease atp23 homolog isoform x1 AND Naegleria fowleri ATCC 30863 |
|
NF0083810 | mRNA1_NF0083810 | 1 | 1 | 1 | | | reverse | protein coding | No | 1626 | NF0083810 | cytosol aminopeptidase | cytosol aminopeptidase | | | Not Assigned | Nfow_scaffold00084:558..2,183(-) | Nfow_scaffold00084:558..2183(-) | Nfow_scaffold00084 | Naegleria fowleri ATCC 30863 | 1 | OG6_100682 | 2 | 541 | 1626 | 59141 | 5.20 | 0 | HMM: MSTATTAITTPFNVLVLGVFGT, NN: MSTATTAITTPFNVLVLGVFGTDGK | NN Sum: 3, NN D: .42, HMM Prob: .52 | GO:0005622 | intracellular | GO:0004177 | aminopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.11.1 (Leucyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0083810ORcytosol aminopeptidaseANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0083810 OR cytosol aminopeptidase AND Naegleria fowleri ATCC 30863 |
|
NF0084200 | mRNA1_NF0084200 | 1 | 1 | 1 | | | forward | protein coding | No | 2409 | NF0084200 | uncharacterized aarf domain-containing protein kinase 5 | uncharacterized aarf domain-containing protein kinase 5 | | | Not Assigned | Nfow_scaffold00084:90,205..92,613(+) | Nfow_scaffold00084:90205..92613(+) | Nfow_scaffold00084 | Naegleria fowleri ATCC 30863 | 3 | OG6_100510 | 7 | 802 | 2409 | 93861 | 9.36 | 0 | | | | | | | | | | | | | | | | 2.7.-.- (Transferring phosphorus-containing groups.) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0084200ORuncharacterized aarf domain-containing protein kinase 5ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0084200 OR uncharacterized aarf domain-containing protein kinase 5 AND Naegleria fowleri ATCC 30863 |
|
NF0085040 | mRNA1_NF0085040 | 2 | 2 | 1 | | | forward | protein coding | No | 2352 | NF0085040 | dipeptidyl-peptidase iii | dipeptidyl-peptidase iii | | | Not Assigned | Nfow_scaffold00086:15,922..18,425(+) | Nfow_scaffold00086:15922..18425(+) | Nfow_scaffold00086 | Naegleria fowleri ATCC 30863 | 9 | OG6_103290 | 0 | 783 | 2352 | 88881 | 6.52 | 0 | | | GO:0005737 | cytoplasm | GO:0008239 | dipeptidyl-peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.14.4 (Dipeptidyl-peptidase III) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0085040ORdipeptidyl-peptidase iiiANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0085040 OR dipeptidyl-peptidase iii AND Naegleria fowleri ATCC 30863 |
|
NF0085660 | mRNA1_NF0085660 | 2 | 2 | 1 | | | forward | protein coding | No | 756 | NF0085660 | signal peptidase complex subunit 2-like | signal peptidase complex subunit 2-like | | | Not Assigned | Nfow_scaffold00087:23,548..24,490(+) | Nfow_scaffold00087:23548..24490(+) | Nfow_scaffold00087 | Naegleria fowleri ATCC 30863 | 1 | OG6_103476 | 0 | 251 | 756 | 28393 | 7.49 | 2 | | | GO:0016021;GO:0005787 | integral component of membrane;signal peptidase complex | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0085660ORsignal peptidase complex subunit 2-likeANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0085660 OR signal peptidase complex subunit 2-like AND Naegleria fowleri ATCC 30863 |
|
NF0086960 | mRNA1_NF0086960 | 4 | 3 | 2 | | | reverse | protein coding | No | 3420 | NF0086960 | ubiquitin carboxyl-terminal hydrolase 12-like | ubiquitin carboxyl-terminal hydrolase 12-like | | | Not Assigned | Nfow_scaffold00089:87,198..90,788(-) | Nfow_scaffold00089:87198..90788(-) | Nfow_scaffold00089 | Naegleria fowleri ATCC 30863 | 1 | OG6_101317 | 0 | 1139 | 3420 | 134066 | 5.20 | 0 | | | | | GO:0005515;GO:0036459 | protein binding;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0086960ORubiquitin carboxyl-terminal hydrolase 12-likeANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0086960 OR ubiquitin carboxyl-terminal hydrolase 12-like AND Naegleria fowleri ATCC 30863 |
|
NF0087110 | mRNA1_NF0087110 | 4 | 4 | 1 | 44 | | reverse | protein coding | No | 566 | NF0087110 | mitochondrial inner membrane protease atp23 homolog | mitochondrial inner membrane protease atp23 homolog | | | Not Assigned | Nfow_scaffold00090:6,341..7,177(-) | Nfow_scaffold00090:6385..7177(-) | Nfow_scaffold00090 | Naegleria fowleri ATCC 30863 | 0 | OG6_177888 | 3 | 173 | 522 | 19615 | 8.62 | 0 | | | | | GO:0004222 | metalloendopeptidase activity | | | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0087110ORmitochondrial inner membrane protease atp23 homologANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0087110 OR mitochondrial inner membrane protease atp23 homolog AND Naegleria fowleri ATCC 30863 |
|
NF0087390 | mRNA1_NF0087390 | 4 | 4 | 1 | | | forward | protein coding | No | 1425 | NF0087390 | probable aspartyl aminopeptidase-like | probable aspartyl aminopeptidase-like | | | Not Assigned | Nfow_scaffold00090:60,935..62,669(+) | Nfow_scaffold00090:60935..62669(+) | Nfow_scaffold00090 | Naegleria fowleri ATCC 30863 | 19 | OG6_102047 | 0 | 474 | 1425 | 52222 | 6.60 | 0 | | | | | GO:0004177;GO:0008270 | aminopeptidase activity;zinc ion binding | GO:0006508 | proteolysis | | | | | | | | 3.4.11.21 (Aspartyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0087390ORprobable aspartyl aminopeptidase-likeANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0087390 OR probable aspartyl aminopeptidase-like AND Naegleria fowleri ATCC 30863 |
|
NF0088410 | mRNA1_NF0088410 | 1 | 1 | 1 | | | reverse | protein coding | No | 1464 | NF0088410 | sprt-like domain-containing protein spartan isoform x1 | sprt-like domain-containing protein spartan isoform x1 | | | Not Assigned | Nfow_scaffold00092:61,161..62,624(-) | Nfow_scaffold00092:61161..62624(-) | Nfow_scaffold00092 | Naegleria fowleri ATCC 30863 | 11 | OG6_104384 | 0 | 487 | 1464 | 54894 | 8.14 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NF0088410ORsprt-like domain-containing protein spartan isoform x1ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0088410 OR sprt-like domain-containing protein spartan isoform x1 AND Naegleria fowleri ATCC 30863 |
|
NF0088780 | mRNA1_NF0088780 | 1 | 1 | 1 | | | reverse | protein coding | No | 1728 | NF0088780 | phosphatidylcholine-sterol acyltransferase | phosphatidylcholine-sterol acyltransferase | | | Not Assigned | Nfow_scaffold00093:29,895..31,622(-) | Nfow_scaffold00093:29895..31622(-) | Nfow_scaffold00093 | Naegleria fowleri ATCC 30863 | 97 | OG6_101376 | 0 | 575 | 1728 | 65144 | 7.18 | 1 | HMM: MIQPSPPPSSSLLWFMTQVVVVLMMMLVMIMALFIPTCSTS, NN: MIQPSPPPSSSLLWFMTQVVVVLMMMLVMIMAL | NN Sum: 4, NN D: .7, HMM Prob: .32 | | | GO:0008374 | O-acyltransferase activity | GO:0006629 | lipid metabolic process | | | | | | | | 2.3.1.43 (Phosphatidylcholine--sterol O-acyltransferase) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0088780ORphosphatidylcholine-sterol acyltransferaseANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0088780 OR phosphatidylcholine-sterol acyltransferase AND Naegleria fowleri ATCC 30863 |
|
NF0089010 | mRNA1_NF0089010 | 1 | 1 | 1 | 9 | | forward | protein coding | No | 1080 | NF0089010 | duf862 duf1000 domain-containing protein | duf862 duf1000 domain-containing protein | | | Not Assigned | Nfow_scaffold00093:74,820..75,899(+) | Nfow_scaffold00093:74820..75890(+) | Nfow_scaffold00093 | Naegleria fowleri ATCC 30863 | 10 | OG6_101256 | 0 | 356 | 1071 | 40052 | 6.41 | 0 | | | | | | | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0089010ORduf862 duf1000 domain-containing proteinANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0089010 OR duf862 duf1000 domain-containing protein AND Naegleria fowleri ATCC 30863 |
|
NF0089100 | mRNA1_NF0089100 | 1 | 1 | 1 | | | forward | protein coding | No | 2505 | NF0089100 | oligopeptidase b | oligopeptidase b | | | Not Assigned | Nfow_scaffold00093:88,753..91,257(+) | Nfow_scaffold00093:88753..91257(+) | Nfow_scaffold00093 | Naegleria fowleri ATCC 30863 | 0 | OG6_296331 | 0 | 834 | 2505 | 97303 | 7.71 | 0 | | | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NF0089100ORoligopeptidase bANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0089100 OR oligopeptidase b AND Naegleria fowleri ATCC 30863 |
|
NF0089160 | mRNA1_NF0089160 | 1 | 1 | 1 | | | forward | protein coding | No | 996 | NF0089160 | otu domain-containing protein 6b-like | otu domain-containing protein 6b-like | | | Not Assigned | Nfow_scaffold00094:5,215..6,210(+) | Nfow_scaffold00094:5215..6210(+) | Nfow_scaffold00094 | Naegleria fowleri ATCC 30863 | 1 | OG6_102788 | 0 | 331 | 996 | 38537 | 5.70 | 0 | | | | | | | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0089160ORotu domain-containing protein 6b-likeANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0089160 OR otu domain-containing protein 6b-like AND Naegleria fowleri ATCC 30863 |
|
NF0089880 | mRNA1_NF0089880 | 7 | 1 | 2 | 281 | | reverse | protein coding | No | 839 | NF0089880 | glutathione gamma-glutamylcysteinyltransferase 3-like | glutathione gamma-glutamylcysteinyltransferase 3-like | | | Not Assigned | Nfow_scaffold00095:35,148..36,871(-) | Nfow_scaffold00095:35429..35986(-) | Nfow_scaffold00095 | Naegleria fowleri ATCC 30863 | 0 | OG6_296777 | 0 | 185 | 558 | 21742 | 8.78 | 0 | | | | | GO:0016756;GO:0046872 | glutathione gamma-glutamylcysteinyltransferase activity;metal ion binding | GO:0046938;GO:0010038 | phytochelatin biosynthetic process;response to metal ion | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NF0089880ORglutathione gamma-glutamylcysteinyltransferase 3-likeANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0089880 OR glutathione gamma-glutamylcysteinyltransferase 3-like AND Naegleria fowleri ATCC 30863 |
|
NF0090220 | mRNA1_NF0090220 | 2 | 2 | 1 | | | reverse | protein coding | No | 1854 | NF0090220 | carboxypeptidase pm20d1 | carboxypeptidase pm20d1 | | | Not Assigned | Nfow_scaffold00095:90,172..92,157(-) | Nfow_scaffold00095:90172..92157(-) | Nfow_scaffold00095 | Naegleria fowleri ATCC 30863 | 3 | OG6_104171 | 0 | 617 | 1854 | 69134 | 6.91 | 1 | HMM: MMKPIVKSILQFLFFALMGLIGLLSV, NN: MMKPIVKSILQFLFFALMGLIGLLSV | NN Sum: 3, NN D: .65, HMM Prob: .74 | | | GO:0016787 | hydrolase activity | GO:0008152 | metabolic process | | | | | | | | 3.4.17.4 (Gly-Xaa carboxypeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0090220ORcarboxypeptidase pm20d1ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0090220 OR carboxypeptidase pm20d1 AND Naegleria fowleri ATCC 30863 |
|
NF0090460 | mRNA1_NF0090460 | 1 | 1 | 1 | | | forward | protein coding | No | 1098 | NF0090460 | unspecified product | unspecified product | | | Not Assigned | Nfow_scaffold00096:33,585..34,682(+) | Nfow_scaffold00096:33585..34682(+) | Nfow_scaffold00096 | Naegleria fowleri ATCC 30863 | 2 | OG6_101151 | 8 | 365 | 1098 | 39786 | 9.17 | 1 | HMM: MATSAIIRKSALHLFLLACIVALCYLSLSA, NN: MATSAIIRKSALHLFLLACIVALCYLSLSAT | NN Sum: 4, NN D: .75, HMM Prob: .97 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.1 (Cathepsin B) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0090460ORunspecified productANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0090460 OR unspecified product AND Naegleria fowleri ATCC 30863 |
|
NF0092050 | mRNA1_NF0092050 | 1 | 1 | 1 | 874 | | reverse | protein coding | No | 2350 | NF0092050 | calpain family cysteine protease containing protein | calpain family cysteine protease containing protein | | | Not Assigned | Nfow_scaffold00099:57,012..59,361(-) | Nfow_scaffold00099:57886..59361(-) | Nfow_scaffold00099 | Naegleria fowleri ATCC 30863 | 0 | OG6_295923 | 0 | 492 | 1476 | 55837 | 5.22 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NF0092050ORcalpain family cysteine protease containing proteinANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0092050 OR calpain family cysteine protease containing protein AND Naegleria fowleri ATCC 30863 |
|
NF0092160 | mRNA1_NF0092160 | 1 | 1 | 1 | | | forward | protein coding | No | 1050 | NF0092160 | predicted protein | predicted protein | | | Not Assigned | Nfow_scaffold00099:73,038..74,087(+) | Nfow_scaffold00099:73038..74087(+) | Nfow_scaffold00099 | Naegleria fowleri ATCC 30863 | 11 | OG6_103838 | 1 | 349 | 1050 | 39471 | 6.77 | 6 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0092160ORpredicted proteinANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0092160 OR predicted protein AND Naegleria fowleri ATCC 30863 |
|
NF0092820 | mRNA1_NF0092820 | 2 | 2 | 1 | | | reverse | protein coding | No | 696 | NF0092820 | ubiquitin carboxyl-terminal hydrolase isozyme l3-like | ubiquitin carboxyl-terminal hydrolase isozyme l3-like | | | Not Assigned | Nfow_scaffold00100:91,110..91,891(-) | Nfow_scaffold00100:91110..91891(-) | Nfow_scaffold00100 | Naegleria fowleri ATCC 30863 | 9 | OG6_101218 | 0 | 231 | 696 | 25873 | 4.65 | 0 | | | GO:0005622 | intracellular | GO:0004843 | thiol-dependent ubiquitin-specific protease activity | GO:0006511 | ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0092820ORubiquitin carboxyl-terminal hydrolase isozyme l3-likeANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0092820 OR ubiquitin carboxyl-terminal hydrolase isozyme l3-like AND Naegleria fowleri ATCC 30863 |
|
NF0094840 | mRNA1_NF0094840 | 1 | 1 | 1 | | | reverse | protein coding | No | 786 | NF0094840 | proteasome subunit alpha type 7 | proteasome subunit alpha type 7 | | | Not Assigned | Nfow_scaffold00105:45,545..46,330(-) | Nfow_scaffold00105:45545..46330(-) | Nfow_scaffold00105 | Naegleria fowleri ATCC 30863 | 12 | OG6_101207 | 0 | 261 | 786 | 29012 | 8.92 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0094840ORproteasome subunit alpha type 7ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0094840 OR proteasome subunit alpha type 7 AND Naegleria fowleri ATCC 30863 |
|
NF0094950 | mRNA1_NF0094950 | 4 | 4 | 1 | | 883 | reverse | protein coding | No | 3337 | NF0094950 | ubiquitin carboxyl-terminal hydrolase 5-like | ubiquitin carboxyl-terminal hydrolase 5-like | | | Not Assigned | Nfow_scaffold00105:65,390..68,916(-) | Nfow_scaffold00105:65390..68033(-) | Nfow_scaffold00105 | Naegleria fowleri ATCC 30863 | 13 | OG6_100913 | 1 | 817 | 2454 | 93296 | 6.78 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0094950ORubiquitin carboxyl-terminal hydrolase 5-likeANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0094950 OR ubiquitin carboxyl-terminal hydrolase 5-like AND Naegleria fowleri ATCC 30863 |
|
NF0096790 | mRNA1_NF0096790 | 4 | 4 | 1 | 101 | | forward | protein coding | No | 4049 | NF0096790 | ubiquitin carboxyl-terminal hydrolase 47-like | ubiquitin carboxyl-terminal hydrolase 47-like | | | Not Assigned | Nfow_scaffold00109:62,154..66,445(+) | Nfow_scaffold00109:62154..66344(+) | Nfow_scaffold00109 | Naegleria fowleri ATCC 30863 | 2 | OG6_106012 | 0 | 1315 | 3948 | 152175 | 6.16 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0096790ORubiquitin carboxyl-terminal hydrolase 47-likeANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0096790 OR ubiquitin carboxyl-terminal hydrolase 47-like AND Naegleria fowleri ATCC 30863 |
|
NF0096880 | mRNA1_NF0096880 | 1 | 1 | 1 | | | reverse | protein coding | No | 900 | NF0096880 | 20s proteasome beta subunit family protein | 20s proteasome beta subunit family protein | | | Not Assigned | Nfow_scaffold00109:86,916..87,815(-) | Nfow_scaffold00109:86916..87815(-) | Nfow_scaffold00109 | Naegleria fowleri ATCC 30863 | 10 | OG6_100897 | 0 | 299 | 900 | 32972 | 8.04 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0096880OR20s proteasome beta subunit family proteinANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0096880 OR 20s proteasome beta subunit family protein AND Naegleria fowleri ATCC 30863 |
|
NF0098540 | mRNA1_NF0098540 | 4 | 3 | 2 | | | reverse | protein coding | No | 951 | NF0098540 | serine protease family | serine protease family | | | Not Assigned | Nfow_scaffold00113:61,554..62,638(-) | Nfow_scaffold00113:61554..62638(-) | Nfow_scaffold00113 | Naegleria fowleri ATCC 30863 | 0 | OG6_103844 | 0 | 316 | 951 | 36271 | 6.63 | 0 | | | | | | | | | | | | | | | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0098540ORserine protease familyANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0098540 OR serine protease family AND Naegleria fowleri ATCC 30863 |
|
NF0099990 | mRNA1_NF0099990 | 6 | 6 | 1 | | | reverse | protein coding | No | 1053 | NF0099990 | cathepsin b | cathepsin b | | | Not Assigned | Nfow_scaffold00117:25,414..27,001(-) | Nfow_scaffold00117:25414..27001(-) | Nfow_scaffold00117 | Naegleria fowleri ATCC 30863 | 0 | OG6_177845 | 3 | 350 | 1053 | 38956 | 6.96 | 1 | HMM: MKVIPTPFLKAFLFIASLILLIIIGSSST, NN: MKVIPTPFLKAFLFIASLILLIIIGSSSTSLQAL | NN Sum: 4, NN D: .7, HMM Prob: .96 | | | GO:0004197;GO:0008234 | cysteine-type endopeptidase activity;cysteine-type peptidase activity | GO:0006508;GO:0050790 | proteolysis;regulation of catalytic activity | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NF0099990ORcathepsin bANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0099990 OR cathepsin b AND Naegleria fowleri ATCC 30863 |
|
NF0101380 | mRNA1_NF0101380 | 3 | 3 | 1 | | | forward | protein coding | No | 2283 | NF0101380 | peptidase s9 | peptidase s9 | | | Not Assigned | Nfow_scaffold00120:76,653..79,068(+) | Nfow_scaffold00120:76653..79068(+) | Nfow_scaffold00120 | Naegleria fowleri ATCC 30863 | 25 | OG6_104931 | 0 | 760 | 2283 | 85556 | 6.60 | 0 | | | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.19.1 (Acylaminoacyl-peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0101380ORpeptidase s9ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0101380 OR peptidase s9 AND Naegleria fowleri ATCC 30863 |
|
NF0102340 | mRNA1_NF0102340 | 2 | 2 | 1 | | | reverse | protein coding | No | 2130 | NF0102340 | uncharacterized aarf domain-containing protein kinase 5 isoform x1 | uncharacterized aarf domain-containing protein kinase 5 isoform x1 | | | Not Assigned | Nfow_scaffold00123:54,006..56,263(-) | Nfow_scaffold00123:54006..56263(-) | Nfow_scaffold00123 | Naegleria fowleri ATCC 30863 | 3 | OG6_100510 | 7 | 709 | 2130 | 82303 | 7.07 | 1 | | | | | | | | | | | | | | | | 2.7.-.- (Transferring phosphorus-containing groups.) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0102340ORuncharacterized aarf domain-containing protein kinase 5 isoform x1ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0102340 OR uncharacterized aarf domain-containing protein kinase 5 isoform x1 AND Naegleria fowleri ATCC 30863 |
|
NF0102750 | mRNA1_NF0102750 | 7 | 7 | 1 | | 451 | reverse | protein coding | No | 1147 | NF0102750 | cysteine proteinase rd19a-like | cysteine proteinase rd19a-like | | | Not Assigned | Nfow_scaffold00124:64,837..66,386(-) | Nfow_scaffold00124:64837..65935(-) | Nfow_scaffold00124 | Naegleria fowleri ATCC 30863 | 0 | OG6_299146 | 0 | 231 | 696 | 25977 | 6.10 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NF0102750ORcysteine proteinase rd19a-likeANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0102750 OR cysteine proteinase rd19a-like AND Naegleria fowleri ATCC 30863 |
|
NF0103570 | mRNA1_NF0103570 | 1 | 1 | 1 | | | reverse | protein coding | No | 2643 | NF0103570 | peptidase s9 | peptidase s9 | | | Not Assigned | Nfow_scaffold00126:73,217..75,859(-) | Nfow_scaffold00126:73217..75859(-) | Nfow_scaffold00126 | Naegleria fowleri ATCC 30863 | 1 | OG6_100574 | 0 | 880 | 2643 | 99561 | 5.78 | 1 | | | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.14.5 (Dipeptidyl-peptidase IV) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0103570ORpeptidase s9ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0103570 OR peptidase s9 AND Naegleria fowleri ATCC 30863 |
|
NF0105870 | mRNA1_NF0105870 | 4 | 3 | 2 | | | reverse | protein coding | No | 1272 | NF0105870 | clan s- family rhomboid-like serine peptidase | clan s- family rhomboid-like serine peptidase | | | Not Assigned | Nfow_scaffold00132:70,414..71,898(-) | Nfow_scaffold00132:70414..71898(-) | Nfow_scaffold00132 | Naegleria fowleri ATCC 30863 | 0 | OG6_107191 | 0 | 423 | 1272 | 46093 | 8.33 | 7 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0105870ORclan s- family rhomboid-like serine peptidaseANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0105870 OR clan s- family rhomboid-like serine peptidase AND Naegleria fowleri ATCC 30863 |
|
NF0105940 | mRNA1_NF0105940 | 3 | 2 | 2 | | 786 | forward | protein coding | No | 2532 | NF0105940 | dna repair protein rad4 containing protein | dna repair protein rad4 containing protein | | | Not Assigned | Nfow_scaffold00133:24,261..26,828(+) | Nfow_scaffold00133:25083..26828(+) | Nfow_scaffold00133 | Naegleria fowleri ATCC 30863 | 0 | OG6_102113 | 0 | 582 | 1746 | 66664 | 7.01 | 0 | | | | | GO:0003677 | DNA binding | | | | | | | | | | 2.1.1.201 (2-methoxy-6-polyprenyl-1,4-benzoquinol methylase) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0105940ORdna repair protein rad4 containing proteinANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0105940 OR dna repair protein rad4 containing protein AND Naegleria fowleri ATCC 30863 |
|
NF0106500 | mRNA1_NF0106500 | 1 | 1 | 1 | | | reverse | protein coding | No | 1701 | NF0106500 | calpain 5 | calpain 5 | | | Not Assigned | Nfow_scaffold00134:55,087..56,787(-) | Nfow_scaffold00134:55087..56787(-) | Nfow_scaffold00134 | Naegleria fowleri ATCC 30863 | 0 | OG6_296233 | 0 | 566 | 1701 | 64004 | 6.16 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NF0106500ORcalpain 5ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0106500 OR calpain 5 AND Naegleria fowleri ATCC 30863 |
|
NF0108230 | mRNA1_NF0108230 | 4 | 4 | 1 | | | forward | protein coding | No | 2343 | NF0108230 | gamma-glutamyltranspeptidase 1 isoform x1 | gamma-glutamyltranspeptidase 1 isoform x1 | | | Not Assigned | Nfow_scaffold00139:66,678..69,469(+) | Nfow_scaffold00139:66678..69469(+) | Nfow_scaffold00139 | Naegleria fowleri ATCC 30863 | 3 | OG6_100578 | 1 | 780 | 2343 | 85730 | 6.78 | 1 | | | | | GO:0036374 | glutathione hydrolase activity | GO:0006751 | glutathione catabolic process | | | | | | | | 2.3.2.2 (Gamma-glutamyltransferase) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0108230ORgamma-glutamyltranspeptidase 1 isoform x1ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0108230 OR gamma-glutamyltranspeptidase 1 isoform x1 AND Naegleria fowleri ATCC 30863 |
|
NF0108310 | mRNA1_NF0108310 | 3 | 2 | 2 | | | reverse | protein coding | No | 996 | NF0108310 | pyrrolidone-carboxylate peptidase isoform 1 | pyrrolidone-carboxylate peptidase isoform 1 | | | Not Assigned | Nfow_scaffold00140:6,957..8,179(-) | Nfow_scaffold00140:6957..8179(-) | Nfow_scaffold00140 | Naegleria fowleri ATCC 30863 | 0 | OG6_101530 | 0 | 331 | 996 | 37442 | 5.96 | 0 | | | | | | | | | | | | | | | | 3.4.19.3 (Pyroglutamyl-peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0108310ORpyrrolidone-carboxylate peptidase isoform 1ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0108310 OR pyrrolidone-carboxylate peptidase isoform 1 AND Naegleria fowleri ATCC 30863 |
|
NF0109410 | mRNA1_NF0109410 | 2 | 2 | 1 | | | forward | protein coding | No | 1158 | NF0109410 | inactive rhomboid protein 1-like | inactive rhomboid protein 1-like | | | Not Assigned | Nfow_scaffold00143:17,791..19,143(+) | Nfow_scaffold00143:17791..19143(+) | Nfow_scaffold00143 | Naegleria fowleri ATCC 30863 | 10 | OG6_100562 | 1 | 385 | 1158 | 43749 | 7.24 | 7 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | | 3.4.21.- (Serine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0109410ORinactive rhomboid protein 1-likeANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0109410 OR inactive rhomboid protein 1-like AND Naegleria fowleri ATCC 30863 |
|
NF0111350 | mRNA1_NF0111350 | 7 | 4 | 2 | | | reverse | protein coding | No | 3621 | NF0111350 | tripeptidyl-peptidase 2 | tripeptidyl-peptidase 2 | | | Not Assigned | Nfow_scaffold00149:50,311..54,574(-) | Nfow_scaffold00149:50311..54144(-) | Nfow_scaffold00149 | Naegleria fowleri ATCC 30863 | 1 | OG6_104037 | 0 | 1206 | 3621 | 137362 | 6.84 | 0 | | | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.14.10 (Tripeptidyl-peptidase II) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0111350ORtripeptidyl-peptidase 2ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0111350 OR tripeptidyl-peptidase 2 AND Naegleria fowleri ATCC 30863 |
|
NF0111460 | mRNA1_NF0111460 | 2 | 2 | 1 | | | reverse | protein coding | No | 1506 | NF0111460 | peptidase m19 | peptidase m19 | | | Not Assigned | Nfow_scaffold00150:6,593..8,410(-) | Nfow_scaffold00150:6593..8410(-) | Nfow_scaffold00150 | Naegleria fowleri ATCC 30863 | 1 | OG6_152277 | 0 | 501 | 1506 | 55830 | 9.23 | 2 | | | | | GO:0016805 | dipeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.13.19 (Membrane dipeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0111460ORpeptidase m19ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0111460 OR peptidase m19 AND Naegleria fowleri ATCC 30863 |
|
NF0111530 | mRNA1_NF0111530 | 2 | 2 | 1 | | | reverse | protein coding | No | 2217 | NF0111530 | ufm1-specific protease 2 | ufm1-specific protease 2 | | | Not Assigned | Nfow_scaffold00150:25,093..27,361(-) | Nfow_scaffold00150:25093..27361(-) | Nfow_scaffold00150 | Naegleria fowleri ATCC 30863 | 1 | OG6_102601 | 0 | 738 | 2217 | 83005 | 7.21 | 0 | | | | | | | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0111530ORufm1-specific protease 2ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0111530 OR ufm1-specific protease 2 AND Naegleria fowleri ATCC 30863 |
|
NF0111770 | mRNA1_NF0111770 | 3 | 3 | 1 | | | reverse | protein coding | No | 2511 | NF0111770 | ubiquitin carboxyl-terminal hydrolase 5 isoform x2 | ubiquitin carboxyl-terminal hydrolase 5 isoform x2 | | | Not Assigned | Nfow_scaffold00151:25,658..28,291(-) | Nfow_scaffold00151:25658..28291(-) | Nfow_scaffold00151 | Naegleria fowleri ATCC 30863 | 11 | OG6_101380 | 0 | 836 | 2511 | 95038 | 5.18 | 0 | | | | | GO:0005515;GO:0004843;GO:0036459;GO:0008270 | protein binding;thiol-dependent ubiquitin-specific protease activity;thiol-dependent ubiquitinyl hydrolase activity;zinc ion binding | GO:0016579 | protein deubiquitination | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0111770ORubiquitin carboxyl-terminal hydrolase 5 isoform x2ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0111770 OR ubiquitin carboxyl-terminal hydrolase 5 isoform x2 AND Naegleria fowleri ATCC 30863 |
|
NF0113550 | mRNA1_NF0113550 | 2 | 2 | 1 | | | forward | protein coding | No | 1452 | NF0113550 | peptidase d | peptidase d | | | Not Assigned | Nfow_scaffold00157:27,758..29,274(+) | Nfow_scaffold00157:27758..29274(+) | Nfow_scaffold00157 | Naegleria fowleri ATCC 30863 | 10 | OG6_102295 | 0 | 483 | 1452 | 54396 | 5.53 | 0 | | | | | GO:0004177;GO:0030145 | aminopeptidase activity;manganese ion binding | | | | | | | | | | 3.4.11.9 (Xaa-Pro aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0113550ORpeptidase dANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0113550 OR peptidase d AND Naegleria fowleri ATCC 30863 |
|
NF0113600 | mRNA1_NF0113600 | 1 | 1 | 1 | | 997 | forward | protein coding | No | 2938 | NF0113600 | ubiquitin carboxyl-terminal hydrolase 28 isoform x3 | ubiquitin carboxyl-terminal hydrolase 28 isoform x3 | | | Not Assigned | Nfow_scaffold00157:38,331..41,268(+) | Nfow_scaffold00157:39328..41268(+) | Nfow_scaffold00157 | Naegleria fowleri ATCC 30863 | 0 | OG6_297512 | 0 | 646 | 1941 | 74840 | 7.01 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NF0113600ORubiquitin carboxyl-terminal hydrolase 28 isoform x3ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0113600 OR ubiquitin carboxyl-terminal hydrolase 28 isoform x3 AND Naegleria fowleri ATCC 30863 |
|
NF0113780 | mRNA1_NF0113780 | 1 | 1 | 1 | | | reverse | protein coding | No | 1623 | NF0113780 | carboxypeptidase a4 | carboxypeptidase a4 | | | Not Assigned | Nfow_scaffold00158:18,567..20,189(-) | Nfow_scaffold00158:18567..20189(-) | Nfow_scaffold00158 | Naegleria fowleri ATCC 30863 | 0 | OG6_112740 | 0 | 540 | 1623 | 62089 | 6.83 | 1 | HMM: MSISLQQRVTAFVIVFLLVIGNVLLVSGL, NN: MSISLQQRVTAFVIVFLLVIGNVLLVSGL | NN Sum: 4, NN D: .72, HMM Prob: .5 | | | GO:0004181;GO:0008270 | metallocarboxypeptidase activity;zinc ion binding | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NF0113780ORcarboxypeptidase a4ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0113780 OR carboxypeptidase a4 AND Naegleria fowleri ATCC 30863 |
|
NF0113880 | mRNA1_NF0113880 | 8 | 4 | 3 | | 142 | reverse | protein coding | No | 1009 | NF0113880 | unspecified product | unspecified product | | | Not Assigned | Nfow_scaffold00158:39,854..41,386(-) | Nfow_scaffold00158:39854..41244(-) | Nfow_scaffold00158 | Naegleria fowleri ATCC 30863 | 2 | OG6_101151 | 6 | 289 | 867 | 32403 | 8.86 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.1 (Cathepsin B) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0113880ORunspecified productANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0113880 OR unspecified product AND Naegleria fowleri ATCC 30863 |
|
NF0115320 | mRNA1_NF0115320 | 1 | 1 | 1 | | | forward | protein coding | No | 1161 | NF0115320 | alpha beta hydrolase | alpha beta hydrolase | | | Not Assigned | Nfow_scaffold00164:51,846..53,006(+) | Nfow_scaffold00164:51846..53006(+) | Nfow_scaffold00164 | Naegleria fowleri ATCC 30863 | 1 | OG6_101420 | 0 | 386 | 1161 | 44988 | 7.11 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NF0115320ORalpha beta hydrolaseANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0115320 OR alpha beta hydrolase AND Naegleria fowleri ATCC 30863 |
|
NF0115390 | mRNA1_NF0115390 | 1 | 1 | 1 | | | forward | protein coding | No | 1563 | NF0115390 | zinc metalloproteinase -like | zinc metalloproteinase -like | | | Not Assigned | Nfow_scaffold00165:8,803..10,365(+) | Nfow_scaffold00165:8803..10365(+) | Nfow_scaffold00165 | Naegleria fowleri ATCC 30863 | 1 | OG6_107913 | 0 | 520 | 1563 | 58328 | 7.05 | 0 | | | | | | | | | | | | | | | | 2.7.8.8 (CDP-diacylglycerol--serine O-phosphatidyltransferase) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0115390ORzinc metalloproteinase -likeANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0115390 OR zinc metalloproteinase -like AND Naegleria fowleri ATCC 30863 |
|
NF0115410 | mRNA1_NF0115410 | 3 | 3 | 1 | | 1 | reverse | protein coding | No | 1642 | NF0115410 | monoglyceride lipase | monoglyceride lipase | | | Not Assigned | Nfow_scaffold00165:13,319..15,296(-) | Nfow_scaffold00165:13319..15295(-) | Nfow_scaffold00165 | Naegleria fowleri ATCC 30863 | 40 | OG6_100231 | 0 | 546 | 1641 | 61566 | 7.07 | 0 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0115410ORmonoglyceride lipaseANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0115410 OR monoglyceride lipase AND Naegleria fowleri ATCC 30863 |
|
NF0116100 | mRNA1_NF0116100 | 1 | 1 | 1 | | | reverse | protein coding | No | 2691 | NF0116100 | endoplasmic reticulum metallopeptidase 1-like | endoplasmic reticulum metallopeptidase 1-like | | | Not Assigned | Nfow_scaffold00168:25,024..27,714(-) | Nfow_scaffold00168:25024..27714(-) | Nfow_scaffold00168 | Naegleria fowleri ATCC 30863 | 0 | OG6_299518 | 0 | 896 | 2691 | 100669 | 7.15 | 8 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NF0116100ORendoplasmic reticulum metallopeptidase 1-likeANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0116100 OR endoplasmic reticulum metallopeptidase 1-like AND Naegleria fowleri ATCC 30863 |
|
NF0116370 | mRNA1_NF0116370 | 1 | 1 | 1 | | | forward | protein coding | No | 2256 | NF0116370 | ubiquitin carboxyl-terminal hydrolase 16 isoform x1 | ubiquitin carboxyl-terminal hydrolase 16 isoform x1 | | | Not Assigned | Nfow_scaffold00169:37,665..39,920(+) | Nfow_scaffold00169:37665..39920(+) | Nfow_scaffold00169 | Naegleria fowleri ATCC 30863 | 1 | OG6_103128 | 0 | 751 | 2256 | 84670 | 8.40 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0116370ORubiquitin carboxyl-terminal hydrolase 16 isoform x1ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0116370 OR ubiquitin carboxyl-terminal hydrolase 16 isoform x1 AND Naegleria fowleri ATCC 30863 |
|
NF0116430 | mRNA1_NF0116430 | 4 | 4 | 1 | | | reverse | protein coding | No | 1560 | NF0116430 | lysosomal protective | lysosomal protective | | | Not Assigned | Nfow_scaffold00169:50,469..52,507(-) | Nfow_scaffold00169:50469..52507(-) | Nfow_scaffold00169 | Naegleria fowleri ATCC 30863 | 6 | OG6_100109 | 10 | 519 | 1560 | 58331 | 6.51 | 0 | HMM: MKFLPLLFLLLAQWLLVVHSTTESGLFILGSGVAAAVAAA, NN: MKFLPLLFLLLAQWLLVVHST | NN Sum: 4, NN D: .79, HMM Prob: 1 | | | GO:0004185 | serine-type carboxypeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.16.- (Serine-type carboxypeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0116430ORlysosomal protectiveANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0116430 OR lysosomal protective AND Naegleria fowleri ATCC 30863 |
|
NF0116890 | mRNA1_NF0116890 | 2 | 2 | 1 | | | forward | protein coding | No | 1485 | NF0116890 | mitochondrial processing peptidase beta subunit | mitochondrial processing peptidase beta subunit | | | Not Assigned | Nfow_scaffold00171:43,975..45,664(+) | Nfow_scaffold00171:43975..45664(+) | Nfow_scaffold00171 | Naegleria fowleri ATCC 30863 | 10 | OG6_100777 | 0 | 494 | 1485 | 54033 | 7.72 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0116890ORmitochondrial processing peptidase beta subunitANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0116890 OR mitochondrial processing peptidase beta subunit AND Naegleria fowleri ATCC 30863 |
|
NF0117640 | mRNA1_NF0117640 | 1 | 1 | 1 | | | forward | protein coding | No | 1113 | NF0117640 | actin-like atpase superfamily protein isoform 1 | actin-like atpase superfamily protein isoform 1 | | | Not Assigned | Nfow_scaffold00175:383..1,495(+) | Nfow_scaffold00175:383..1495(+) | Nfow_scaffold00175 | Naegleria fowleri ATCC 30863 | 11 | OG6_100288 | 1 | 370 | 1113 | 41381 | 6.77 | 0 | | | | | | | | | | | | | | | | 2.3.1.234 (N(6)-L-threonylcarbamoyladenine synthase) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0117640ORactin-like atpase superfamily protein isoform 1ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0117640 OR actin-like atpase superfamily protein isoform 1 AND Naegleria fowleri ATCC 30863 |
|
NF0117950 | mRNA1_NF0117950 | 2 | 2 | 1 | | | forward | protein coding | No | 3225 | NF0117950 | lon protease | lon protease | | | Not Assigned | Nfow_scaffold00176:18,689..22,107(+) | Nfow_scaffold00176:18689..22107(+) | Nfow_scaffold00176 | Naegleria fowleri ATCC 30863 | 1 | OG6_100411 | 0 | 1074 | 3225 | 120600 | 7.98 | 0 | | | | | GO:0005524;GO:0004176;GO:0004252 | ATP binding;ATP-dependent peptidase activity;serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0117950ORlon proteaseANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0117950 OR lon protease AND Naegleria fowleri ATCC 30863 |
|
NF0118280 | mRNA1_NF0118280 | 1 | 1 | 1 | | | forward | protein coding | No | 513 | NF0118280 | mitochondrial inner membrane protease subunit | mitochondrial inner membrane protease subunit | | | Not Assigned | Nfow_scaffold00178:588..1,100(+) | Nfow_scaffold00178:588..1100(+) | Nfow_scaffold00178 | Naegleria fowleri ATCC 30863 | 1 | OG6_103471 | 0 | 170 | 513 | 18966 | 10.03 | 1 | HMM: MLQRVKGVLYPTLFIASTLYGA, NN: MLQRVKGVLYPTLFIASTLYGASCF | NN Sum: 4, NN D: .58, HMM Prob: .82 | | | | | | | | | | | | | | 3.4.21.- (Serine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0118280ORmitochondrial inner membrane protease subunitANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0118280 OR mitochondrial inner membrane protease subunit AND Naegleria fowleri ATCC 30863 |
|
NF0118840 | mRNA1_NF0118840 | 1 | 1 | 1 | | | forward | protein coding | No | 1452 | NF0118840 | leishmanolysin peptidase | leishmanolysin peptidase | | | Not Assigned | Nfow_scaffold00180:8,534..9,985(+) | Nfow_scaffold00180:8534..9985(+) | Nfow_scaffold00180 | Naegleria fowleri ATCC 30863 | 99 | OG6_101715 | 1 | 483 | 1452 | 53071 | 7.44 | 0 | | | GO:0016020 | membrane | GO:0004222 | metalloendopeptidase activity | GO:0007155;GO:0006508 | cell adhesion;proteolysis | | | | | | | | 3.4.24.36 (Leishmanolysin) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0118840ORleishmanolysin peptidaseANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0118840 OR leishmanolysin peptidase AND Naegleria fowleri ATCC 30863 |
|
NF0119540 | mRNA1_NF0119540 | 2 | 2 | 1 | | | reverse | protein coding | No | 828 | NF0119540 | ataxin-3 isoform x5 | ataxin-3 isoform x5 | | | Not Assigned | Nfow_scaffold00183:17,530..18,595(-) | Nfow_scaffold00183:17530..18595(-) | Nfow_scaffold00183 | Naegleria fowleri ATCC 30863 | 1 | OG6_104644 | 0 | 275 | 828 | 31518 | 4.56 | 0 | | | | | GO:0004843 | thiol-dependent ubiquitin-specific protease activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0119540ORataxin-3 isoform x5ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0119540 OR ataxin-3 isoform x5 AND Naegleria fowleri ATCC 30863 |
|
NF0120610 | mRNA1_NF0120610 | 1 | 1 | 1 | | | forward | protein coding | No | 1245 | NF0120610 | monoglyceride lipase-like | monoglyceride lipase-like | | | Not Assigned | Nfow_scaffold00188:6,133..7,377(+) | Nfow_scaffold00188:6133..7377(+) | Nfow_scaffold00188 | Naegleria fowleri ATCC 30863 | 0 | OG6_299176 | 0 | 414 | 1245 | 47996 | 6.38 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NF0120610ORmonoglyceride lipase-likeANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0120610 OR monoglyceride lipase-like AND Naegleria fowleri ATCC 30863 |
|
NF0120680 | mRNA1_NF0120680 | 2 | 2 | 1 | 328 | | reverse | protein coding | No | 2332 | NF0120680 | peptidase s10 family protein | peptidase s10 family protein | | | Not Assigned | Nfow_scaffold00188:17,568..20,023(-) | Nfow_scaffold00188:17896..20023(-) | Nfow_scaffold00188 | Naegleria fowleri ATCC 30863 | 6 | OG6_100109 | 10 | 667 | 2004 | 74736 | 6.98 | 1 | | | | | GO:0004185 | serine-type carboxypeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.16.- (Serine-type carboxypeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0120680ORpeptidase s10 family proteinANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0120680 OR peptidase s10 family protein AND Naegleria fowleri ATCC 30863 |
|
NF0121140 | mRNA1_NF0121140 | 3 | 3 | 1 | 781 | | reverse | protein coding | No | 2371 | NF0121140 | protease 2 | protease 2 | | | Not Assigned | Nfow_scaffold00191:12,468..14,972(-) | Nfow_scaffold00191:13303..14972(-) | Nfow_scaffold00191 | Naegleria fowleri ATCC 30863 | 0 | OG6_297551 | 0 | 529 | 1590 | 62675 | 4.96 | 0 | | | | | GO:0004252;GO:0070008 | serine-type endopeptidase activity;serine-type exopeptidase activity | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NF0121140ORprotease 2ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0121140 OR protease 2 AND Naegleria fowleri ATCC 30863 |
|
NF0121710 | mRNA1_NF0121710 | 2 | 2 | 1 | | | forward | protein coding | No | 1134 | NF0121710 | peptidase m50 | peptidase m50 | | | Not Assigned | Nfow_scaffold00193:38,535..39,876(+) | Nfow_scaffold00193:38535..39876(+) | Nfow_scaffold00193 | Naegleria fowleri ATCC 30863 | 0 | OG6_110253 | 0 | 377 | 1134 | 42784 | 7.21 | 6 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NF0121710ORpeptidase m50ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0121710 OR peptidase m50 AND Naegleria fowleri ATCC 30863 |
|
NF0122010 | mRNA1_NF0122010 | 6 | 1 | 3 | | | forward | protein coding | No | 459 | NF0122010 | unspecified product | unspecified product | | | Not Assigned | Nfow_scaffold00195:26,734..29,687(+) | Nfow_scaffold00195:26734..27192(+) | Nfow_scaffold00195 | Naegleria fowleri ATCC 30863 | 2 | OG6_100384 | 1 | 152 | 459 | 16904 | 10.86 | 1 | | | | | | | | | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0122010ORunspecified productANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0122010 OR unspecified product AND Naegleria fowleri ATCC 30863 |
|
NF0123230 | mRNA1_NF0123230 | 2 | 2 | 1 | | | reverse | protein coding | No | 618 | NF0123230 | proteasome subunit beta type-3-like | proteasome subunit beta type-3-like | | | Not Assigned | Nfow_scaffold00202:26,353..27,071(-) | Nfow_scaffold00202:26353..27071(-) | Nfow_scaffold00202 | Naegleria fowleri ATCC 30863 | 10 | OG6_101970 | 0 | 205 | 618 | 22889 | 5.74 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0123230ORproteasome subunit beta type-3-likeANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0123230 OR proteasome subunit beta type-3-like AND Naegleria fowleri ATCC 30863 |
|
NF0123260 | mRNA1_NF0123260 | 2 | 2 | 1 | | | reverse | protein coding | No | 1188 | NF0123260 | ubiquitin carboxyl-terminal hydrolase 3-like | ubiquitin carboxyl-terminal hydrolase 3-like | | | Not Assigned | Nfow_scaffold00202:30,101..31,365(-) | Nfow_scaffold00202:30101..31365(-) | Nfow_scaffold00202 | Naegleria fowleri ATCC 30863 | 0 | OG6_101733 | 0 | 395 | 1188 | 46049 | 5.66 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0123260ORubiquitin carboxyl-terminal hydrolase 3-likeANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0123260 OR ubiquitin carboxyl-terminal hydrolase 3-like AND Naegleria fowleri ATCC 30863 |
|
NF0123430 | mRNA1_NF0123430 | 1 | 1 | 1 | | | reverse | protein coding | No | 3561 | NF0123430 | pab-dependent poly -specific ribonuclease subunit 2-like | pab-dependent poly -specific ribonuclease subunit 2-like | | | Not Assigned | Nfow_scaffold00204:4,426..7,986(-) | Nfow_scaffold00204:4426..7986(-) | Nfow_scaffold00204 | Naegleria fowleri ATCC 30863 | 2 | OG6_102772 | 0 | 1186 | 3561 | 136808 | 6.52 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 3.1.13.4 (Poly(A)-specific ribonuclease) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0123430ORpab-dependent poly -specific ribonuclease subunit 2-likeANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0123430 OR pab-dependent poly -specific ribonuclease subunit 2-like AND Naegleria fowleri ATCC 30863 |
|
NF0123820 | mRNA1_NF0123820 | 6 | 1 | 2 | | | forward | protein coding | No | 309 | NF0123820 | hydrolase | hydrolase | | | Not Assigned | Nfow_scaffold00206:15,870..16,890(+) | Nfow_scaffold00206:15870..16178(+) | Nfow_scaffold00206 | Naegleria fowleri ATCC 30863 | 0 | OG6_298863 | 0 | 102 | 309 | 11639 | 10.24 | 1 | HMM: MFFSNIYLNSLTFLPLVLIGI, NN: MFFSNIYLNSLTFLPLVLIGI | NN Sum: 2, NN D: .51, HMM Prob: .1 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NF0123820ORhydrolaseANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0123820 OR hydrolase AND Naegleria fowleri ATCC 30863 |
|
NF0123830 | mRNA1_NF0123830 | 1 | 1 | 1 | | 1 | forward | protein coding | No | 328 | NF0123830 | alpha beta hydrolase domain-containing protein 17b | alpha beta hydrolase domain-containing protein 17b | | | Not Assigned | Nfow_scaffold00206:16,982..17,309(+) | Nfow_scaffold00206:16983..17309(+) | Nfow_scaffold00206 | Naegleria fowleri ATCC 30863 | 0 | OG6_137980 | 0 | 108 | 327 | 12624 | 7.95 | 0 | | | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.14.- (Dipeptidyl-peptidases and tripeptidyl-peptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0123830ORalpha beta hydrolase domain-containing protein 17bANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0123830 OR alpha beta hydrolase domain-containing protein 17b AND Naegleria fowleri ATCC 30863 |
|
NF0125230 | mRNA1_NF0125230 | 4 | 4 | 1 | | 284 | forward | protein coding | No | 788 | NF0125230 | protease i | protease i | | | Not Assigned | Nfow_scaffold00216:4,024..5,161(+) | Nfow_scaffold00216:4608..5161(+) | Nfow_scaffold00216 | Naegleria fowleri ATCC 30863 | 0 | OG6_137481 | 0 | 167 | 504 | 18537 | 10.39 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NF0125230ORprotease iANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0125230 OR protease i AND Naegleria fowleri ATCC 30863 |
|
NF0125410 | mRNA1_NF0125410 | 7 | 7 | 1 | | 562 | reverse | protein coding | No | 1360 | NF0125410 | 3-hydroxyisobutyryl- hydrolase 1-like | 3-hydroxyisobutyryl- hydrolase 1-like | | | Not Assigned | Nfow_scaffold00217:7,394..9,296(-) | Nfow_scaffold00217:7394..8241(-) | Nfow_scaffold00217 | Naegleria fowleri ATCC 30863 | 0 | OG6_294744 | 0 | 265 | 798 | 30488 | 5.46 | 0 | HMM: PLQVQFLLLQRPPWVTSQ, NN: PLQVQFLLLQRPPWVTSQ | NN Sum: 3, NN D: .38, HMM Prob: .36 | | | GO:0003860 | 3-hydroxyisobutyryl-CoA hydrolase activity | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NF0125410OR3-hydroxyisobutyryl- hydrolase 1-likeANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0125410 OR 3-hydroxyisobutyryl- hydrolase 1-like AND Naegleria fowleri ATCC 30863 |
|
NF0125430 | mRNA1_NF0125430 | 2 | 2 | 1 | | | reverse | protein coding | No | 1800 | NF0125430 | zinc carboxypeptidase family protein | zinc carboxypeptidase family protein | | | Not Assigned | Nfow_scaffold00217:10,223..12,085(-) | Nfow_scaffold00217:10223..12085(-) | Nfow_scaffold00217 | Naegleria fowleri ATCC 30863 | 0 | OG6_101273 | 0 | 600 | 1800 | 69394 | 7.51 | 0 | | | | | GO:0004181;GO:0008270 | metallocarboxypeptidase activity;zinc ion binding | GO:0006508 | proteolysis | | | | | | | | 3.4.17.10 (Carboxypeptidase E) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0125430ORzinc carboxypeptidase family proteinANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0125430 OR zinc carboxypeptidase family protein AND Naegleria fowleri ATCC 30863 |
|
NF0125990 | mRNA1_NF0125990 | 1 | 1 | 1 | | 6 | reverse | protein coding | No | 2013 | NF0125990 | eukaryotic translation initiation factor 3 subunit b-like | eukaryotic translation initiation factor 3 subunit b-like | | | Not Assigned | Nfow_scaffold00221:6,517..8,529(-) | Nfow_scaffold00221:6517..8523(-) | Nfow_scaffold00221 | Naegleria fowleri ATCC 30863 | 14 | OG6_101924 | 0 | 668 | 2007 | 76042 | 5.62 | 0 | | | | | GO:0003676 | nucleic acid binding | | | | | | | | | | 3.6.3.14 (Transferred entry: 7.1.2.2) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0125990OReukaryotic translation initiation factor 3 subunit b-likeANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0125990 OR eukaryotic translation initiation factor 3 subunit b-like AND Naegleria fowleri ATCC 30863 |
|
NF0126000 | mRNA1_NF0126000 | 3 | 2 | 2 | | | forward | protein coding | No | 555 | NF0126000 | u4 tri-snrnp-associated protein 2 | u4 tri-snrnp-associated protein 2 | | | Not Assigned | Nfow_scaffold00221:8,585..10,333(+) | Nfow_scaffold00221:8585..9193(+) | Nfow_scaffold00221 | Naegleria fowleri ATCC 30863 | 9 | OG6_102786 | 0 | 185 | 555 | 20810 | 4.41 | 0 | | | | | GO:0008270 | zinc ion binding | | | | | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0126000ORu4 tri-snrnp-associated protein 2ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0126000 OR u4 tri-snrnp-associated protein 2 AND Naegleria fowleri ATCC 30863 |
|
NF0126390 | mRNA1_NF0126390 | 5 | 5 | 1 | | 34 | reverse | protein coding | No | 1558 | NF0126390 | serine protease -like | serine protease -like | | | Not Assigned | Nfow_scaffold00224:8,919..10,997(-) | Nfow_scaffold00224:8919..10963(-) | Nfow_scaffold00224 | Naegleria fowleri ATCC 30863 | 23 | OG6_100644 | 3 | 507 | 1524 | 56918 | 7.16 | 1 | HMM: TCMSKKMLRTSSLLLFSMSVMLLVFIISSVLHAR, NN: TCMSKKMLRTSSLLLFSMSVMLLVFIISSVLHAR | NN Sum: 4, NN D: .82, HMM Prob: .78 | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.16.2 (Lysosomal Pro-Xaa carboxypeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0126390ORserine protease -likeANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0126390 OR serine protease -like AND Naegleria fowleri ATCC 30863 |
|
NF0126520 | mRNA1_NF0126520 | 1 | 1 | 1 | | | reverse | protein coding | No | 2574 | NF0126520 | calpain-like protease | calpain-like protease | | | Not Assigned | Nfow_scaffold00225:2,347..4,920(-) | Nfow_scaffold00225:2347..4920(-) | Nfow_scaffold00225 | Naegleria fowleri ATCC 30863 | 1 | OG6_103851 | 0 | 857 | 2574 | 96755 | 9.02 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0126520ORcalpain-like proteaseANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0126520 OR calpain-like protease AND Naegleria fowleri ATCC 30863 |
|
NF0126900 | mRNA1_NF0126900 | 5 | 5 | 1 | | | reverse | protein coding | No | 2211 | NF0126900 | prolyl oligopeptidase | prolyl oligopeptidase | | | Not Assigned | Nfow_scaffold00228:3,915..6,598(-) | Nfow_scaffold00228:3915..6598(-) | Nfow_scaffold00228 | Naegleria fowleri ATCC 30863 | 1 | OG6_102873 | 0 | 736 | 2211 | 85184 | 4.96 | 0 | | | | | GO:0004252;GO:0070008;GO:0008236 | serine-type endopeptidase activity;serine-type exopeptidase activity;serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.21.83 (Oligopeptidase B) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0126900ORprolyl oligopeptidaseANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0126900 OR prolyl oligopeptidase AND Naegleria fowleri ATCC 30863 |
|
NF0126930 | mRNA1_NF0126930 | 1 | 1 | 1 | | | reverse | protein coding | No | 774 | NF0126930 | proteasome subunit alpha type-4-like | proteasome subunit alpha type-4-like | | | Not Assigned | Nfow_scaffold00228:10,191..10,964(-) | Nfow_scaffold00228:10191..10964(-) | Nfow_scaffold00228 | Naegleria fowleri ATCC 30863 | 10 | OG6_101968 | 0 | 257 | 774 | 29006 | 6.95 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0126930ORproteasome subunit alpha type-4-likeANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0126930 OR proteasome subunit alpha type-4-like AND Naegleria fowleri ATCC 30863 |
|
NF0127050 | mRNA1_NF0127050 | 1 | 1 | 1 | | | reverse | protein coding | No | 6645 | NF0127050 | acetyl- carboxylase | acetyl- carboxylase | | | Not Assigned | Nfow_scaffold00229:7,875..14,519(-) | Nfow_scaffold00229:7875..14519(-) | Nfow_scaffold00229 | Naegleria fowleri ATCC 30863 | 1 | OG6_101052 | 0 | 2214 | 6645 | 250868 | 6.14 | 0 | | | | | GO:0005524;GO:0003989;GO:0016874;GO:0046872 | ATP binding;acetyl-CoA carboxylase activity;ligase activity;metal ion binding | GO:0006633 | fatty acid biosynthetic process | | | | | | | | 6.4.1.2 (Acetyl-CoA carboxylase) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0127050ORacetyl- carboxylaseANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0127050 OR acetyl- carboxylase AND Naegleria fowleri ATCC 30863 |
|
NF0127480 | mRNA1_NF0127480 | 1 | 1 | 1 | 733 | | forward | protein coding | No | 2149 | NF0127480 | silent information regulator protein sir2 | silent information regulator protein sir2 | | | Not Assigned | Nfow_scaffold00232:13,796..15,944(+) | Nfow_scaffold00232:13796..15211(+) | Nfow_scaffold00232 | Naegleria fowleri ATCC 30863 | 18 | OG6_101827 | 0 | 471 | 1416 | 53508 | 9.20 | 0 | HMM: MLYWLLGSLPFVFLFSFAY, NN: MLYWLLGSLPFVFLFSFAYYK | NN Sum: 4, NN D: .63, HMM Prob: .96 | | | | | | | | | | | | | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0127480ORsilent information regulator protein sir2ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0127480 OR silent information regulator protein sir2 AND Naegleria fowleri ATCC 30863 |
|
NF0127690 | mRNA1_NF0127690 | 8 | 7 | 2 | | | reverse | protein coding | No | 1437 | NF0127690 | serine carboxypeptidase | serine carboxypeptidase | | | Not Assigned | Nfow_scaffold00234:4,848..6,929(-) | Nfow_scaffold00234:4848..6929(-) | Nfow_scaffold00234 | Naegleria fowleri ATCC 30863 | 6 | OG6_100109 | 9 | 478 | 1437 | 53866 | 8.20 | 1 | HMM: KLKKMKQLLPIMFMMMVLNAFILSSNSVVYAS, NN: KLKKMKQLLPIMFMMMVLNAFILSS | NN Sum: 4, NN D: .64, HMM Prob: .96 | | | GO:0004185 | serine-type carboxypeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.16.- (Serine-type carboxypeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0127690ORserine carboxypeptidaseANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0127690 OR serine carboxypeptidase AND Naegleria fowleri ATCC 30863 |
|
NF0128070 | mRNA1_NF0128070 | 1 | 1 | 1 | | | reverse | protein coding | No | 360 | NF0128070 | autophagy related protein atg8 | autophagy related protein atg8 | | | Not Assigned | Nfow_scaffold00238:3,116..3,475(-) | Nfow_scaffold00238:3116..3475(-) | Nfow_scaffold00238 | Naegleria fowleri ATCC 30863 | 11 | OG6_100707 | 1 | 119 | 360 | 13952 | 6.75 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NF0128070ORautophagy related protein atg8ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0128070 OR autophagy related protein atg8 AND Naegleria fowleri ATCC 30863 |
|
NF0128590 | mRNA1_NF0128590 | 2 | 2 | 1 | | | forward | protein coding | No | 3969 | NF0128590 | wd repeat-containing protein 65-like | wd repeat-containing protein 65-like | | | Not Assigned | Nfow_scaffold00243:8,566..12,633(+) | Nfow_scaffold00243:8566..12633(+) | Nfow_scaffold00243 | Naegleria fowleri ATCC 30863 | 0 | OG6_128057 | 0 | 1322 | 3969 | 152059 | 7.05 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NF0128590ORwd repeat-containing protein 65-likeANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0128590 OR wd repeat-containing protein 65-like AND Naegleria fowleri ATCC 30863 |
|
NF0129610 | mRNA1_NF0129610 | 1 | 1 | 1 | 1 | | reverse | protein coding | No | 844 | NF0129610 | pug domain-containing protein | pug domain-containing protein | | | Not Assigned | Nfow_scaffold00259:1..844(-) | Nfow_scaffold00259:2..844(-) | Nfow_scaffold00259 | Naegleria fowleri ATCC 30863 | 1 | OG6_129730 | 0 | 281 | 843 | 32542 | 6.92 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NF0129610ORpug domain-containing proteinANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0129610 OR pug domain-containing protein AND Naegleria fowleri ATCC 30863 |
|
NF0130580 | mRNA1_NF0130580 | 5 | 5 | 1 | | | forward | protein coding | No | 1461 | NF0130580 | serine carboxypeptidase-like 20-like | serine carboxypeptidase-like 20-like | | | Not Assigned | Nfow_scaffold00292:317..2,294(+) | Nfow_scaffold00292:317..2294(+) | Nfow_scaffold00292 | Naegleria fowleri ATCC 30863 | 6 | OG6_100109 | 10 | 486 | 1461 | 54401 | 7.53 | 1 | HMM: MFRNKFFSLLSLSLLLALSFLLLILLEFSSGQ, NN: MFRNKFFSLLSLSLLLALSFLLLILLEFSSGQ | NN Sum: 4, NN D: .81, HMM Prob: .97 | | | GO:0004185 | serine-type carboxypeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.16.- (Serine-type carboxypeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0130580ORserine carboxypeptidase-like 20-likeANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0130580 OR serine carboxypeptidase-like 20-like AND Naegleria fowleri ATCC 30863 |
|
NF0130780 | mRNA1_NF0130780 | 2 | 2 | 1 | | | reverse | protein coding | No | 1623 | NF0130780 | rhomboid-like protein isoform 1 | rhomboid-like protein isoform 1 | | | Not Assigned | Nfow_scaffold00314:6,051..7,842(-) | Nfow_scaffold00314:6051..7842(-) | Nfow_scaffold00314 | Naegleria fowleri ATCC 30863 | 1 | OG6_101864 | 0 | 540 | 1623 | 61049 | 9.91 | 6 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0130780ORrhomboid-like protein isoform 1ANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0130780 OR rhomboid-like protein isoform 1 AND Naegleria fowleri ATCC 30863 |
|
NF0130830 | mRNA1_NF0130830 | 4 | 2 | 2 | | | forward | protein coding | No | 474 | NF0130830 | serine protease family | serine protease family | | | Not Assigned | Nfow_scaffold00319:4..1,093(+) | Nfow_scaffold00319:4..629(+) | Nfow_scaffold00319 | Naegleria fowleri ATCC 30863 | 13 | OG6_100915 | 0 | 157 | 474 | 17888 | 7.05 | 0 | | | | | | | | | | | | | | | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0130830ORserine protease familyANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0130830 OR serine protease family AND Naegleria fowleri ATCC 30863 |
|
NF0131050 | mRNA1_NF0131050 | 2 | 2 | 1 | | 416 | forward | protein coding | No | 1097 | NF0131050 | glutaminyl-peptide cyclotransferase | glutaminyl-peptide cyclotransferase | | | Not Assigned | Nfow_scaffold00375:1,295..2,460(+) | Nfow_scaffold00375:1711..2460(+) | Nfow_scaffold00375 | Naegleria fowleri ATCC 30863 | 2 | OG6_102560 | 0 | 226 | 681 | 26804 | 5.56 | 0 | | | | | | | | | | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0131050ORglutaminyl-peptide cyclotransferaseANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0131050 OR glutaminyl-peptide cyclotransferase AND Naegleria fowleri ATCC 30863 |
|
NF0131410 | mRNA1_NF0131410 | 1 | 1 | 1 | | 1300 | reverse | protein coding | No | 3004 | NF0131410 | glutathione gamma-glutamylcysteinyltransferase | glutathione gamma-glutamylcysteinyltransferase | | | Not Assigned | Nfow_scaffold00498:96..3,099(-) | Nfow_scaffold00498:96..1799(-) | Nfow_scaffold00498 | Naegleria fowleri ATCC 30863 | 1 | OG6_106155 | 0 | 567 | 1704 | 65629 | 9.61 | 0 | | | | | GO:0016756;GO:0046872 | glutathione gamma-glutamylcysteinyltransferase activity;metal ion binding | GO:0046938;GO:0010038 | phytochelatin biosynthetic process;response to metal ion | | | | | | | | 2.3.2.15 (Glutathione gamma-glutamylcysteinyltransferase) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0131410ORglutathione gamma-glutamylcysteinyltransferaseANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0131410 OR glutathione gamma-glutamylcysteinyltransferase AND Naegleria fowleri ATCC 30863 |
|
NF0131910 | mRNA1_NF0131910 | 2 | 2 | 1 | 1 | | forward | protein coding | No | 1033 | NF0131910 | inactive rhomboid protein 1-like | inactive rhomboid protein 1-like | | | Not Assigned | Nfow_scaffold00710:51..1,294(+) | Nfow_scaffold00710:51..1293(+) | Nfow_scaffold00710 | Naegleria fowleri ATCC 30863 | 10 | OG6_100562 | 1 | 344 | 1032 | 38688 | 7.80 | 7 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | | 3.4.21.- (Serine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NF0131910ORinactive rhomboid protein 1-likeANDNaegleria fowleri ATCC 30863 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NF0131910 OR inactive rhomboid protein 1-like AND Naegleria fowleri ATCC 30863 |