|
PBANKA_0100300 | PBANKA_0100300.1 | 7 | 7 | 1 | | | forward | protein coding | Yes | 1305 | PBANKA_0100300 | lysophospholipase, putative, pseudogene | lysophospholipase, putative, pseudogene | 3425094 | | 1 | PbANKA_01_v3:33,270..34,584(+) | PbANKA_01_v3:33270..34584(+) | PbANKA_01_v3 | Plasmodium berghei ANKA | 0 | N/A (orthology not determined because poor protein quality) | 0 | 434 | 1305 | 49504 | 7.25 | 0 | | | | | | | | | | | | | | | | 2.7.11.1 (Non-specific serine/threonine protein kinase) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0100300ORlysophospholipase, putative, pseudogeneANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0100300 OR lysophospholipase, putative, pseudogene AND Plasmodium berghei ANKA |
|
PBANKA_0102600 | PBANKA_0102600.1 | 20 | 20 | 1 | | | reverse | protein coding | No | 5565 | PBANKA_0102600 | centrosomal protein CEP76, putative | centrosomal protein CEP76, putative | 3426502 | | 1 | PbANKA_01_v3:113,956..121,877(-) | PbANKA_01_v3:113956..121877(-) | PbANKA_01_v3 | Plasmodium berghei ANKA | 46 | OG6_126374 | 0 | 1854 | 5565 | 220803 | 7.38 | 0 | | | | | | | | | GO:0005813 | centrosome | | | | | | 1.3.-.- (Acting on the CH-CH group of donors.) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0102600ORcentrosomal protein CEP76, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0102600 OR centrosomal protein CEP76, putative AND Plasmodium berghei ANKA |
|
PBANKA_0107100 | PBANKA_0107100.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 708 | PBANKA_0107100 | proteasome subunit alpha type-2, putative | proteasome subunit alpha type-2, putative | 3427602 | A0A077X7Y0 | 1 | PbANKA_01_v3:285,801..286,753(-) | PbANKA_01_v3:285801..286753(-) | PbANKA_01_v3 | Plasmodium berghei ANKA | 43 | OG6_101969 | 0 | 235 | 708 | 26445 | 4.86 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0107100ORproteasome subunit alpha type-2, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0107100 OR proteasome subunit alpha type-2, putative AND Plasmodium berghei ANKA |
|
PBANKA_0201300 | PBANKA_0201300.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1371 | PBANKA_0201300 | lysophospholipase, putative | lysophospholipase, putative | 3428763 | | 2 | PbANKA_02_v3:53,529..54,899(+) | PbANKA_02_v3:53529..54899(+) | PbANKA_02_v3 | Plasmodium berghei ANKA | 458 | OG6_100231 | 3 | 456 | 1371 | 52167 | 5.92 | 0 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0201300ORlysophospholipase, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0201300 OR lysophospholipase, putative AND Plasmodium berghei ANKA |
|
PBANKA_0205400 | PBANKA_0205400.1 | 4 | 4 | 1 | | | forward | protein coding | No | 657 | PBANKA_0205400 | proteasome subunit beta type-3, putative | proteasome subunit beta type-3, putative | 3424978 | | 2 | PbANKA_02_v3:184,766..185,813(+) | PbANKA_02_v3:184766..185813(+) | PbANKA_02_v3 | Plasmodium berghei ANKA | 45 | OG6_101970 | 0 | 218 | 657 | 24508 | 4.70 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | GO:0019774 | proteasome core complex, beta-subunit complex | | | GO:0006511 | ubiquitin-dependent protein catabolic process | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0205400ORproteasome subunit beta type-3, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0205400 OR proteasome subunit beta type-3, putative AND Plasmodium berghei ANKA |
|
PBANKA_0208800 | PBANKA_0208800.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 8838 | PBANKA_0208800 | ubiquitin carboxyl-terminal hydrolase 1, putative | ubiquitin carboxyl-terminal hydrolase 1, putative | 3418582 | | 2 | PbANKA_02_v3:299,759..308,804(-) | PbANKA_02_v3:299759..308804(-) | PbANKA_02_v3 | Plasmodium berghei ANKA | 4 | OG6_105906 | 0 | 2945 | 8838 | 350626 | 8.75 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0006511 | ubiquitin-dependent protein catabolic process | | | | | GO:0042493 | response to drug | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0208800ORubiquitin carboxyl-terminal hydrolase 1, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0208800 OR ubiquitin carboxyl-terminal hydrolase 1, putative AND Plasmodium berghei ANKA |
|
PBANKA_0209700 | PBANKA_0209700.1 | 1 | 1 | 1 | | | forward | protein coding | No | 4614 | PBANKA_0209700 | zinc-carboxypeptidase, putative | zinc-carboxypeptidase, putative | 3421006 | A0A077X5R9 | 2 | PbANKA_02_v3:340,868..345,481(+) | PbANKA_02_v3:340868..345481(+) | PbANKA_02_v3 | Plasmodium berghei ANKA | 36 | OG6_101273 | 0 | 1537 | 4614 | 178825 | 9.79 | 0 | | | | | | | | | | | | | | | | 3.4.17.10 (Carboxypeptidase E) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0209700ORzinc-carboxypeptidase, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0209700 OR zinc-carboxypeptidase, putative AND Plasmodium berghei ANKA |
|
PBANKA_0210600 | PBANKA_0210600.1 | 4 | 4 | 1 | | | reverse | protein coding | No | 8367 | PBANKA_0210600 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | 3427062 | A0A077X661 | 2 | PbANKA_02_v3:383,882..392,643(-) | PbANKA_02_v3:383882..392643(-) | PbANKA_02_v3 | Plasmodium berghei ANKA | 46 | OG6_101317 | 0 | 2788 | 8367 | 326232 | 8.70 | 0 | | | | | GO:0005515;GO:0036459 | protein binding;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0210600ORubiquitin carboxyl-terminal hydrolase, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0210600 OR ubiquitin carboxyl-terminal hydrolase, putative AND Plasmodium berghei ANKA |
|
PBANKA_0211500 | PBANKA_0211500.1 | 3 | 3 | 1 | | | forward | protein coding | No | 771 | PBANKA_0211500 | proteasome subunit alpha type-5, putative | proteasome subunit alpha type-5, putative | 3428359 | | 2 | PbANKA_02_v3:416,055..417,175(+) | PbANKA_02_v3:416055..417175(+) | PbANKA_02_v3 | Plasmodium berghei ANKA | 44 | OG6_101621 | 0 | 256 | 771 | 28347 | 4.89 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0211500ORproteasome subunit alpha type-5, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0211500 OR proteasome subunit alpha type-5, putative AND Plasmodium berghei ANKA |
|
PBANKA_0212800 | PBANKA_0212800.1 | 4 | 4 | 1 | | | reverse | protein coding | No | 1686 | PBANKA_0212800 | alpha/beta hydrolase, putative | alpha/beta hydrolase, putative | 3427805 | | 2 | PbANKA_02_v3:476,469..478,970(-) | PbANKA_02_v3:476469..478970(-) | PbANKA_02_v3 | Plasmodium berghei ANKA | 44 | OG6_110414 | 0 | 561 | 1686 | 65401 | 9.18 | 0 | | | | | | | | | | | GO:0016298 | lipase activity | GO:0006629 | lipid metabolic process | | 3.-.-.- (Hydrolases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0212800ORalpha/beta hydrolase, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0212800 OR alpha/beta hydrolase, putative AND Plasmodium berghei ANKA |
|
PBANKA_0216741 | PBANKA_0216741.1 | 4 | 4 | 1 | | | forward | protein coding | Yes | 1308 | PBANKA_0216741 | lysophospholipase, putative, pseudogene | lysophospholipase, putative, pseudogene | | | 2 | PbANKA_02_v3:608,692..610,004(+) | PbANKA_02_v3:608692..610004(+) | PbANKA_02_v3 | Plasmodium berghei ANKA | 0 | N/A (orthology not determined because poor protein quality) | 0 | 435 | 1308 | 49997 | 6.44 | 0 | | | | | | | | | | | | | | | | 2.7.11.1 (Non-specific serine/threonine protein kinase) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0216741ORlysophospholipase, putative, pseudogeneANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0216741 OR lysophospholipase, putative, pseudogene AND Plasmodium berghei ANKA |
|
PBANKA_0304700 | PBANKA_0304700.1 | 6 | 6 | 1 | | | reverse | protein coding | No | 2160 | PBANKA_0304700 | serine repeat antigen 5 | serine repeat antigen 5 | 3426945 | | 3 | PbANKA_03_v3:149,412..152,465(-) | PbANKA_03_v3:149412..152465(-) | PbANKA_03_v3 | Plasmodium berghei ANKA | 376 | OG6_126098 | 4 | 719 | 2160 | 83433 | 7.49 | 0 | NN: MKTYKIKYFLLLSLFINLINQAKSK, HMM: MKTYKIKYFLLLSLFINLINQAKSK | NN Sum: 4, NN D: .78, HMM Prob: .89 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | GO:0035891 | exit from host cell | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0304700ORserine repeat antigen 5ANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0304700 OR serine repeat antigen 5 AND Plasmodium berghei ANKA |
|
PBANKA_0304800 | PBANKA_0304800.1 | 4 | 4 | 1 | | | reverse | protein coding | No | 2772 | PBANKA_0304800 | serine repeat antigen 4 | serine repeat antigen 4 | 3425086 | | 3 | PbANKA_03_v3:153,928..157,135(-) | PbANKA_03_v3:153928..157135(-) | PbANKA_03_v3 | Plasmodium berghei ANKA | 376 | OG6_126098 | 4 | 923 | 2772 | 106796 | 5.26 | 0 | HMM: MKPRIYLLLVSCAIFTINIHEINTQ, NN: MKPRIYLLLVSCAIFTINIHEINTQ | NN Sum: 4, NN D: .54, HMM Prob: .87 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0304800ORserine repeat antigen 4ANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0304800 OR serine repeat antigen 4 AND Plasmodium berghei ANKA |
|
PBANKA_0304900 | PBANKA_0304900.1 | 4 | 4 | 1 | | | reverse | protein coding | No | 3291 | PBANKA_0304900 | serine repeat antigen 3 | serine repeat antigen 3 | 3429011 | | 3 | PbANKA_03_v3:158,235..161,950(-) | PbANKA_03_v3:158235..161950(-) | PbANKA_03_v3 | Plasmodium berghei ANKA | 376 | OG6_126098 | 4 | 1096 | 3291 | 123200 | 5.72 | 0 | NN: MARLSSIVFIICLLLCNNAISD, HMM: MARLSSIVFIICLLLCNNAISD | NN Sum: 4, NN D: .82, HMM Prob: 1 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | GO:0005737;GO:0030430 | cytoplasm;host cell cytoplasm | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0304900ORserine repeat antigen 3ANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0304900 OR serine repeat antigen 3 AND Plasmodium berghei ANKA |
|
PBANKA_0305000 | PBANKA_0305000.1 | 4 | 4 | 1 | | | reverse | protein coding | No | 3369 | PBANKA_0305000 | serine repeat antigen 2 | serine repeat antigen 2 | 3429014 | | 3 | PbANKA_03_v3:163,296..167,127(-) | PbANKA_03_v3:163296..167127(-) | PbANKA_03_v3 | Plasmodium berghei ANKA | 376 | OG6_126098 | 4 | 1122 | 3369 | 123983 | 4.66 | 0 | NN: MKTYIPLIFLLYAMLGNDIINCR, HMM: MKTYIPLIFLLYAMLGNDIINCR | NN Sum: 4, NN D: .59, HMM Prob: .86 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0305000ORserine repeat antigen 2ANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0305000 OR serine repeat antigen 2 AND Plasmodium berghei ANKA |
|
PBANKA_0305100 | PBANKA_0305100.1 | 4 | 4 | 1 | | | reverse | protein coding | No | 4221 | PBANKA_0305100 | serine repeat antigen 1 | serine repeat antigen 1 | 3429012 | | 3 | PbANKA_03_v3:168,669..173,334(-) | PbANKA_03_v3:168669..173334(-) | PbANKA_03_v3 | Plasmodium berghei ANKA | 376 | OG6_126098 | 4 | 1406 | 4221 | 154916 | 4.48 | 0 | NN: MRRLSILFILYALLIRNYGLGV, HMM: MRRLSILFILYALLIRNYGLGV | NN Sum: 4, NN D: .75, HMM Prob: 1 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0305100ORserine repeat antigen 1ANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0305100 OR serine repeat antigen 1 AND Plasmodium berghei ANKA |
|
PBANKA_0311600 | PBANKA_0311600.1 | 2 | 2 | 1 | | | forward | protein coding | No | 3618 | PBANKA_0311600 | conserved Plasmodium protein, unknown function | conserved Plasmodium protein, unknown function | 3419439 | A0A077X6L7 | 3 | PbANKA_03_v3:403,216..407,019(+) | PbANKA_03_v3:403216..407019(+) | PbANKA_03_v3 | Plasmodium berghei ANKA | 20 | OG6_532626 | 0 | 1205 | 3618 | 140848 | 9.06 | 10 | | | | | | | | | GO:0016021 | integral component of membrane | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0311600ORconserved Plasmodium protein, unknown functionANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0311600 OR conserved Plasmodium protein, unknown function AND Plasmodium berghei ANKA |
|
PBANKA_0405700 | PBANKA_0405700.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 993 | PBANKA_0405700 | ATP-dependent Clp protease proteolytic subunit, putative | ATP-dependent Clp protease proteolytic subunit, putative | 3425164 | | 4 | PbANKA_04_v3:203,138..204,130(-) | PbANKA_04_v3:203138..204130(-) | PbANKA_04_v3 | Plasmodium berghei ANKA | 44 | OG6_100939 | 0 | 330 | 993 | 38696 | 10.05 | 0 | NN: MIYLILFIFLILIKNNAIEAK, HMM: MIYLILFIFLILIKNNAI | NN Sum: 4, NN D: .76, HMM Prob: .88 | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0020011 | apicoplast | | | | | 3.4.21.92 (Endopeptidase Clp) | 3.4.21.92 (Endopeptidase Clp) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0405700ORATP-dependent Clp protease proteolytic subunit, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0405700 OR ATP-dependent Clp protease proteolytic subunit, putative AND Plasmodium berghei ANKA |
|
PBANKA_0409700 | PBANKA_0409700.1 | 15 | 15 | 1 | | | forward | protein coding | No | 1326 | PBANKA_0409700 | plasmepsin VI, putative | plasmepsin VI, putative | 3425065 | | 4 | PbANKA_04_v3:359,895..362,966(+) | PbANKA_04_v3:359895..362966(+) | PbANKA_04_v3 | Plasmodium berghei ANKA | 158 | OG6_100536 | 1 | 441 | 1326 | 50318 | 7.49 | 1 | HMM: MTNFCIKSYLFLYLSFLLFFDIITI, NN: MTNFCIKSYLFLYLSFLLFFDIITIFHVSSI | NN Sum: 4, NN D: .69, HMM Prob: .06 | | | GO:0004190 | aspartic-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0409700ORplasmepsin VI, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0409700 OR plasmepsin VI, putative AND Plasmodium berghei ANKA |
|
PBANKA_0411950 | PBANKA_0411950.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3927 | PBANKA_0411950 | conserved Plasmodium protein, unknown function | conserved Plasmodium protein, unknown function | 3,42,05,09,34,21,725 | A0A077X8H8,A0A077XA41 | 4 | PbANKA_04_v3:424,426..428,352(-) | PbANKA_04_v3:424426..428352(-) | PbANKA_04_v3 | Plasmodium berghei ANKA | 42 | OG6_533302 | 0 | 1308 | 3927 | 156515 | 9.85 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0411950ORconserved Plasmodium protein, unknown functionANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0411950 OR conserved Plasmodium protein, unknown function AND Plasmodium berghei ANKA |
|
PBANKA_0412000 | PBANKA_0412000.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1134 | PBANKA_0412000 | DER1-like protein, putative | DER1-like protein, putative | | | 4 | PbANKA_04_v3:428,593..429,726(-) | PbANKA_04_v3:428593..429726(-) | PbANKA_04_v3 | Plasmodium berghei ANKA | 87 | OG6_130104 | 1 | 377 | 1134 | 45522 | 9.71 | 3 | HMM: MVVSKFLFFLSLIASVGYYYYCDAK, NN: MVVSKFLFFLSLIASVGYY | NN Sum: 4, NN D: .72, HMM Prob: .96 | | | | | | | GO:0020011;GO:0016021 | apicoplast;integral component of membrane | | | GO:0030433 | ubiquitin-dependent ERAD pathway | | | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0412000ORDER1-like protein, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0412000 OR DER1-like protein, putative AND Plasmodium berghei ANKA |
|
PBANKA_0416800 | PBANKA_0416800.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 4161 | PBANKA_0416800 | ubiquitin specific protease, putative | ubiquitin specific protease, putative | 3429117 | | 4 | PbANKA_04_v3:626,770..631,082(-) | PbANKA_04_v3:626770..631082(-) | PbANKA_04_v3 | Plasmodium berghei ANKA | 35 | OG6_122792 | 0 | 1386 | 4161 | 161513 | 8.65 | 0 | | | | | GO:0004843;GO:0036459 | thiol-dependent ubiquitin-specific protease activity;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0416800ORubiquitin specific protease, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0416800 OR ubiquitin specific protease, putative AND Plasmodium berghei ANKA |
|
PBANKA_0417000 | PBANKA_0417000.1 | 1 | 1 | 1 | | | forward | protein coding | No | 558 | PBANKA_0417000 | signal peptidase complex subunit 3, putative | signal peptidase complex subunit 3, putative | 3429118 | A0A077XAA1 | 4 | PbANKA_04_v3:635,115..635,672(+) | PbANKA_04_v3:635115..635672(+) | PbANKA_04_v3 | Plasmodium berghei ANKA | 43 | OG6_102447 | 0 | 185 | 558 | 21833 | 9.18 | 1 | HMM: MDSLLNRINVIFYSMALCFVTLCLFNYGTSF, NN: MDSLLNRINVIFYSMALCFVTLCLFNYGTSF | NN Sum: 4, NN D: .72, HMM Prob: .1 | GO:0016021;GO:0005787 | integral component of membrane;signal peptidase complex | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | | | | | | | 3.4.21.89 (Signal peptidase I) | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0417000ORsignal peptidase complex subunit 3, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0417000 OR signal peptidase complex subunit 3, putative AND Plasmodium berghei ANKA |
|
PBANKA_0501500 | PBANKA_0501500.1 | 2 | 2 | 1 | | | forward | protein coding | No | 1593 | PBANKA_0501500 | enoyl-CoA hydratase-related protein, putative | enoyl-CoA hydratase-related protein, putative | 3419987 | | 5 | PbANKA_05_v3:60,539..62,366(+) | PbANKA_05_v3:60539..62366(+) | PbANKA_05_v3 | Plasmodium berghei ANKA | 43 | OG6_134153 | 0 | 530 | 1593 | 62450 | 8.62 | 0 | | | | | GO:0003860 | 3-hydroxyisobutyryl-CoA hydrolase activity | | | | | | | | | 4.2.1.17 (Enoyl-CoA hydratase) | 3.1.2.4 (3-hydroxyisobutyryl-CoA hydrolase) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0501500ORenoyl-CoA hydratase-related protein, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0501500 OR enoyl-CoA hydratase-related protein, putative AND Plasmodium berghei ANKA |
|
PBANKA_0502600 | PBANKA_0502600.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2148 | PBANKA_0502600 | peptidase, putative | peptidase, putative | 3424627 | A0A077X6P8 | 5 | PbANKA_05_v3:96,257..98,404(-) | PbANKA_05_v3:96257..98404(-) | PbANKA_05_v3 | Plasmodium berghei ANKA | 44 | OG6_124535 | 0 | 715 | 2148 | 82920 | 5.04 | 2 | HMM: MDIKNTICNRFKFFLILIVVLICTFGF, NN: MDIKNTICNRFKFFLILIVVLICTFGF | NN Sum: 4, NN D: .73, HMM Prob: .05 | | | | | | | | | | | | | | 3.1.3.16 (Protein-serine/threonine phosphatase) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0502600ORpeptidase, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0502600 OR peptidase, putative AND Plasmodium berghei ANKA |
|
PBANKA_0504100 | PBANKA_0504100.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 375 | PBANKA_0504100 | autophagy-related protein 8 | autophagy-related protein 8 | 3427121 | A0A077XAG6 | 5 | PbANKA_05_v3:166,490..166,864(-) | PbANKA_05_v3:166490..166864(-) | PbANKA_05_v3 | Plasmodium berghei ANKA | 45 | OG6_100707 | 0 | 124 | 375 | 14685 | 8.06 | 0 | | | | | | | | | GO:0020011;GO:0031410;GO:0005829 | apicoplast;cytoplasmic vesicle;cytosol | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0504100ORautophagy-related protein 8ANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0504100 OR autophagy-related protein 8 AND Plasmodium berghei ANKA |
|
PBANKA_0514600 | PBANKA_0514600.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1743 | PBANKA_0514600 | tRNA N6-adenosine threonylcarbamoyltransferase, putative | tRNA N6-adenosine threonylcarbamoyltransferase, putative | 3424431 | A0A077XAS4 | 5 | PbANKA_05_v3:554,171..555,913(-) | PbANKA_05_v3:554171..555913(-) | PbANKA_05_v3 | Plasmodium berghei ANKA | 88 | OG6_100288 | 1 | 580 | 1743 | 67942 | 8.24 | 0 | | | | | | | | | GO:0000408;GO:0005737 | EKC/KEOPS complex;cytoplasm | | | | | 2.3.1.234 (N(6)-L-threonylcarbamoyladenine synthase) | 2.3.1.234 (N(6)-L-threonylcarbamoyladenine synthase) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0514600ORtRNA N6-adenosine threonylcarbamoyltransferase, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0514600 OR tRNA N6-adenosine threonylcarbamoyltransferase, putative AND Plasmodium berghei ANKA |
|
PBANKA_0515350 | PBANKA_0515350.1 | 8 | 8 | 1 | | | forward | protein coding | No | 1038 | PBANKA_0515350 | OTU-like cysteine protease, putative | OTU-like cysteine protease, putative | 3424280 | | 5 | PbANKA_05_v3:571,307..573,179(+) | PbANKA_05_v3:571307..573179(+) | PbANKA_05_v3 | Plasmodium berghei ANKA | 45 | OG6_104209 | 0 | 345 | 1038 | 41363 | 6.72 | 0 | | | | | | | | | GO:0020011;GO:0005829;GO:0031982 | apicoplast;cytosol;vesicle | GO:0008233 | peptidase activity | GO:1903060 | negative regulation of protein lipidation | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0515350OROTU-like cysteine protease, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0515350 OR OTU-like cysteine protease, putative AND Plasmodium berghei ANKA |
|
PBANKA_0516300 | PBANKA_0516300.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 786 | PBANKA_0516300 | DER1-like protein, putative | DER1-like protein, putative | 3427100 | A0A077X7W1 | 5 | PbANKA_05_v3:603,979..605,033(-) | PbANKA_05_v3:603979..605033(-) | PbANKA_05_v3 | Plasmodium berghei ANKA | 44 | OG6_113960 | 0 | 261 | 786 | 30903 | 9.83 | 5 | HMM: MDLSGPEVWYNNLPNVTKYMIIIIFLVTLLITCNLL, NN: MDLSGPEVWYNNLPNVTKYMIIIIFLVTLLITCNLL | NN Sum: 3, NN D: .48, HMM Prob: .01 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0516300ORDER1-like protein, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0516300 OR DER1-like protein, putative AND Plasmodium berghei ANKA |
|
PBANKA_0517600 | PBANKA_0517600.1 | 8 | 8 | 1 | | | forward | protein coding | No | 1416 | PBANKA_0517600 | plasmepsin VII | plasmepsin VII | 3428923 | | 5 | PbANKA_05_v3:643,900..646,279(+) | PbANKA_05_v3:643900..646279(+) | PbANKA_05_v3 | Plasmodium berghei ANKA | 46 | OG6_139465 | 0 | 471 | 1416 | 54285 | 8.54 | 1 | HMM: MKSVYHHFAIIFFLKLFLCNCILSI, NN: MKSVYHHFAIIFFLKLFLCNCILSI | NN Sum: 4, NN D: .73, HMM Prob: .82 | | | GO:0004190 | aspartic-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0517600ORplasmepsin VIIANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0517600 OR plasmepsin VII AND Plasmodium berghei ANKA |
|
PBANKA_0604600 | PBANKA_0604600.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3519 | PBANKA_0604600 | conserved protein, unknown function | conserved protein, unknown function | 3427987 | | 6 | PbANKA_06_v3:237,659..241,177(-) | PbANKA_06_v3:237659..241177(-) | PbANKA_06_v3 | Plasmodium berghei ANKA | 43 | OG6_102131 | 0 | 1172 | 3519 | 134286 | 6.70 | 2 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0604600ORconserved protein, unknown functionANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0604600 OR conserved protein, unknown function AND Plasmodium berghei ANKA |
|
PBANKA_0612000 | PBANKA_0612000.1 | 1 | 1 | 1 | | | forward | protein coding | No | 723 | PBANKA_0612000 | ATP-dependent Clp protease proteolytic subunit, putative | ATP-dependent Clp protease proteolytic subunit, putative | 3426391 | | 6 | PbANKA_06_v3:520,123..520,845(+) | PbANKA_06_v3:520123..520845(+) | PbANKA_06_v3 | Plasmodium berghei ANKA | 42 | OG6_113660 | 0 | 240 | 723 | 27959 | 9.53 | 0 | HMM: MRLFWIFIINFIYFCVCK, NN: MRLFWIFIINFIYFCVCK | NN Sum: 4, NN D: .68, HMM Prob: .31 | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0020011 | apicoplast | | | | | 3.4.21.92 (Endopeptidase Clp) | 3.4.21.92 (Endopeptidase Clp) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0612000ORATP-dependent Clp protease proteolytic subunit, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0612000 OR ATP-dependent Clp protease proteolytic subunit, putative AND Plasmodium berghei ANKA |
|
PBANKA_0612100 | PBANKA_0612100.1 | 2 | 2 | 1 | | | forward | protein coding | No | 2538 | PBANKA_0612100 | conserved protein, unknown function | conserved protein, unknown function | 3427222 | A0A077X8I3 | 6 | PbANKA_06_v3:521,120..523,739(+) | PbANKA_06_v3:521120..523739(+) | PbANKA_06_v3 | Plasmodium berghei ANKA | 45 | OG6_146174 | 0 | 845 | 2538 | 101514 | 9.24 | 0 | | | | | | | | | | | | | | | | 3.4.21.92 (Endopeptidase Clp) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0612100ORconserved protein, unknown functionANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0612100 OR conserved protein, unknown function AND Plasmodium berghei ANKA |
|
PBANKA_0616300 | PBANKA_0616300.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1389 | PBANKA_0616300 | conserved Plasmodium protein, unknown function | conserved Plasmodium protein, unknown function | 3424016 | A0A077X7N8 | 6 | PbANKA_06_v3:703,263..704,651(-) | PbANKA_06_v3:703263..704651(-) | PbANKA_06_v3 | Plasmodium berghei ANKA | 44 | OG6_533066 | 0 | 462 | 1389 | 54060 | 9.29 | 6 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0616300ORconserved Plasmodium protein, unknown functionANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0616300 OR conserved Plasmodium protein, unknown function AND Plasmodium berghei ANKA |
|
PBANKA_0619800 | PBANKA_0619800.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3138 | PBANKA_0619800 | zinc finger protein, putative | zinc finger protein, putative | 3425484 | A0A077X7R3 | 6 | PbANKA_06_v3:806,402..809,539(-) | PbANKA_06_v3:806402..809539(-) | PbANKA_06_v3 | Plasmodium berghei ANKA | 43 | OG6_532410 | 0 | 1045 | 3138 | 124451 | 8.84 | 0 | | | | | GO:0008270 | zinc ion binding | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0619800ORzinc finger protein, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0619800 OR zinc finger protein, putative AND Plasmodium berghei ANKA |
|
PBANKA_0623200 | PBANKA_0623200.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1737 | PBANKA_0623200 | lysophospholipase, putative | lysophospholipase, putative | 3426692 | | 6 | PbANKA_06_v3:948,561..950,297(+) | PbANKA_06_v3:948561..950297(+) | PbANKA_06_v3 | Plasmodium berghei ANKA | 458 | OG6_100231 | 3 | 578 | 1737 | 64358 | 4.34 | 0 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0623200ORlysophospholipase, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0623200 OR lysophospholipase, putative AND Plasmodium berghei ANKA |
|
PBANKA_0702700 | PBANKA_0702700.1 | 4 | 4 | 1 | | | reverse | protein coding | No | 801 | PBANKA_0702700 | rhomboid protease ROM3 | rhomboid protease ROM3 | 3425090 | | 7 | PbANKA_07_v3:140,162..141,457(-) | PbANKA_07_v3:140162..141457(-) | PbANKA_07_v3 | Plasmodium berghei ANKA | 93 | OG6_100562 | 1 | 266 | 801 | 30446 | 7.60 | 7 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | 3.4.21.105 (Rhomboid protease) | 3.4.21.- (Serine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0702700ORrhomboid protease ROM3ANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0702700 OR rhomboid protease ROM3 AND Plasmodium berghei ANKA |
|
PBANKA_0704300 | PBANKA_0704300.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1125 | PBANKA_0704300 | SPRY domain, putative | SPRY domain, putative | 3421456 | | 7 | PbANKA_07_v3:197,195..198,319(-) | PbANKA_07_v3:197195..198319(-) | PbANKA_07_v3 | Plasmodium berghei ANKA | 44 | OG6_102272 | 0 | 374 | 1125 | 43448 | 8.51 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0704300ORSPRY domain, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0704300 OR SPRY domain, putative AND Plasmodium berghei ANKA |
|
PBANKA_0704400 | PBANKA_0704400.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1314 | PBANKA_0704400 | alpha/beta hydrolase, putative | alpha/beta hydrolase, putative | 3419643 | A0A077X7Z1 | 7 | PbANKA_07_v3:200,318..201,631(+) | PbANKA_07_v3:200318..201631(+) | PbANKA_07_v3 | Plasmodium berghei ANKA | 67 | OG6_129556 | 0 | 437 | 1314 | 51170 | 9.92 | 2 | | | | | | | | | | | | | | | | 3.4.11.- (Aminopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0704400ORalpha/beta hydrolase, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0704400 OR alpha/beta hydrolase, putative AND Plasmodium berghei ANKA |
|
PBANKA_0707200 | PBANKA_0707200.1 | 5 | 5 | 1 | | | reverse | protein coding | No | 1506 | PBANKA_0707200 | alpha/beta hydrolase, putative | alpha/beta hydrolase, putative | 3427466 | | 7 | PbANKA_07_v3:298,730..300,778(-) | PbANKA_07_v3:298730..300778(-) | PbANKA_07_v3 | Plasmodium berghei ANKA | 44 | OG6_105308 | 0 | 501 | 1506 | 59119 | 8.79 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0707200ORalpha/beta hydrolase, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0707200 OR alpha/beta hydrolase, putative AND Plasmodium berghei ANKA |
|
PBANKA_0712200 | PBANKA_0712200.1 | 11 | 11 | 1 | | | forward | protein coding | No | 864 | PBANKA_0712200 | BEM46-like protein, putative | BEM46-like protein, putative | 3422711 | | 7 | PbANKA_07_v3:467,048..469,225(+) | PbANKA_07_v3:467048..469225(+) | PbANKA_07_v3 | Plasmodium berghei ANKA | 45 | OG6_101827 | 0 | 287 | 864 | 32737 | 9.13 | 3 | NN: MVLKQVIISIIVAVIASIALINTY, HMM: MVLKQVIISIIVAVIASIALINTY | NN Sum: 3, NN D: .66, HMM Prob: .64 | | | | | | | GO:0005886 | plasma membrane | GO:0016298 | lipase activity | GO:0048469;GO:0006629 | cell maturation;lipid metabolic process | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0712200ORBEM46-like protein, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0712200 OR BEM46-like protein, putative AND Plasmodium berghei ANKA |
|
PBANKA_0714200 | PBANKA_0714200.1 | 1 | 1 | 1 | | | forward | protein coding | No | 3135 | PBANKA_0714200 | chaperone protein ClpB1, putative | chaperone protein ClpB1, putative | 3428617 | | 7 | PbANKA_07_v3:536,960..540,094(+) | PbANKA_07_v3:536960..540094(+) | PbANKA_07_v3 | Plasmodium berghei ANKA | 95 | OG6_100223 | 1 | 1044 | 3135 | 119003 | 9.30 | 0 | NN: MQKNFIALFVIITISFLCKQGDGK, HMM: MQKNFIALFVIITISFLCKQGDGK | NN Sum: 4, NN D: .68, HMM Prob: .82 | | | GO:0005524 | ATP binding | GO:0019538 | protein metabolic process | GO:0020011 | apicoplast | GO:0016887 | ATPase activity | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0714200ORchaperone protein ClpB1, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0714200 OR chaperone protein ClpB1, putative AND Plasmodium berghei ANKA |
|
PBANKA_0715600 | PBANKA_0715600.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 1188 | PBANKA_0715600 | 26S protease regulatory subunit 6B, putative | 26S protease regulatory subunit 6B, putative | 3423610 | | 7 | PbANKA_07_v3:576,357..577,872(-) | PbANKA_07_v3:576357..577872(-) | PbANKA_07_v3 | Plasmodium berghei ANKA | 42 | OG6_101965 | 0 | 395 | 1188 | 45191 | 9.45 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | GO:0008540 | proteasome regulatory particle, base subcomplex | | | GO:0070682;GO:0006511 | proteasome regulatory particle assembly;ubiquitin-dependent protein catabolic process | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0715600OR26S protease regulatory subunit 6B, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0715600 OR 26S protease regulatory subunit 6B, putative AND Plasmodium berghei ANKA |
|
PBANKA_0715900 | PBANKA_0715900.1 | 4 | 4 | 1 | | | reverse | protein coding | No | 2592 | PBANKA_0715900 | ubiquitin carboxyl-terminal hydrolase 13, putative | ubiquitin carboxyl-terminal hydrolase 13, putative | 3427892 | A0A077X9E2 | 7 | PbANKA_07_v3:582,556..585,474(-) | PbANKA_07_v3:582556..585474(-) | PbANKA_07_v3 | Plasmodium berghei ANKA | 42 | OG6_101380 | 0 | 863 | 2592 | 99618 | 5.40 | 0 | | | | | GO:0005515;GO:0004843;GO:0036459;GO:0008270 | protein binding;thiol-dependent ubiquitin-specific protease activity;thiol-dependent ubiquitinyl hydrolase activity;zinc ion binding | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | GO:0101005 | ubiquitinyl hydrolase activity | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0715900ORubiquitin carboxyl-terminal hydrolase 13, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0715900 OR ubiquitin carboxyl-terminal hydrolase 13, putative AND Plasmodium berghei ANKA |
|
PBANKA_0721400 | PBANKA_0721400.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 939 | PBANKA_0721400 | conserved Plasmodium protein, unknown function | conserved Plasmodium protein, unknown function | 3424411 | A0A077XBD5 | 7 | PbANKA_07_v3:776,608..777,690(-) | PbANKA_07_v3:776608..777690(-) | PbANKA_07_v3 | Plasmodium berghei ANKA | 43 | OG6_174320 | 0 | 312 | 939 | 36923 | 9.53 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0721400ORconserved Plasmodium protein, unknown functionANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0721400 OR conserved Plasmodium protein, unknown function AND Plasmodium berghei ANKA |
|
PBANKA_0807400 | PBANKA_0807400.1 | 1 | 1 | 1 | | | forward | protein coding | No | 675 | PBANKA_0807400 | 26S proteasome non-ATPase regulatory subunit 9, putative | 26S proteasome non-ATPase regulatory subunit 9, putative | 3426262 | A0A077XDQ3 | 8 | PbANKA_08_v3:356,364..357,038(+) | PbANKA_08_v3:356364..357038(+) | PbANKA_08_v3 | Plasmodium berghei ANKA | 44 | OG6_102356 | 0 | 224 | 675 | 26007 | 5.98 | 0 | | | | | GO:0005515 | protein binding | | | GO:0005838 | proteasome regulatory particle | | | GO:0070682 | proteasome regulatory particle assembly | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0807400OR26S proteasome non-ATPase regulatory subunit 9, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0807400 OR 26S proteasome non-ATPase regulatory subunit 9, putative AND Plasmodium berghei ANKA |
|
PBANKA_0808200 | PBANKA_0808200.1 | 2 | 2 | 1 | | | forward | protein coding | No | 753 | PBANKA_0808200 | proteasome subunit alpha type-3, putative | proteasome subunit alpha type-3, putative | 3425242 | A0A077XBX2 | 8 | PbANKA_08_v3:405,775..406,632(+) | PbANKA_08_v3:405775..406632(+) | PbANKA_08_v3 | Plasmodium berghei ANKA | 44 | OG6_102011 | 0 | 250 | 753 | 28728 | 6.71 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0808200ORproteasome subunit alpha type-3, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0808200 OR proteasome subunit alpha type-3, putative AND Plasmodium berghei ANKA |
|
PBANKA_0808900 | PBANKA_0808900.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2328 | PBANKA_0808900 | ATP-dependent protease ATPase subunit ClpY, putative | ATP-dependent protease ATPase subunit ClpY, putative | 3426292 | | 8 | PbANKA_08_v3:424,487..426,814(-) | PbANKA_08_v3:424487..426814(-) | PbANKA_08_v3 | Plasmodium berghei ANKA | 44 | OG6_106348 | 0 | 775 | 2328 | 89552 | 8.74 | 0 | | | GO:0009376;GO:0005737 | HslUV protease complex;cytoplasm | GO:0005524;GO:0016887;GO:0070011 | ATP binding;ATPase activity;peptidase activity, acting on L-amino acid peptides | | | GO:0009376 | HslUV protease complex | | | | | | 2.7.1.71 (Shikimate kinase) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0808900ORATP-dependent protease ATPase subunit ClpY, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0808900 OR ATP-dependent protease ATPase subunit ClpY, putative AND Plasmodium berghei ANKA |
|
PBANKA_0813900 | PBANKA_0813900.1 | 2 | 2 | 1 | | | forward | protein coding | No | 960 | PBANKA_0813900 | 26S proteasome regulatory subunit RPN8, putative | 26S proteasome regulatory subunit RPN8, putative | 3427881 | A0A077XC19 | 8 | PbANKA_08_v3:602,160..603,273(+) | PbANKA_08_v3:602160..603273(+) | PbANKA_08_v3 | Plasmodium berghei ANKA | 47 | OG6_102054 | 0 | 319 | 960 | 36839 | 7.04 | 0 | | | | | GO:0005515 | protein binding | | | GO:0000502 | proteasome complex | | | | | | 3.1.3.16 (Protein-serine/threonine phosphatase) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0813900OR26S proteasome regulatory subunit RPN8, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0813900 OR 26S proteasome regulatory subunit RPN8, putative AND Plasmodium berghei ANKA |
|
PBANKA_0814500 | PBANKA_0814500.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 1314 | PBANKA_0814500 | protease, putative | protease, putative | 3426520 | | 8 | PbANKA_08_v3:616,152..617,728(-) | PbANKA_08_v3:616152..617728(-) | PbANKA_08_v3 | Plasmodium berghei ANKA | 43 | OG6_112025 | 0 | 437 | 1314 | 52108 | 9.64 | 9 | HMM: MMYMVFISLCFNIICCI, NN: MMYMVFISLCFNIICCI | NN Sum: 4, NN D: .74, HMM Prob: .54 | GO:0016020 | membrane | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0814500ORprotease, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0814500 OR protease, putative AND Plasmodium berghei ANKA |
|
PBANKA_0819300 | PBANKA_0819300.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 942 | PBANKA_0819300 | eukaryotic translation initiation factor 3 subunit F, putative | eukaryotic translation initiation factor 3 subunit F, putative | 3427043 | A0A077XE50 | 8 | PbANKA_08_v3:767,737..768,758(-) | PbANKA_08_v3:767737..768758(-) | PbANKA_08_v3 | Plasmodium berghei ANKA | 44 | OG6_103242 | 0 | 313 | 942 | 36056 | 6.79 | 0 | | | | | GO:0005515 | protein binding | | | GO:0005852 | eukaryotic translation initiation factor 3 complex | GO:0003743 | translation initiation factor activity | GO:0006413 | translational initiation | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0819300OReukaryotic translation initiation factor 3 subunit F, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0819300 OR eukaryotic translation initiation factor 3 subunit F, putative AND Plasmodium berghei ANKA |
|
PBANKA_0820100 | PBANKA_0820100.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 732 | PBANKA_0820100 | PPPDE peptidase, putative | PPPDE peptidase, putative | 3420436 | | 8 | PbANKA_08_v3:801,997..802,857(-) | PbANKA_08_v3:801997..802857(-) | PbANKA_08_v3 | Plasmodium berghei ANKA | 90 | OG6_101256 | 1 | 243 | 732 | 28373 | 9.39 | 0 | | | | | | | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0820100ORPPPDE peptidase, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0820100 OR PPPDE peptidase, putative AND Plasmodium berghei ANKA |
|
PBANKA_0824000 | PBANKA_0824000.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 696 | PBANKA_0824000 | OTU domain-containing protein, putative | OTU domain-containing protein, putative | 34829630 | | 8 | PbANKA_08_v3:938,168..938,863(-) | PbANKA_08_v3:938168..938863(-) | PbANKA_08_v3 | Plasmodium berghei ANKA | 44 | OG6_124705 | 0 | 231 | 696 | 27782 | 9.82 | 0 | | | | | | | | | GO:0005737 | cytoplasm | | | GO:0016579 | protein deubiquitination | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0824000OROTU domain-containing protein, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0824000 OR OTU domain-containing protein, putative AND Plasmodium berghei ANKA |
|
PBANKA_0832600 | PBANKA_0832600.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 828 | PBANKA_0832600 | proteasome subunit beta type-6, putative | proteasome subunit beta type-6, putative | 3426718 | A0A077XA71 | 8 | PbANKA_08_v3:1,233,915..1,234,742(-) | PbANKA_08_v3:1233915..1234742(-) | PbANKA_08_v3 | Plasmodium berghei ANKA | 44 | OG6_101390 | 0 | 275 | 828 | 31721 | 7.74 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | GO:0005622 | intracellular | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0832600ORproteasome subunit beta type-6, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0832600 OR proteasome subunit beta type-6, putative AND Plasmodium berghei ANKA |
|
PBANKA_0833100 | PBANKA_0833100.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1482 | PBANKA_0833100 | M18 aspartyl aminopeptidase, putative | M18 aspartyl aminopeptidase, putative | 3422187 | A0A077XA76 | 8 | PbANKA_08_v3:1,248,278..1,249,759(-) | PbANKA_08_v3:1248278..1249759(-) | PbANKA_08_v3 | Plasmodium berghei ANKA | 44 | OG6_102047 | 0 | 493 | 1482 | 56367 | 6.90 | 0 | | | | | GO:0004177;GO:0008270 | aminopeptidase activity;zinc ion binding | GO:0006508 | proteolysis | GO:0005829 | cytosol | | | | | 3.4.11.21 (Aspartyl aminopeptidase) | 3.4.11.21 (Aspartyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0833100ORM18 aspartyl aminopeptidase, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0833100 OR M18 aspartyl aminopeptidase, putative AND Plasmodium berghei ANKA |
|
PBANKA_0834400 | PBANKA_0834400.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1440 | PBANKA_0834400 | mitochondrial-processing peptidase subunit beta, putative | mitochondrial-processing peptidase subunit beta, putative | 3427955 | A0A077XB43 | 8 | PbANKA_08_v3:1,286,317..1,287,756(-) | PbANKA_08_v3:1286317..1287756(-) | PbANKA_08_v3 | Plasmodium berghei ANKA | 44 | OG6_100777 | 0 | 479 | 1440 | 54986 | 6.65 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | GO:0006508 | proteolysis | GO:0017087 | mitochondrial processing peptidase complex | GO:0004222 | metalloendopeptidase activity | GO:0006627 | protein processing involved in protein targeting to mitochondrion | 3.4.24.64 (Mitochondrial processing peptidase) | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0834400ORmitochondrial-processing peptidase subunit beta, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0834400 OR mitochondrial-processing peptidase subunit beta, putative AND Plasmodium berghei ANKA |
|
PBANKA_0906000 | PBANKA_0906000.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1047 | PBANKA_0906000 | alpha/beta hydrolase, putative | alpha/beta hydrolase, putative | 3424770 | A0A077XCZ3 | 9 | PbANKA_09_v3:201,895..202,941(-) | PbANKA_09_v3:201895..202941(-) | PbANKA_09_v3 | Plasmodium berghei ANKA | 44 | OG6_101420 | 0 | 348 | 1047 | 40216 | 9.31 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0906000ORalpha/beta hydrolase, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0906000 OR alpha/beta hydrolase, putative AND Plasmodium berghei ANKA |
|
PBANKA_0907300 | PBANKA_0907300.1 | 5 | 5 | 1 | | | reverse | protein coding | No | 936 | PBANKA_0907300 | OTU domain-containing protein, putative | OTU domain-containing protein, putative | 34829662 | | 9 | PbANKA_09_v3:246,278..247,648(-) | PbANKA_09_v3:246278..247648(-) | PbANKA_09_v3 | Plasmodium berghei ANKA | 43 | OG6_102788 | 0 | 311 | 936 | 37119 | 7.56 | 0 | | | | | | | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0907300OROTU domain-containing protein, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0907300 OR OTU domain-containing protein, putative AND Plasmodium berghei ANKA |
|
PBANKA_0911700 | PBANKA_0911700.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 3693 | PBANKA_0911700 | subtilisin-like protease 2 | subtilisin-like protease 2 | 3424218 | | 9 | PbANKA_09_v3:433,109..436,937(-) | PbANKA_09_v3:433109..436937(-) | PbANKA_09_v3 | Plasmodium berghei ANKA | 42 | OG6_100121 | 0 | 1230 | 3693 | 141324 | 7.77 | 1 | HMM: MLRTFYVLSLMLIEFILHNGQ, NN: MLRTFYVLSLMLIEFILHNGQ | NN Sum: 3, NN D: .6, HMM Prob: .2 | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0020009;GO:0044310 | microneme;osmiophilic body | | | GO:0044409 | entry into host | | 3.4.21.66 (Thermitase) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0911700ORsubtilisin-like protease 2ANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0911700 OR subtilisin-like protease 2 AND Plasmodium berghei ANKA |
|
PBANKA_0915000 | PBANKA_0915000.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1671 | PBANKA_0915000 | apical membrane antigen 1 | apical membrane antigen 1 | 3426620 | A0A077XDA0 | 9 | PbANKA_09_v3:573,540..575,210(-) | PbANKA_09_v3:573540..575210(-) | PbANKA_09_v3 | Plasmodium berghei ANKA | 44 | OG6_130922 | 0 | 556 | 1671 | 63749 | 6.57 | 1 | NN: MKEIYYILILCSIYLINLSNCS, HMM: MKEIYYILILCSIYLINLSNCS | NN Sum: 4, NN D: .58, HMM Prob: .72 | GO:0016020 | membrane | | | GO:0009405 | pathogenesis | GO:0020009 | microneme | GO:0046812 | host cell surface binding | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0915000ORapical membrane antigen 1ANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0915000 OR apical membrane antigen 1 AND Plasmodium berghei ANKA |
|
PBANKA_0917900 | PBANKA_0917900.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1356 | PBANKA_0917900 | 26S protease regulatory subunit 6A, putative | 26S protease regulatory subunit 6A, putative | 3420632 | A0A077XDD3 | 9 | PbANKA_09_v3:672,339..673,694(-) | PbANKA_09_v3:672339..673694(-) | PbANKA_09_v3 | Plasmodium berghei ANKA | 44 | OG6_101915 | 0 | 451 | 1356 | 50976 | 4.74 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | GO:0008540 | proteasome regulatory particle, base subcomplex | | | GO:0070682;GO:0006511 | proteasome regulatory particle assembly;ubiquitin-dependent protein catabolic process | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0917900OR26S protease regulatory subunit 6A, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0917900 OR 26S protease regulatory subunit 6A, putative AND Plasmodium berghei ANKA |
|
PBANKA_0919500 | PBANKA_0919500.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1389 | PBANKA_0919500 | GPI-anchor transamidase, putative | GPI-anchor transamidase, putative | 34829683 | | 9 | PbANKA_09_v3:724,399..725,787(-) | PbANKA_09_v3:724399..725787(-) | PbANKA_09_v3 | Plasmodium berghei ANKA | 44 | OG6_101767 | 0 | 462 | 1389 | 55383 | 8.73 | 2 | HMM: MEVKIGIVIYLLIAIKCAIGS, NN: MEVKIGIVIYLLIAIKCAIGS | NN Sum: 4, NN D: .71, HMM Prob: .74 | | | GO:0008233 | peptidase activity | GO:0006508 | proteolysis | | | GO:0003923 | GPI-anchor transamidase activity | GO:0016255 | attachment of GPI anchor to protein | | 3.-.-.- (Hydrolases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0919500ORGPI-anchor transamidase, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0919500 OR GPI-anchor transamidase, putative AND Plasmodium berghei ANKA |
|
PBANKA_0921800 | PBANKA_0921800.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1779 | PBANKA_0921800 | steryl ester hydrolase, putative | steryl ester hydrolase, putative | 3422867 | A0A077XDL1 | 9 | PbANKA_09_v3:797,080..798,858(+) | PbANKA_09_v3:797080..798858(+) | PbANKA_09_v3 | Plasmodium berghei ANKA | 3 | OG6_115656 | 0 | 592 | 1779 | 69031 | 9.15 | 0 | | | | | | | GO:0006629 | lipid metabolic process | | | | | | | 3.1.1.13 (Sterol esterase) | 3.1.1.13 (Sterol esterase) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0921800ORsteryl ester hydrolase, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0921800 OR steryl ester hydrolase, putative AND Plasmodium berghei ANKA |
|
PBANKA_0926500 | PBANKA_0926500.1 | 1 | 1 | 1 | | | forward | protein coding | No | 4935 | PBANKA_0926500 | peptidase M16, putative | peptidase M16, putative | 3420722 | A0A077XDP5 | 9 | PbANKA_09_v3:981,583..986,517(+) | PbANKA_09_v3:981583..986517(+) | PbANKA_09_v3 | Plasmodium berghei ANKA | 43 | OG6_108964 | 0 | 1644 | 4935 | 193363 | 7.63 | 0 | HMM: MYFNIFIFLIILIYENQSSCQ, NN: MYFNIFIFLIILIYENQSSCQ | NN Sum: 4, NN D: .7, HMM Prob: .75 | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.55 (Pitrilysin) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0926500ORpeptidase M16, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0926500 OR peptidase M16, putative AND Plasmodium berghei ANKA |
|
PBANKA_0928500 | PBANKA_0928500.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2916 | PBANKA_0928500 | ATP-dependent zinc metalloprotease FTSH, putative | ATP-dependent zinc metalloprotease FTSH, putative | 3426477 | | 9 | PbANKA_09_v3:1,052,114..1,055,029(+) | PbANKA_09_v3:1052114..1055029(+) | PbANKA_09_v3 | Plasmodium berghei ANKA | 91 | OG6_100384 | 1 | 971 | 2916 | 110706 | 9.56 | 2 | | | GO:0016021;GO:0016020 | integral component of membrane;membrane | GO:0005524;GO:0004222;GO:0008270 | ATP binding;metalloendopeptidase activity;zinc ion binding | GO:0006508 | proteolysis | | | | | | | 3.4.24.- (Metalloendopeptidases.) | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0928500ORATP-dependent zinc metalloprotease FTSH, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0928500 OR ATP-dependent zinc metalloprotease FTSH, putative AND Plasmodium berghei ANKA |
|
PBANKA_0929800 | PBANKA_0929800.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3753 | PBANKA_0929800 | insulinase, putative | insulinase, putative | 3423403 | A0A077XDU7 | 9 | PbANKA_09_v3:1,090,809..1,094,561(-) | PbANKA_09_v3:1090809..1094561(-) | PbANKA_09_v3 | Plasmodium berghei ANKA | 47 | OG6_105738 | 0 | 1250 | 3753 | 145687 | 5.29 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | 3.4.24.56 (Insulysin) | 3.4.24.56 (Insulysin) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0929800ORinsulinase, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0929800 OR insulinase, putative AND Plasmodium berghei ANKA |
|
PBANKA_0930900 | PBANKA_0930900.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1260 | PBANKA_0930900 | ubiquitin carboxyl-terminal hydrolase UCH54, putative | ubiquitin carboxyl-terminal hydrolase UCH54, putative | 3421636 | A0A077XC75 | 9 | PbANKA_09_v3:1,126,472..1,127,731(-) | PbANKA_09_v3:1126472..1127731(-) | PbANKA_09_v3 | Plasmodium berghei ANKA | 44 | OG6_102753 | 0 | 419 | 1260 | 49539 | 5.11 | 0 | | | GO:0005622 | intracellular | GO:0004843 | thiol-dependent ubiquitin-specific protease activity | GO:0006511 | ubiquitin-dependent protein catabolic process | | | GO:0019784 | NEDD8-specific protease activity | GO:0000338;GO:0016579 | protein deneddylation;protein deubiquitination | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0930900ORubiquitin carboxyl-terminal hydrolase UCH54, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0930900 OR ubiquitin carboxyl-terminal hydrolase UCH54, putative AND Plasmodium berghei ANKA |
|
PBANKA_0931200 | PBANKA_0931200.1 | 4 | 4 | 1 | | | forward | protein coding | No | 2724 | PBANKA_0931200 | heat shock protein 101 | heat shock protein 101 | 3424805 | | 9 | PbANKA_09_v3:1,139,058..1,142,155(+) | PbANKA_09_v3:1139058..1142155(+) | PbANKA_09_v3 | Plasmodium berghei ANKA | 95 | OG6_100223 | 1 | 907 | 2724 | 103200 | 9.46 | 1 | HMM: MVRNIAKNYLFVIVLLLSVLKVDIAV, NN: MVRNIAKNYLFVIVLLLSVLKVDIAV | NN Sum: 4, NN D: .74, HMM Prob: .74 | | | GO:0005524 | ATP binding | GO:0019538 | protein metabolic process | GO:0097619;GO:0020026;GO:0020005 | PTEX complex;merozoite dense granule;symbiont-containing vacuole membrane | | | GO:0043335;GO:0044053 | protein unfolding;translocation of peptides or proteins into host cell cytoplasm | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0931200ORheat shock protein 101ANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0931200 OR heat shock protein 101 AND Plasmodium berghei ANKA |
|
PBANKA_0931300 | PBANKA_0931300.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2046 | PBANKA_0931300 | dipeptidyl aminopeptidase 1, putative | dipeptidyl aminopeptidase 1, putative | 3426605 | | 9 | PbANKA_09_v3:1,144,938..1,146,983(+) | PbANKA_09_v3:1144938..1146983(+) | PbANKA_09_v3 | Plasmodium berghei ANKA | 90 | OG6_103622 | 1 | 681 | 2046 | 78695 | 5.89 | 1 | HMM: MKKINKFISLLLVSLHILYVSYVSAD, NN: MKKINKFISLLLVSLHILYVSYVSAD | NN Sum: 4, NN D: .88, HMM Prob: .99 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | GO:0020020;GO:0020003 | food vacuole;symbiont-containing vacuole | | | | | | 3.4.14.1 (Dipeptidyl-peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0931300ORdipeptidyl aminopeptidase 1, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0931300 OR dipeptidyl aminopeptidase 1, putative AND Plasmodium berghei ANKA |
|
PBANKA_0931800 | PBANKA_0931800.1 | 7 | 7 | 1 | | | forward | protein coding | No | 681 | PBANKA_0931800 | pyridoxine biosynthesis protein PDX2, putative | pyridoxine biosynthesis protein PDX2, putative | 3425278 | | 9 | PbANKA_09_v3:1,158,500..1,159,898(+) | PbANKA_09_v3:1158500..1159898(+) | PbANKA_09_v3 | Plasmodium berghei ANKA | 49 | OG6_103407 | 0 | 226 | 681 | 25675 | 7.75 | 0 | | | | | GO:0004359 | glutaminase activity | GO:0042823;GO:0042819 | pyridoxal phosphate biosynthetic process;vitamin B6 biosynthetic process | | | | | | | | 3.5.1.2 (Glutaminase) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0931800ORpyridoxine biosynthesis protein PDX2, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0931800 OR pyridoxine biosynthesis protein PDX2, putative AND Plasmodium berghei ANKA |
|
PBANKA_0931900 | PBANKA_0931900.1 | 1 | 1 | 1 | | | forward | protein coding | No | 4290 | PBANKA_0931900 | serine esterase, putative | serine esterase, putative | 3424790 | A0A077XC88 | 9 | PbANKA_09_v3:1,161,467..1,165,756(+) | PbANKA_09_v3:1161467..1165756(+) | PbANKA_09_v3 | Plasmodium berghei ANKA | 44 | OG6_154686 | 0 | 1429 | 4290 | 169033 | 9.11 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0931900ORserine esterase, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0931900 OR serine esterase, putative AND Plasmodium berghei ANKA |
|
PBANKA_0932000 | PBANKA_0932000.1 | 3 | 3 | 1 | | | forward | protein coding | No | 2361 | PBANKA_0932000 | rhoptry neck protein 4 | rhoptry neck protein 4 | 3423752 | | 9 | PbANKA_09_v3:1,166,868..1,169,639(+) | PbANKA_09_v3:1166868..1169639(+) | PbANKA_09_v3 | Plasmodium berghei ANKA | 40 | OG6_211592 | 0 | 786 | 2361 | 88828 | 4.91 | 0 | HMM: MSGLRLFYVCIFIVLSTFIHTAKSI, NN: MSGLRLFYVCIFIVLSTFIHTAKSI | NN Sum: 4, NN D: .87, HMM Prob: .88 | | | | | | | GO:1990225 | rhoptry neck | | | GO:0044409 | entry into host | | | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0932000ORrhoptry neck protein 4ANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0932000 OR rhoptry neck protein 4 AND Plasmodium berghei ANKA |
|
PBANKA_0932400 | PBANKA_0932400.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1407 | PBANKA_0932400 | berghepain-2 | berghepain-2 | 3429067 | A0A077XC94 | 9 | PbANKA_09_v3:1,179,508..1,180,914(+) | PbANKA_09_v3:1179508..1180914(+) | PbANKA_09_v3 | Plasmodium berghei ANKA | 159 | OG6_100116 | 1 | 468 | 1407 | 54458 | 6.36 | 1 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0932400ORberghepain-2ANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0932400 OR berghepain-2 AND Plasmodium berghei ANKA |
|
PBANKA_0933500 | PBANKA_0933500.1 | 4 | 4 | 1 | | | reverse | protein coding | No | 837 | PBANKA_0933500 | rhomboid protease ROM1 | rhomboid protease ROM1 | 3427454 | | 9 | PbANKA_09_v3:1,218,533..1,219,839(-) | PbANKA_09_v3:1218533..1219839(-) | PbANKA_09_v3 | Plasmodium berghei ANKA | 93 | OG6_100562 | 1 | 278 | 837 | 31064 | 9.54 | 6 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | GO:0009986;GO:0020009 | cell surface;microneme | | | | | | 3.4.21.- (Serine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0933500ORrhomboid protease ROM1ANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0933500 OR rhomboid protease ROM1 AND Plasmodium berghei ANKA |
|
PBANKA_0935700 | PBANKA_0935700.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 705 | PBANKA_0935700 | Josephin domain-containing protein, putative | Josephin domain-containing protein, putative | 3428449 | | 9 | PbANKA_09_v3:1,298,864..1,300,175(-) | PbANKA_09_v3:1298864..1300175(-) | PbANKA_09_v3 | Plasmodium berghei ANKA | 43 | OG6_104335 | 0 | 234 | 705 | 28171 | 9.12 | 0 | | | | | GO:0004843 | thiol-dependent ubiquitin-specific protease activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_0935700ORJosephin domain-containing protein, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_0935700 OR Josephin domain-containing protein, putative AND Plasmodium berghei ANKA |
|
PBANKA_1001100 | PBANKA_1001100.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1161 | PBANKA_1001100 | ubiquitin specific protease, putative | ubiquitin specific protease, putative | 3428672 | A0A077YD10 | 10 | PbANKA_10_v3:87,146..88,306(+) | PbANKA_10_v3:87146..88306(+) | PbANKA_10_v3 | Plasmodium berghei ANKA | 44 | OG6_208753 | 0 | 386 | 1161 | 45894 | 7.77 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1001100ORubiquitin specific protease, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1001100 OR ubiquitin specific protease, putative AND Plasmodium berghei ANKA |
|
PBANKA_1001500 | PBANKA_1001500.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2076 | PBANKA_1001500 | alpha/beta hydrolase, putative | alpha/beta hydrolase, putative | 3422180 | A0A077YG30 | 10 | PbANKA_10_v3:106,618..108,693(-) | PbANKA_10_v3:106618..108693(-) | PbANKA_10_v3 | Plasmodium berghei ANKA | 135 | OG6_100915 | 2 | 691 | 2076 | 79120 | 9.78 | 0 | | | | | | | | | | | | | | | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1001500ORalpha/beta hydrolase, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1001500 OR alpha/beta hydrolase, putative AND Plasmodium berghei ANKA |
|
PBANKA_1002400 | PBANKA_1002400.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 2472 | PBANKA_1002400 | dipeptidyl aminopeptidase 3, putative | dipeptidyl aminopeptidase 3, putative | 3426996 | | 10 | PbANKA_10_v3:158,869..161,537(-) | PbANKA_10_v3:158869..161537(-) | PbANKA_10_v3 | Plasmodium berghei ANKA | 38 | OG6_533572 | 0 | 823 | 2472 | 97127 | 8.88 | 0 | HMM: MILIPLFFYIFLNYIKCD, NN: MILIPLFFYIFLNYIKCD | NN Sum: 4, NN D: .66, HMM Prob: .38 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | GO:0045177;GO:0044164 | apical part of cell;host cell cytosol | GO:0004177 | aminopeptidase activity | | | 3.4.14.4 (Dipeptidyl-peptidase III) | 3.4.14.4 (Dipeptidyl-peptidase III) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1002400ORdipeptidyl aminopeptidase 3, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1002400 OR dipeptidyl aminopeptidase 3, putative AND Plasmodium berghei ANKA |
|
PBANKA_1006500 | PBANKA_1006500.1 | 5 | 5 | 1 | | | forward | protein coding | No | 2055 | PBANKA_1006500 | tRNA N6-adenosine threonylcarbamoyltransferase, putative | tRNA N6-adenosine threonylcarbamoyltransferase, putative | 3427758 | | 10 | PbANKA_10_v3:319,611..322,157(+) | PbANKA_10_v3:319611..322157(+) | PbANKA_10_v3 | Plasmodium berghei ANKA | 88 | OG6_100288 | 1 | 684 | 2055 | 79578 | 9.87 | 1 | NN: MKLRASTCIVFFLLFFIPCLFNSY, HMM: MKLRASTCIVFFLLFFIPCLFNSY | NN Sum: 4, NN D: .75, HMM Prob: .41 | | | | | | | GO:0020011 | apicoplast | GO:0003677 | DNA binding | | | 2.3.1.234 (N(6)-L-threonylcarbamoyladenine synthase) | 2.3.1.234 (N(6)-L-threonylcarbamoyladenine synthase) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1006500ORtRNA N6-adenosine threonylcarbamoyltransferase, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1006500 OR tRNA N6-adenosine threonylcarbamoyltransferase, putative AND Plasmodium berghei ANKA |
|
PBANKA_1010200 | PBANKA_1010200.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1716 | PBANKA_1010200 | methionine aminopeptidase 2, putative | methionine aminopeptidase 2, putative | 3428405 | A0A077YCI6 | 10 | PbANKA_10_v3:458,431..460,146(-) | PbANKA_10_v3:458431..460146(-) | PbANKA_10_v3 | Plasmodium berghei ANKA | 45 | OG6_100815 | 0 | 571 | 1716 | 65364 | 8.22 | 0 | | | | | GO:0004177;GO:0008235 | aminopeptidase activity;metalloexopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1010200ORmethionine aminopeptidase 2, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1010200 OR methionine aminopeptidase 2, putative AND Plasmodium berghei ANKA |
|
PBANKA_1011300 | PBANKA_1011300.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 300 | PBANKA_1011300 | signal peptidase complex subunit SPC1, putative | signal peptidase complex subunit SPC1, putative | 3423171 | A0A077YEM9 | 10 | PbANKA_10_v3:518,681..519,292(-) | PbANKA_10_v3:518681..519292(-) | PbANKA_10_v3 | Plasmodium berghei ANKA | 44 | OG6_103297 | 0 | 99 | 300 | 11376 | 10.46 | 2 | | | GO:0016021;GO:0005787 | integral component of membrane;signal peptidase complex | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1011300ORsignal peptidase complex subunit SPC1, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1011300 OR signal peptidase complex subunit SPC1, putative AND Plasmodium berghei ANKA |
|
PBANKA_1012300 | PBANKA_1012300.1 | 1 | 1 | 1 | | | forward | protein coding | No | 3378 | PBANKA_1012300 | conserved Plasmodium protein, unknown function | conserved Plasmodium protein, unknown function | 3423992 | A0A077YEN4 | 10 | PbANKA_10_v3:565,360..568,737(+) | PbANKA_10_v3:565360..568737(+) | PbANKA_10_v3 | Plasmodium berghei ANKA | 42 | OG6_532401 | 0 | 1125 | 3378 | 134186 | 9.62 | 0 | | | | | GO:0003677 | DNA binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1012300ORconserved Plasmodium protein, unknown functionANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1012300 OR conserved Plasmodium protein, unknown function AND Plasmodium berghei ANKA |
|
PBANKA_1014500 | PBANKA_1014500.1 | 8 | 8 | 1 | | | reverse | protein coding | No | 1824 | PBANKA_1014500 | plasmepsin IX, putative | plasmepsin IX, putative | 3428965 | A0A077YGJ2 | 10 | PbANKA_10_v3:640,434..643,143(-) | PbANKA_10_v3:640434..643143(-) | PbANKA_10_v3 | Plasmodium berghei ANKA | 91 | OG6_119797 | 1 | 607 | 1824 | 71451 | 9.61 | 1 | NN: MFFLTLKKLRKKCFFVFLTHPTITALFFIYIFNFVKSY, HMM: MFFLTLKKLRKKCFFVFLTHPTITAL | NN Sum: 4, NN D: .57, HMM Prob: .11 | | | GO:0004190 | aspartic-type endopeptidase activity | GO:0006508 | proteolysis | GO:0020008 | rhoptry | | | | | | 3.4.23.1 (Pepsin A) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1014500ORplasmepsin IX, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1014500 OR plasmepsin IX, putative AND Plasmodium berghei ANKA |
|
PBANKA_1016300 | PBANKA_1016300.1 | 2 | 2 | 1 | | | forward | protein coding | No | 1134 | PBANKA_1016300 | proliferation-associated protein 2g4, putative | proliferation-associated protein 2g4, putative | 3422094 | | 10 | PbANKA_10_v3:704,094..705,422(+) | PbANKA_10_v3:704094..705422(+) | PbANKA_10_v3 | Plasmodium berghei ANKA | 42 | OG6_101895 | 0 | 377 | 1134 | 42763 | 8.22 | 0 | | | | | | | | | | | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1016300ORproliferation-associated protein 2g4, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1016300 OR proliferation-associated protein 2g4, putative AND Plasmodium berghei ANKA |
|
PBANKA_1017500 | PBANKA_1017500.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3156 | PBANKA_1017500 | lipase, putative | lipase, putative | 3422987 | | 10 | PbANKA_10_v3:745,436..748,591(-) | PbANKA_10_v3:745436..748591(-) | PbANKA_10_v3 | Plasmodium berghei ANKA | 43 | OG6_145929 | 0 | 1051 | 3156 | 125336 | 6.27 | 1 | | | | | | | GO:0006629 | lipid metabolic process | | | | | | | 3.1.1.3 (Triacylglycerol lipase) | 3.1.1.3 (Triacylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1017500ORlipase, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1017500 OR lipase, putative AND Plasmodium berghei ANKA |
|
PBANKA_1019300 | PBANKA_1019300.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1245 | PBANKA_1019300 | enoyl-CoA hydratase, putative | enoyl-CoA hydratase, putative | 3425338 | A0A077YET8 | 10 | PbANKA_10_v3:802,186..803,430(+) | PbANKA_10_v3:802186..803430(+) | PbANKA_10_v3 | Plasmodium berghei ANKA | 44 | OG6_102410 | 0 | 414 | 1245 | 48895 | 8.86 | 0 | | | | | GO:0003824 | catalytic activity | GO:0008152 | metabolic process | | | | | | | 4.2.1.17 (Enoyl-CoA hydratase) | 4.2.1.17 (Enoyl-CoA hydratase) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1019300ORenoyl-CoA hydratase, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1019300 OR enoyl-CoA hydratase, putative AND Plasmodium berghei ANKA |
|
PBANKA_1025400 | PBANKA_1025400.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 3012 | PBANKA_1025400 | cysteine protease ATG4, putative | cysteine protease ATG4, putative | 3419218 | A0A077YDJ2 | 10 | PbANKA_10_v3:1,036,069..1,039,347(-) | PbANKA_10_v3:1036069..1039347(-) | PbANKA_10_v3 | Plasmodium berghei ANKA | 41 | OG6_100501 | 0 | 1003 | 3012 | 117567 | 9.93 | 0 | | | | | | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1025400ORcysteine protease ATG4, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1025400 OR cysteine protease ATG4, putative AND Plasmodium berghei ANKA |
|
PBANKA_1026500 | PBANKA_1026500.1 | 1 | 1 | 1 | | | forward | protein coding | No | 5661 | PBANKA_1026500 | metacaspase-3, putative | metacaspase-3, putative | 3424784 | | 10 | PbANKA_10_v3:1,088,202..1,093,862(+) | PbANKA_10_v3:1088202..1093862(+) | PbANKA_10_v3 | Plasmodium berghei ANKA | 46 | OG6_119794 | 0 | 1886 | 5661 | 220765 | 9.53 | 0 | | | | | | | | | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1026500ORmetacaspase-3, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1026500 OR metacaspase-3, putative AND Plasmodium berghei ANKA |
|
PBANKA_1027800 | PBANKA_1027800.1 | 1 | 1 | 1 | | | forward | protein coding | No | 3312 | PBANKA_1027800 | ATP-dependent protease, putative | ATP-dependent protease, putative | 3422486 | A0A077YF13 | 10 | PbANKA_10_v3:1,132,541..1,135,852(+) | PbANKA_10_v3:1132541..1135852(+) | PbANKA_10_v3 | Plasmodium berghei ANKA | 47 | OG6_100411 | 0 | 1103 | 3312 | 129494 | 9.17 | 0 | | | | | GO:0005524;GO:0004176;GO:0004252 | ATP binding;ATP-dependent peptidase activity;serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1027800ORATP-dependent protease, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1027800 OR ATP-dependent protease, putative AND Plasmodium berghei ANKA |
|
PBANKA_1028000 | PBANKA_1028000.1 | 3 | 3 | 1 | | | forward | protein coding | No | 3681 | PBANKA_1028000 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | 3425098 | A0A077YGU2 | 10 | PbANKA_10_v3:1,139,764..1,143,447(+) | PbANKA_10_v3:1139764..1143447(+) | PbANKA_10_v3 | Plasmodium berghei ANKA | 48 | OG6_101457 | 0 | 1226 | 3681 | 147123 | 10.14 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1028000ORubiquitin carboxyl-terminal hydrolase, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1028000 OR ubiquitin carboxyl-terminal hydrolase, putative AND Plasmodium berghei ANKA |
|
PBANKA_1028200 | PBANKA_1028200.1 | 5 | 5 | 1 | | | forward | protein coding | No | 6360 | PBANKA_1028200 | atypical protein kinase, ABC-1 family, putative | atypical protein kinase, ABC-1 family, putative | 3422843 | | 10 | PbANKA_10_v3:1,148,039..1,154,984(+) | PbANKA_10_v3:1148039..1154984(+) | PbANKA_10_v3 | Plasmodium berghei ANKA | 48 | OG6_112296 | 0 | 2119 | 6360 | 251218 | 9.77 | 0 | | | | | | | | | | | | | | | | 1.14.13.- (With NADH or NADPH as one donor, and incorporation of one atom of oxygen.) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1028200ORatypical protein kinase, ABC-1 family, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1028200 OR atypical protein kinase, ABC-1 family, putative AND Plasmodium berghei ANKA |
|
PBANKA_1031300 | PBANKA_1031300.1 | 4 | 4 | 1 | | | forward | protein coding | No | 1911 | PBANKA_1031300 | rhomboid protease ROM8 | rhomboid protease ROM8 | 3424174 | | 10 | PbANKA_10_v3:1,261,430..1,263,944(+) | PbANKA_10_v3:1261430..1263944(+) | PbANKA_10_v3 | Plasmodium berghei ANKA | 44 | OG6_533440 | 0 | 636 | 1911 | 74088 | 10.01 | 5 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1031300ORrhomboid protease ROM8ANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1031300 OR rhomboid protease ROM8 AND Plasmodium berghei ANKA |
|
PBANKA_1032400 | PBANKA_1032400.1 | 7 | 7 | 1 | | | reverse | protein coding | No | 936 | PBANKA_1032400 | alpha/beta hydrolase, putative | alpha/beta hydrolase, putative | 3428756 | A0A077YDR7 | 10 | PbANKA_10_v3:1,314,206..1,315,929(-) | PbANKA_10_v3:1314206..1315929(-) | PbANKA_10_v3 | Plasmodium berghei ANKA | 43 | OG6_112275 | 0 | 311 | 936 | 36280 | 9.69 | 0 | | | | | | | | | GO:0005737 | cytoplasm | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1032400ORalpha/beta hydrolase, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1032400 OR alpha/beta hydrolase, putative AND Plasmodium berghei ANKA |
|
PBANKA_1033200 | PBANKA_1033200.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1158 | PBANKA_1033200 | DNA damage-inducible protein 1, putative | DNA damage-inducible protein 1, putative | 3428875 | A0A077YD12 | 10 | PbANKA_10_v3:1,345,033..1,346,190(-) | PbANKA_10_v3:1345033..1346190(-) | PbANKA_10_v3 | Plasmodium berghei ANKA | 45 | OG6_101685 | 0 | 385 | 1158 | 44258 | 5.12 | 0 | | | | | GO:0004190 | aspartic-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1033200ORDNA damage-inducible protein 1, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1033200 OR DNA damage-inducible protein 1, putative AND Plasmodium berghei ANKA |
|
PBANKA_1034400 | PBANKA_1034400.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1353 | PBANKA_1034400 | plasmepsin IV | plasmepsin IV | 3427410 | A0A077YDU0 | 10 | PbANKA_10_v3:1,404,093..1,405,445(-) | PbANKA_10_v3:1404093..1405445(-) | PbANKA_10_v3 | Plasmodium berghei ANKA | 158 | OG6_100536 | 1 | 450 | 1353 | 50482 | 5.33 | 1 | | | | | GO:0004190 | aspartic-type endopeptidase activity | GO:0006508 | proteolysis | GO:0020020 | food vacuole | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1034400ORplasmepsin IVANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1034400 OR plasmepsin IV AND Plasmodium berghei ANKA |
|
PBANKA_1035600 | PBANKA_1035600.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3387 | PBANKA_1035600 | ATP-dependent Clp protease regulatory subunit ClpC, putative | ATP-dependent Clp protease regulatory subunit ClpC, putative | 3427537 | A0A077YE28 | 10 | PbANKA_10_v3:1,443,468..1,446,854(-) | PbANKA_10_v3:1443468..1446854(-) | PbANKA_10_v3 | Plasmodium berghei ANKA | 42 | OG6_532618 | 0 | 1128 | 3387 | 131422 | 8.97 | 0 | HMM: MKDYHILIGIFMILGFVLNIKISK, NN: MKDYHILIGIFMILGFVLNI | NN Sum: 3, NN D: .63, HMM Prob: .03 | | | GO:0005524 | ATP binding | GO:0019538 | protein metabolic process | GO:0020011 | apicoplast | | | | | | 3.4.21.92 (Endopeptidase Clp) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1035600ORATP-dependent Clp protease regulatory subunit ClpC, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1035600 OR ATP-dependent Clp protease regulatory subunit ClpC, putative AND Plasmodium berghei ANKA |
|
PBANKA_1035700 | PBANKA_1035700.1 | 2 | 2 | 1 | | | forward | protein coding | No | 4323 | PBANKA_1035700 | WD repeat-containing protein 65, putative | WD repeat-containing protein 65, putative | 3427535 | A0A077YD37 | 10 | PbANKA_10_v3:1,448,272..1,452,785(+) | PbANKA_10_v3:1448272..1452785(+) | PbANKA_10_v3 | Plasmodium berghei ANKA | 49 | OG6_102663 | 1 | 1440 | 4323 | 169871 | 7.24 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1035700ORWD repeat-containing protein 65, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1035700 OR WD repeat-containing protein 65, putative AND Plasmodium berghei ANKA |
|
PBANKA_1106500 | PBANKA_1106500.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1827 | PBANKA_1106500 | rhomboid protease ROM4 | rhomboid protease ROM4 | 3426156 | | 11 | PbANKA_11_v3:259,183..261,009(-) | PbANKA_11_v3:259183..261009(-) | PbANKA_11_v3 | Plasmodium berghei ANKA | 44 | OG6_126349 | 0 | 608 | 1827 | 69042 | 9.54 | 7 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | 3.4.21.105 (Rhomboid protease) | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1106500ORrhomboid protease ROM4ANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1106500 OR rhomboid protease ROM4 AND Plasmodium berghei ANKA |
|
PBANKA_1106800 | PBANKA_1106800.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1779 | PBANKA_1106800 | subtilisin-like protease 3, putative | subtilisin-like protease 3, putative | 3422053 | A0A077XFK8 | 11 | PbANKA_11_v3:267,464..269,242(-) | PbANKA_11_v3:267464..269242(-) | PbANKA_11_v3 | Plasmodium berghei ANKA | 42 | OG6_532299 | 0 | 592 | 1779 | 68497 | 9.50 | 0 | | | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0005737 | cytoplasm | | | | | | 3.4.21.62 (Subtilisin) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1106800ORsubtilisin-like protease 3, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1106800 OR subtilisin-like protease 3, putative AND Plasmodium berghei ANKA |
|
PBANKA_1106900 | PBANKA_1106900.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2511 | PBANKA_1106900 | PIMMS2 protein | PIMMS2 protein | 3427723 | A0A077XCT1 | 11 | PbANKA_11_v3:270,743..273,253(-) | PbANKA_11_v3:270743..273253(-) | PbANKA_11_v3 | Plasmodium berghei ANKA | 1 | OG6r1_160119 | 0 | 836 | 2511 | 99418 | 8.12 | 0 | | | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0071944;GO:0009986 | cell periphery;cell surface | | | GO:0044409 | entry into host | | | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1106900ORPIMMS2 proteinANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1106900 OR PIMMS2 protein AND Plasmodium berghei ANKA |
|
PBANKA_1107100 | PBANKA_1107100.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1800 | PBANKA_1107100 | subtilisin-like protease 1 | subtilisin-like protease 1 | 3427722 | A0A077XFI0 | 11 | PbANKA_11_v3:275,890..277,689(-) | PbANKA_11_v3:275890..277689(-) | PbANKA_11_v3 | Plasmodium berghei ANKA | 49 | OG6_121085 | 0 | 599 | 1800 | 67312 | 6.45 | 0 | HMM: MRTVFIYACIISLVLRTIPAH, NN: MRTVFIYACIISLVLRTIPAH | NN Sum: 4, NN D: .69, HMM Prob: .96 | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0044311;GO:0044310;GO:0020003 | exoneme;osmiophilic body;symbiont-containing vacuole | | | GO:0035891;GO:0006508 | exit from host cell;proteolysis | 3.4.21.62 (Subtilisin) | 3.4.21.62 (Subtilisin) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1107100ORsubtilisin-like protease 1ANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1107100 OR subtilisin-like protease 1 AND Plasmodium berghei ANKA |
|
PBANKA_1114700 | PBANKA_1114700.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 1410 | PBANKA_1114700 | rhomboid protease ROM9 | rhomboid protease ROM9 | 3426788 | | 11 | PbANKA_11_v3:561,764..563,485(-) | PbANKA_11_v3:561764..563485(-) | PbANKA_11_v3 | Plasmodium berghei ANKA | 6 | OG6_101864 | 0 | 469 | 1410 | 55448 | 10.32 | 6 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1114700ORrhomboid protease ROM9ANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1114700 OR rhomboid protease ROM9 AND Plasmodium berghei ANKA |
|
PBANKA_1117800 | PBANKA_1117800.1 | 8 | 8 | 1 | | | reverse | protein coding | No | 828 | PBANKA_1117800 | rhomboid protease ROM10 | rhomboid protease ROM10 | 3420148 | | 11 | PbANKA_11_v3:666,460..668,160(-) | PbANKA_11_v3:666460..668160(-) | PbANKA_11_v3 | Plasmodium berghei ANKA | 44 | OG6_103838 | 0 | 275 | 828 | 31723 | 9.44 | 7 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1117800ORrhomboid protease ROM10ANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1117800 OR rhomboid protease ROM10 AND Plasmodium berghei ANKA |
|
PBANKA_1126000 | PBANKA_1126000.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1398 | PBANKA_1126000 | E3 ubiquitin-protein ligase RNF5, putative | E3 ubiquitin-protein ligase RNF5, putative | 3425941 | A0A077XDB8 | 11 | PbANKA_11_v3:955,178..956,575(-) | PbANKA_11_v3:955178..956575(-) | PbANKA_11_v3 | Plasmodium berghei ANKA | 44 | OG6_102074 | 0 | 465 | 1398 | 53066 | 4.75 | 1 | | | | | | | | | | | | | | | 6.3.2.19 (Transferred entry: 2.3.2.23, 2.3.2.27 and 6.2.1.45) | 6.3.2.19 (Transferred entry: 2.3.2.23, 2.3.2.27 and 6.2.1.45) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1126000ORE3 ubiquitin-protein ligase RNF5, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1126000 OR E3 ubiquitin-protein ligase RNF5, putative AND Plasmodium berghei ANKA |
|
PBANKA_1126200 | PBANKA_1126200.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 570 | PBANKA_1126200 | protein DJ-1, putative | protein DJ-1, putative | 3425050 | | 11 | PbANKA_11_v3:959,676..960,791(-) | PbANKA_11_v3:959676..960791(-) | PbANKA_11_v3 | Plasmodium berghei ANKA | 44 | OG6_101257 | 0 | 189 | 570 | 20706 | 7.03 | 0 | | | | | | | | | GO:0005829 | cytosol | GO:0008233 | peptidase activity | GO:0036525;GO:0006457 | protein deglycation;protein folding | | 2.7.1.50 (Hydroxyethylthiazole kinase) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1126200ORprotein DJ-1, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1126200 OR protein DJ-1, putative AND Plasmodium berghei ANKA |
|
PBANKA_1127100 | PBANKA_1127100.1 | 8 | 8 | 1 | | | forward | protein coding | No | 1002 | PBANKA_1127100 | protease, putative | protease, putative | 3424415 | | 11 | PbANKA_11_v3:1,023,717..1,025,896(+) | PbANKA_11_v3:1023717..1025896(+) | PbANKA_11_v3 | Plasmodium berghei ANKA | 44 | OG6_168022 | 0 | 333 | 1002 | 39186 | 8.26 | 7 | | | | | GO:0008233 | peptidase activity | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1127100ORprotease, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1127100 OR protease, putative AND Plasmodium berghei ANKA |
|
PBANKA_1128100 | PBANKA_1128100.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2256 | PBANKA_1128100 | phospholipase | phospholipase | 3424836 | | 11 | PbANKA_11_v3:1,051,220..1,053,475(+) | PbANKA_11_v3:1051220..1053475(+) | PbANKA_11_v3 | Plasmodium berghei ANKA | 44 | OG6_101376 | 0 | 751 | 2256 | 86740 | 4.78 | 1 | HMM: MQAFLFIIILYNCICLAL, NN: MQAFLFIIILYNCICLALIYSF | NN Sum: 4, NN D: .75, HMM Prob: .96 | | | GO:0008374 | O-acyltransferase activity | GO:0006629 | lipid metabolic process | GO:0009986;GO:0020005 | cell surface;symbiont-containing vacuole membrane | GO:0004620 | phospholipase activity | GO:0035891 | exit from host cell | 2.3.1.43 (Phosphatidylcholine--sterol O-acyltransferase) | 2.3.1.43 (Phosphatidylcholine--sterol O-acyltransferase) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1128100ORphospholipaseANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1128100 OR phospholipase AND Plasmodium berghei ANKA |
|
PBANKA_1130400 | PBANKA_1130400.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 741 | PBANKA_1130400 | proteasome subunit alpha type-4, putative | proteasome subunit alpha type-4, putative | 3423580 | A0A077XG34 | 11 | PbANKA_11_v3:1,151,109..1,151,967(-) | PbANKA_11_v3:1151109..1151967(-) | PbANKA_11_v3 | Plasmodium berghei ANKA | 45 | OG6_101968 | 0 | 246 | 741 | 27670 | 7.99 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1130400ORproteasome subunit alpha type-4, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1130400 OR proteasome subunit alpha type-4, putative AND Plasmodium berghei ANKA |
|
PBANKA_1130500 | PBANKA_1130500.1 | 4 | 4 | 1 | | | forward | protein coding | No | 726 | PBANKA_1130500 | proteasome subunit alpha type-7, putative | proteasome subunit alpha type-7, putative | 3423223 | A0A077XDG4 | 11 | PbANKA_11_v3:1,153,509..1,154,588(+) | PbANKA_11_v3:1153509..1154588(+) | PbANKA_11_v3 | Plasmodium berghei ANKA | 45 | OG6_101207 | 0 | 241 | 726 | 27180 | 7.86 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1130500ORproteasome subunit alpha type-7, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1130500 OR proteasome subunit alpha type-7, putative AND Plasmodium berghei ANKA |
|
PBANKA_1131400 | PBANKA_1131400.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1788 | PBANKA_1131400 | metacaspase-1 | metacaspase-1 | 3428105 | | 11 | PbANKA_11_v3:1,176,710..1,178,497(-) | PbANKA_11_v3:1176710..1178497(-) | PbANKA_11_v3 | Plasmodium berghei ANKA | 83 | OG6_101407 | 1 | 595 | 1788 | 69603 | 8.92 | 0 | | | | | | | | | | | GO:0008233 | peptidase activity | GO:0006915;GO:0006508 | apoptotic process;proteolysis | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1131400ORmetacaspase-1ANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1131400 OR metacaspase-1 AND Plasmodium berghei ANKA |
|
PBANKA_1132600 | PBANKA_1132600.1 | 7 | 7 | 1 | | | forward | protein coding | No | 609 | PBANKA_1132600 | ubiquitin-conjugating enzyme E2, putative | ubiquitin-conjugating enzyme E2, putative | 3423325 | A0A077XI31 | 11 | PbANKA_11_v3:1,222,934..1,224,409(+) | PbANKA_11_v3:1222934..1224409(+) | PbANKA_11_v3 | Plasmodium berghei ANKA | 44 | OG6_103192 | 0 | 202 | 609 | 22788 | 5.12 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 6.3.2.19 (Transferred entry: 2.3.2.23, 2.3.2.27 and 6.2.1.45) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1132600ORubiquitin-conjugating enzyme E2, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1132600 OR ubiquitin-conjugating enzyme E2, putative AND Plasmodium berghei ANKA |
|
PBANKA_1134600 | PBANKA_1134600.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1002 | PBANKA_1134600 | rhomboid protease ROM7 | rhomboid protease ROM7 | 3420265 | A0A077XI47 | 11 | PbANKA_11_v3:1,299,621..1,300,622(-) | PbANKA_11_v3:1299621..1300622(-) | PbANKA_11_v3 | Plasmodium berghei ANKA | 44 | OG6_533468 | 0 | 333 | 1002 | 39737 | 10.10 | 6 | NN: MNLLILFIFIIYIASGNSL, HMM: MNLLILFIFIIYIASGN | NN Sum: 4, NN D: .84, HMM Prob: 1 | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | GO:0020011 | apicoplast | | | | | 3.4.21.105 (Rhomboid protease) | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1134600ORrhomboid protease ROM7ANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1134600 OR rhomboid protease ROM7 AND Plasmodium berghei ANKA |
|
PBANKA_1136100 | PBANKA_1136100.1 | 1 | 1 | 1 | | | forward | protein coding | No | 5310 | PBANKA_1136100 | conserved Plasmodium protein, unknown function | conserved Plasmodium protein, unknown function | 3427706 | | 11 | PbANKA_11_v3:1,360,268..1,365,577(+) | PbANKA_11_v3:1360268..1365577(+) | PbANKA_11_v3 | Plasmodium berghei ANKA | 46 | OG6_156430 | 0 | 1769 | 5310 | 206551 | 9.43 | 4 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1136100ORconserved Plasmodium protein, unknown functionANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1136100 OR conserved Plasmodium protein, unknown function AND Plasmodium berghei ANKA |
|
PBANKA_1137000 | PBANKA_1137000.1 | 1 | 1 | 1 | | | forward | protein coding | No | 3450 | PBANKA_1137000 | bergheilysin | bergheilysin | 3427356 | A0A077XGA4 | 11 | PbANKA_11_v3:1,396,544..1,399,993(+) | PbANKA_11_v3:1396544..1399993(+) | PbANKA_11_v3 | Plasmodium berghei ANKA | 44 | OG6_101809 | 0 | 1149 | 3450 | 133532 | 7.10 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | GO:0006508 | proteolysis | GO:0020011;GO:0020020 | apicoplast;food vacuole | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1137000ORbergheilysinANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1137000 OR bergheilysin AND Plasmodium berghei ANKA |
|
PBANKA_1138400 | PBANKA_1138400.1 | 1 | 1 | 1 | | | forward | protein coding | No | 5769 | PBANKA_1138400 | calpain, putative | calpain, putative | 3427828 | | 11 | PbANKA_11_v3:1,449,769..1,455,537(+) | PbANKA_11_v3:1449769..1455537(+) | PbANKA_11_v3 | Plasmodium berghei ANKA | 44 | OG6_103851 | 0 | 1922 | 5769 | 225867 | 9.93 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0005737;GO:0005730 | cytoplasm;nucleolus | | | | | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1138400ORcalpain, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1138400 OR calpain, putative AND Plasmodium berghei ANKA |
|
PBANKA_1144000 | PBANKA_1144000.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 936 | PBANKA_1144000 | 26S proteasome regulatory subunit RPN11, putative | 26S proteasome regulatory subunit RPN11, putative | 3425329 | | 11 | PbANKA_11_v3:1,641,745..1,642,993(-) | PbANKA_11_v3:1641745..1642993(-) | PbANKA_11_v3 | Plasmodium berghei ANKA | 43 | OG6_101835 | 0 | 311 | 936 | 35152 | 6.63 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1144000OR26S proteasome regulatory subunit RPN11, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1144000 OR 26S proteasome regulatory subunit RPN11, putative AND Plasmodium berghei ANKA |
|
PBANKA_1203900 | PBANKA_1203900.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 2100 | PBANKA_1203900 | peptidase, putative | peptidase, putative | 3419290 | A0A077XIK6 | 12 | PbANKA_12_v3:177,516..179,820(-) | PbANKA_12_v3:177516..179820(-) | PbANKA_12_v3 | Plasmodium berghei ANKA | 45 | OG6_100561 | 0 | 699 | 2100 | 83676 | 9.61 | 0 | | | | | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.24.15 (Thimet oligopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1203900ORpeptidase, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1203900 OR peptidase, putative AND Plasmodium berghei ANKA |
|
PBANKA_1205100 | PBANKA_1205100.1 | 9 | 9 | 1 | | | forward | protein coding | No | 630 | PBANKA_1205100 | PPPDE peptidase, putative | PPPDE peptidase, putative | 3422521 | | 12 | PbANKA_12_v3:208,970..210,438(+) | PbANKA_12_v3:208970..210438(+) | PbANKA_12_v3 | Plasmodium berghei ANKA | 90 | OG6_101256 | 1 | 209 | 630 | 23416 | 9.20 | 0 | | | | | | | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1205100ORPPPDE peptidase, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1205100 OR PPPDE peptidase, putative AND Plasmodium berghei ANKA |
|
PBANKA_1206600 | PBANKA_1206600.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 1344 | PBANKA_1206600 | 26S protease regulatory subunit 4, putative | 26S protease regulatory subunit 4, putative | 3421744 | | 12 | PbANKA_12_v3:270,333..272,061(-) | PbANKA_12_v3:270333..272061(-) | PbANKA_12_v3 | Plasmodium berghei ANKA | 45 | OG6_101477 | 0 | 447 | 1344 | 49708 | 8.04 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | GO:0008540 | proteasome regulatory particle, base subcomplex | | | GO:0070682;GO:0006511 | proteasome regulatory particle assembly;ubiquitin-dependent protein catabolic process | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1206600OR26S protease regulatory subunit 4, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1206600 OR 26S protease regulatory subunit 4, putative AND Plasmodium berghei ANKA |
|
PBANKA_1207800 | PBANKA_1207800.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 861 | PBANKA_1207800 | metalloprotease, putative | metalloprotease, putative | 3425497 | | 12 | PbANKA_12_v3:306,075..307,325(-) | PbANKA_12_v3:306075..307325(-) | PbANKA_12_v3 | Plasmodium berghei ANKA | 45 | OG6_108834 | 0 | 286 | 861 | 33211 | 9.69 | 0 | | | | | | | | | | | GO:0008237 | metallopeptidase activity | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1207800ORmetalloprotease, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1207800 OR metalloprotease, putative AND Plasmodium berghei ANKA |
|
PBANKA_1209800 | PBANKA_1209800.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 813 | PBANKA_1209800 | proteasome subunit beta type-5, putative | proteasome subunit beta type-5, putative | 3425350 | A0A077XEC8 | 12 | PbANKA_12_v3:368,395..369,207(-) | PbANKA_12_v3:368395..369207(-) | PbANKA_12_v3 | Plasmodium berghei ANKA | 44 | OG6_100897 | 0 | 270 | 813 | 30610 | 5.16 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1209800ORproteasome subunit beta type-5, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1209800 OR proteasome subunit beta type-5, putative AND Plasmodium berghei ANKA |
|
PBANKA_1213700 | PBANKA_1213700.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1446 | PBANKA_1213700 | methionine aminopeptidase 1b, putative | methionine aminopeptidase 1b, putative | 3426870 | A0A077XH24 | 12 | PbANKA_12_v3:528,144..529,589(+) | PbANKA_12_v3:528144..529589(+) | PbANKA_12_v3 | Plasmodium berghei ANKA | 43 | OG6_100342 | 0 | 481 | 1446 | 55177 | 8.09 | 0 | | | | | GO:0004177;GO:0008235 | aminopeptidase activity;metalloexopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1213700ORmethionine aminopeptidase 1b, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1213700 OR methionine aminopeptidase 1b, putative AND Plasmodium berghei ANKA |
|
PBANKA_1217000 | PBANKA_1217000.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2616 | PBANKA_1217000 | peptidase, putative | peptidase, putative | 3423102 | A0A077XH07 | 12 | PbANKA_12_v3:650,845..653,460(+) | PbANKA_12_v3:650845..653460(+) | PbANKA_12_v3 | Plasmodium berghei ANKA | 45 | OG6_102438 | 0 | 871 | 2616 | 102048 | 6.83 | 0 | | | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.19.1 (Acylaminoacyl-peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1217000ORpeptidase, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1217000 OR peptidase, putative AND Plasmodium berghei ANKA |
|
PBANKA_1217800 | PBANKA_1217800.1 | 8 | 8 | 1 | | | reverse | protein coding | No | 552 | PBANKA_1217800 | signal peptidase complex subunit 2, putative | signal peptidase complex subunit 2, putative | 3419151 | | 12 | PbANKA_12_v3:682,463..684,041(-) | PbANKA_12_v3:682463..684041(-) | PbANKA_12_v3 | Plasmodium berghei ANKA | 44 | OG6_137524 | 0 | 183 | 552 | 21883 | 8.40 | 2 | | | GO:0016021;GO:0005787 | integral component of membrane;signal peptidase complex | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | GO:0005783;GO:0005787 | endoplasmic reticulum;signal peptidase complex | | | GO:0045047;GO:0006465 | protein targeting to ER;signal peptide processing | | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1217800ORsignal peptidase complex subunit 2, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1217800 OR signal peptidase complex subunit 2, putative AND Plasmodium berghei ANKA |
|
PBANKA_1220200 | PBANKA_1220200.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2100 | PBANKA_1220200 | lysophospholipase, putative | lysophospholipase, putative | 3427608 | A0A077XH67 | 12 | PbANKA_12_v3:776,817..778,916(-) | PbANKA_12_v3:776817..778916(-) | PbANKA_12_v3 | Plasmodium berghei ANKA | 458 | OG6_100231 | 3 | 699 | 2100 | 78113 | 4.22 | 0 | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1220200ORlysophospholipase, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1220200 OR lysophospholipase, putative AND Plasmodium berghei ANKA |
|
PBANKA_1220300 | PBANKA_1220300.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1134 | PBANKA_1220300 | prodrug activation and resistance esterase, putative | prodrug activation and resistance esterase, putative | 3427606 | A0A077XEN3 | 12 | PbANKA_12_v3:781,266..782,399(-) | PbANKA_12_v3:781266..782399(-) | PbANKA_12_v3 | Plasmodium berghei ANKA | 458 | OG6_100231 | 3 | 377 | 1134 | 43394 | 9.31 | 0 | | | | | | | | | GO:0005737 | cytoplasm | GO:0047372;GO:0016788 | acylglycerol lipase activity;hydrolase activity, acting on ester bonds | GO:0052651;GO:0042493 | monoacylglycerol catabolic process;response to drug | 3.1.1.23 (Acylglycerol lipase) | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1220300ORprodrug activation and resistance esterase, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1220300 OR prodrug activation and resistance esterase, putative AND Plasmodium berghei ANKA |
|
PBANKA_1220500 | PBANKA_1220500.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 5838 | PBANKA_1220500 | conserved protein, unknown function | conserved protein, unknown function | 3425995 | A0A077XH39 | 12 | PbANKA_12_v3:784,713..790,778(-) | PbANKA_12_v3:784713..790778(-) | PbANKA_12_v3 | Plasmodium berghei ANKA | 43 | OG6_113142 | 0 | 1945 | 5838 | 229025 | 10.03 | 4 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1220500ORconserved protein, unknown functionANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1220500 OR conserved protein, unknown function AND Plasmodium berghei ANKA |
|
PBANKA_1222500 | PBANKA_1222500.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1665 | PBANKA_1222500 | plasmepsin X, putative | plasmepsin X, putative | 3426191 | A0A077XH53 | 12 | PbANKA_12_v3:854,662..856,326(+) | PbANKA_12_v3:854662..856326(+) | PbANKA_12_v3 | Plasmodium berghei ANKA | 91 | OG6_119797 | 1 | 554 | 1665 | 62740 | 5.94 | 0 | HMM: MKSIKILPVFYLVTFFLHNYNEIKCN, NN: MKSIKILPVFYLVTFFLHNYNEIKCN | NN Sum: 4, NN D: .49, HMM Prob: .07 | | | | | | | GO:0044311 | exoneme | GO:0004190 | aspartic-type endopeptidase activity | GO:0044409;GO:0035891;GO:0006508 | entry into host;exit from host cell;proteolysis | | 3.4.23.1 (Pepsin A) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1222500ORplasmepsin X, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1222500 OR plasmepsin X, putative AND Plasmodium berghei ANKA |
|
PBANKA_1222700 | PBANKA_1222700.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3564 | PBANKA_1222700 | conserved Plasmodium protein, unknown function | conserved Plasmodium protein, unknown function | 3419601 | A0A077XH85 | 12 | PbANKA_12_v3:862,877..866,440(-) | PbANKA_12_v3:862877..866440(-) | PbANKA_12_v3 | Plasmodium berghei ANKA | 44 | OG6_128391 | 0 | 1187 | 3564 | 142952 | 9.99 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1222700ORconserved Plasmodium protein, unknown functionANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1222700 OR conserved Plasmodium protein, unknown function AND Plasmodium berghei ANKA |
|
PBANKA_1222900 | PBANKA_1222900.1 | 2 | 2 | 1 | | | forward | protein coding | No | 1269 | PBANKA_1222900 | 26S proteasome regulatory subunit RPN10, putative | 26S proteasome regulatory subunit RPN10, putative | 3426402 | A0A077XJ43 | 12 | PbANKA_12_v3:869,718..871,071(+) | PbANKA_12_v3:869718..871071(+) | PbANKA_12_v3 | Plasmodium berghei ANKA | 44 | OG6_102002 | 0 | 422 | 1269 | 47957 | 4.46 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1222900OR26S proteasome regulatory subunit RPN10, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1222900 OR 26S proteasome regulatory subunit RPN10, putative AND Plasmodium berghei ANKA |
|
PBANKA_1223100 | PBANKA_1223100.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 783 | PBANKA_1223100 | proteasome subunit alpha type-6, putative | proteasome subunit alpha type-6, putative | 3428303 | | 12 | PbANKA_12_v3:877,285..878,498(-) | PbANKA_12_v3:877285..878498(-) | PbANKA_12_v3 | Plasmodium berghei ANKA | 44 | OG6_102240 | 0 | 260 | 783 | 29618 | 5.04 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1223100ORproteasome subunit alpha type-6, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1223100 OR proteasome subunit alpha type-6, putative AND Plasmodium berghei ANKA |
|
PBANKA_1225600 | PBANKA_1225600.1 | 7 | 7 | 1 | | | forward | protein coding | No | 732 | PBANKA_1225600 | alpha/beta hydrolase, putative | alpha/beta hydrolase, putative | 3426468 | | 12 | PbANKA_12_v3:971,687..973,149(+) | PbANKA_12_v3:971687..973149(+) | PbANKA_12_v3 | Plasmodium berghei ANKA | 135 | OG6_100915 | 2 | 243 | 732 | 28252 | 5.94 | 0 | | | | | | | | | | | | | | | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1225600ORalpha/beta hydrolase, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1225600 OR alpha/beta hydrolase, putative AND Plasmodium berghei ANKA |
|
PBANKA_1226200 | PBANKA_1226200.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2043 | PBANKA_1226200 | methionine aminopeptidase 1c, putative | methionine aminopeptidase 1c, putative | 3428937 | A0A077XHB8 | 12 | PbANKA_12_v3:1,005,323..1,007,365(-) | PbANKA_12_v3:1005323..1007365(-) | PbANKA_12_v3 | Plasmodium berghei ANKA | 44 | OG6_171502 | 0 | 680 | 2043 | 81234 | 9.35 | 0 | NN: MNVHIFLLLLFCGIFLCKKNSN, HMM: MNVHIFLLLLFCGIFLCK | NN Sum: 3, NN D: .61, HMM Prob: .95 | | | | | | | | | GO:0003729;GO:0070006 | mRNA binding;metalloaminopeptidase activity | | | | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1226200ORmethionine aminopeptidase 1c, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1226200 OR methionine aminopeptidase 1c, putative AND Plasmodium berghei ANKA |
|
PBANKA_1226500 | PBANKA_1226500.1 | 2 | 2 | 1 | | | forward | protein coding | No | 771 | PBANKA_1226500 | proteasome subunit beta type-4, putative | proteasome subunit beta type-4, putative | 3428938 | A0A077XH84 | 12 | PbANKA_12_v3:1,017,604..1,018,484(+) | PbANKA_12_v3:1017604..1018484(+) | PbANKA_12_v3 | Plasmodium berghei ANKA | 44 | OG6_101718 | 0 | 256 | 771 | 29772 | 7.11 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1226500ORproteasome subunit beta type-4, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1226500 OR proteasome subunit beta type-4, putative AND Plasmodium berghei ANKA |
|
PBANKA_1228500 | PBANKA_1228500.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 4263 | PBANKA_1228500 | sentrin-specific protease 2, putative | sentrin-specific protease 2, putative | 3426286 | | 12 | PbANKA_12_v3:1,109,810..1,114,389(-) | PbANKA_12_v3:1109810..1114389(-) | PbANKA_12_v3 | Plasmodium berghei ANKA | 34 | OG6_113308 | 0 | 1420 | 4263 | 168998 | 9.22 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.68 (Ulp1 peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1228500ORsentrin-specific protease 2, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1228500 OR sentrin-specific protease 2, putative AND Plasmodium berghei ANKA |
|
PBANKA_1231500 | PBANKA_1231500.1 | 3 | 3 | 1 | | | forward | protein coding | No | 3657 | PBANKA_1231500 | ubiquitin carboxyl-terminal hydrolase 2, putative | ubiquitin carboxyl-terminal hydrolase 2, putative | 3422470 | | 12 | PbANKA_12_v3:1,215,559..1,219,461(+) | PbANKA_12_v3:1215559..1219461(+) | PbANKA_12_v3 | Plasmodium berghei ANKA | 48 | OG6_101021 | 0 | 1218 | 3657 | 142398 | 6.89 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1231500ORubiquitin carboxyl-terminal hydrolase 2, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1231500 OR ubiquitin carboxyl-terminal hydrolase 2, putative AND Plasmodium berghei ANKA |
|
PBANKA_1232200 | PBANKA_1232200.1 | 3 | 3 | 1 | | | forward | protein coding | No | 3291 | PBANKA_1232200 | FACT complex subunit SPT16 | FACT complex subunit SPT16 | 3425618 | | 12 | PbANKA_12_v3:1,246,975..1,250,509(+) | PbANKA_12_v3:1246975..1250509(+) | PbANKA_12_v3 | Plasmodium berghei ANKA | 38 | OG6_102309 | 0 | 1096 | 3291 | 127562 | 4.81 | 0 | | | | | | | | | GO:0005634 | nucleus | | | | | | 1.1.1.27 (L-lactate dehydrogenase) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1232200ORFACT complex subunit SPT16ANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1232200 OR FACT complex subunit SPT16 AND Plasmodium berghei ANKA |
|
PBANKA_1232500 | PBANKA_1232500.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2151 | PBANKA_1232500 | eukaryotic translation initiation factor 3 subunit B, putative | eukaryotic translation initiation factor 3 subunit B, putative | 3428466 | | 12 | PbANKA_12_v3:1,258,179..1,260,329(+) | PbANKA_12_v3:1258179..1260329(+) | PbANKA_12_v3 | Plasmodium berghei ANKA | 45 | OG6_101924 | 0 | 716 | 2151 | 84182 | 8.83 | 0 | | | GO:0005852 | eukaryotic translation initiation factor 3 complex | GO:0003723;GO:0003676;GO:0003743;GO:0031369 | RNA binding;nucleic acid binding;translation initiation factor activity;translation initiation factor binding | GO:0006413 | translational initiation | | | | | | | | 3.6.3.14 (Transferred entry: 7.1.2.2) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1232500OReukaryotic translation initiation factor 3 subunit B, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1232500 OR eukaryotic translation initiation factor 3 subunit B, putative AND Plasmodium berghei ANKA |
|
PBANKA_1233100 | PBANKA_1233100.1 | 4 | 4 | 1 | | | reverse | protein coding | No | 729 | PBANKA_1233100 | proteasome subunit beta type-1, putative | proteasome subunit beta type-1, putative | 3423416 | | 12 | PbANKA_12_v3:1,273,963..1,275,168(-) | PbANKA_12_v3:1273963..1275168(-) | PbANKA_12_v3 | Plasmodium berghei ANKA | 44 | OG6_101631 | 0 | 242 | 729 | 27362 | 7.11 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1233100ORproteasome subunit beta type-1, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1233100 OR proteasome subunit beta type-1, putative AND Plasmodium berghei ANKA |
|
PBANKA_1237900 | PBANKA_1237900.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 1605 | PBANKA_1237900 | mitochondrial-processing peptidase subunit alpha, putative | mitochondrial-processing peptidase subunit alpha, putative | 3428549 | A0A077XF63 | 12 | PbANKA_12_v3:1,458,002..1,459,812(-) | PbANKA_12_v3:1458002..1459812(-) | PbANKA_12_v3 | Plasmodium berghei ANKA | 44 | OG6_102381 | 0 | 534 | 1605 | 61263 | 8.88 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | GO:0017087;GO:0005739 | mitochondrial processing peptidase complex;mitochondrion | GO:0004222 | metalloendopeptidase activity | GO:0006627 | protein processing involved in protein targeting to mitochondrion | 3.4.24.64 (Mitochondrial processing peptidase) | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1237900ORmitochondrial-processing peptidase subunit alpha, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1237900 OR mitochondrial-processing peptidase subunit alpha, putative AND Plasmodium berghei ANKA |
|
PBANKA_1242000 | PBANKA_1242000.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 1638 | PBANKA_1242000 | ubiquitin carboxyl-terminal hydrolase 14, putative | ubiquitin carboxyl-terminal hydrolase 14, putative | 3428366 | A0A077XJI2 | 12 | PbANKA_12_v3:1,592,580..1,594,656(-) | PbANKA_12_v3:1592580..1594656(-) | PbANKA_12_v3 | Plasmodium berghei ANKA | 44 | OG6_101892 | 0 | 545 | 1638 | 63541 | 7.75 | 0 | | | | | GO:0005515;GO:0036459 | protein binding;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1242000ORubiquitin carboxyl-terminal hydrolase 14, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1242000 OR ubiquitin carboxyl-terminal hydrolase 14, putative AND Plasmodium berghei ANKA |
|
PBANKA_1242100 | PBANKA_1242100.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 993 | PBANKA_1242100 | methionine aminopeptidase 1a, putative | methionine aminopeptidase 1a, putative | 3428367 | | 12 | PbANKA_12_v3:1,596,025..1,597,932(-) | PbANKA_12_v3:1596025..1597932(-) | PbANKA_12_v3 | Plasmodium berghei ANKA | 43 | OG6_124490 | 0 | 330 | 993 | 37594 | 7.67 | 0 | | | | | GO:0004177;GO:0008235 | aminopeptidase activity;metalloexopeptidase activity | GO:0006508 | proteolysis | | | GO:0003729;GO:0070006 | mRNA binding;metalloaminopeptidase activity | | | 3.4.11.18 (Methionyl aminopeptidase) | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1242100ORmethionine aminopeptidase 1a, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1242100 OR methionine aminopeptidase 1a, putative AND Plasmodium berghei ANKA |
|
PBANKA_1301400 | PBANKA_1301400.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 762 | PBANKA_1301400 | proteasome subunit alpha type-1, putative | proteasome subunit alpha type-1, putative | 3424966 | A0A077XHW3 | 13 | PbANKA_13_v3:92,041..93,163(-) | PbANKA_13_v3:92041..93163(-) | PbANKA_13_v3 | Plasmodium berghei ANKA | 44 | OG6_102143 | 0 | 253 | 762 | 28894 | 6.51 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1301400ORproteasome subunit alpha type-1, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1301400 OR proteasome subunit alpha type-1, putative AND Plasmodium berghei ANKA |
|
PBANKA_1302300 | PBANKA_1302300.1 | 7 | 7 | 1 | | | forward | protein coding | No | 5181 | PBANKA_1302300 | metacaspase-2, putative | metacaspase-2, putative | 3420507 | | 13 | PbANKA_13_v3:142,573..149,070(+) | PbANKA_13_v3:142573..149070(+) | PbANKA_13_v3 | Plasmodium berghei ANKA | 83 | OG6_101407 | 1 | 1726 | 5181 | 201110 | 10.00 | 0 | | | | | | | | | GO:0005737 | cytoplasm | GO:0008234 | cysteine-type peptidase activity | GO:0006915 | apoptotic process | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1302300ORmetacaspase-2, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1302300 OR metacaspase-2, putative AND Plasmodium berghei ANKA |
|
PBANKA_1304200 | PBANKA_1304200.1 | 6 | 6 | 1 | | | forward | protein coding | No | 4437 | PBANKA_1304200 | stromal-processing peptidase, putative | stromal-processing peptidase, putative | | | 13 | PbANKA_13_v3:227,665..235,180(+) | PbANKA_13_v3:227665..235180(+) | PbANKA_13_v3 | Plasmodium berghei ANKA | 43 | OG6_110270 | 0 | 1478 | 4437 | 174903 | 7.67 | 0 | HMM: MKKINEIILSFLFALYFVNCL, NN: MKKINEIILSFLFALYFVNCL | NN Sum: 4, NN D: .74, HMM Prob: .55 | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | GO:0020011 | apicoplast | | | | | | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1304200ORstromal-processing peptidase, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1304200 OR stromal-processing peptidase, putative AND Plasmodium berghei ANKA |
|
PBANKA_1305600 | PBANKA_1305600.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1356 | PBANKA_1305600 | mitochondrial inner membrane protease ATP23, putative | mitochondrial inner membrane protease ATP23, putative | 3425679 | A0A077XI32 | 13 | PbANKA_13_v3:286,093..287,448(+) | PbANKA_13_v3:286093..287448(+) | PbANKA_13_v3 | Plasmodium berghei ANKA | 44 | OG6_102968 | 0 | 451 | 1356 | 53128 | 9.04 | 0 | | | | | GO:0004222 | metalloendopeptidase activity | | | GO:0005758 | mitochondrial intermembrane space | | | GO:0034982;GO:0033615 | mitochondrial protein processing;mitochondrial proton-transporting ATP synthase complex assembly | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1305600ORmitochondrial inner membrane protease ATP23, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1305600 OR mitochondrial inner membrane protease ATP23, putative AND Plasmodium berghei ANKA |
|
PBANKA_1309900 | PBANKA_1309900.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1908 | PBANKA_1309900 | M17 leucyl aminopeptidase, putative | M17 leucyl aminopeptidase, putative | 3426599 | A0A077XI51 | 13 | PbANKA_13_v3:461,027..462,934(-) | PbANKA_13_v3:461027..462934(-) | PbANKA_13_v3 | Plasmodium berghei ANKA | 47 | OG6_100682 | 0 | 635 | 1908 | 72092 | 9.31 | 0 | | | GO:0005737;GO:0005622 | cytoplasm;intracellular | GO:0004177;GO:0030145;GO:0008235 | aminopeptidase activity;manganese ion binding;metalloexopeptidase activity | GO:0019538;GO:0006508 | protein metabolic process;proteolysis | | | | | | | 3.4.11.1 (Leucyl aminopeptidase) | 3.4.11.1 (Leucyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1309900ORM17 leucyl aminopeptidase, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1309900 OR M17 leucyl aminopeptidase, putative AND Plasmodium berghei ANKA |
|
PBANKA_1316000 | PBANKA_1316000.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1062 | PBANKA_1316000 | DER1-like protein, putative | DER1-like protein, putative | 3421016 | A0A077XFT8 | 13 | PbANKA_13_v3:675,081..676,142(-) | PbANKA_13_v3:675081..676142(-) | PbANKA_13_v3 | Plasmodium berghei ANKA | 44 | OG6_160757 | 0 | 353 | 1062 | 41779 | 10.26 | 5 | NN: MKMYIFYYVLLFFIYIIGI, HMM: MKMYIFYYVLLFFIYIIGI | NN Sum: 3, NN D: .67, HMM Prob: .07 | | | | | | | GO:0020011 | apicoplast | | | GO:0030433 | ubiquitin-dependent ERAD pathway | | | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1316000ORDER1-like protein, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1316000 OR DER1-like protein, putative AND Plasmodium berghei ANKA |
|
PBANKA_1318100 | PBANKA_1318100.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2331 | PBANKA_1318100 | aminopeptidase P, putative | aminopeptidase P, putative | 3428805 | | 13 | PbANKA_13_v3:758,373..760,703(+) | PbANKA_13_v3:758373..760703(+) | PbANKA_13_v3 | Plasmodium berghei ANKA | 44 | OG6_100896 | 0 | 776 | 2331 | 89893 | 7.25 | 0 | NN: MRINSLIYANLLLTAIHAN, HMM: MRINSLIYANLLLTAIHAN | NN Sum: 3, NN D: .6, HMM Prob: .84 | | | GO:0016787 | hydrolase activity | | | GO:0005829;GO:0020020 | cytosol;food vacuole | GO:0070006;GO:0042803 | metalloaminopeptidase activity;protein homodimerization activity | GO:0042540 | hemoglobin catabolic process | | 3.4.11.9 (Xaa-Pro aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1318100ORaminopeptidase P, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1318100 OR aminopeptidase P, putative AND Plasmodium berghei ANKA |
|
PBANKA_1320700 | PBANKA_1320700.1 | 9 | 9 | 1 | | | reverse | protein coding | No | 1236 | PBANKA_1320700 | signal peptide peptidase, putative | signal peptide peptidase, putative | 3427800 | | 13 | PbANKA_13_v3:853,554..856,225(-) | PbANKA_13_v3:853554..856225(-) | PbANKA_13_v3 | Plasmodium berghei ANKA | 44 | OG6_102328 | 0 | 411 | 1236 | 47332 | 9.44 | 8 | | | GO:0016021 | integral component of membrane | GO:0004190 | aspartic-type endopeptidase activity | | | GO:0005783;GO:0020009 | endoplasmic reticulum;microneme | GO:0042803 | protein homodimerization activity | GO:0006465 | signal peptide processing | 3.4.21.89 (Signal peptidase I) | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1320700ORsignal peptide peptidase, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1320700 OR signal peptide peptidase, putative AND Plasmodium berghei ANKA |
|
PBANKA_1321700 | PBANKA_1321700.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1560 | PBANKA_1321700 | berghepain-1 | berghepain-1 | 3426186 | | 13 | PbANKA_13_v3:902,142..903,701(+) | PbANKA_13_v3:902142..903701(+) | PbANKA_13_v3 | Plasmodium berghei ANKA | 159 | OG6_100116 | 1 | 519 | 1560 | 60310 | 7.72 | 1 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | GO:0005783;GO:0048471 | endoplasmic reticulum;perinuclear region of cytoplasm | | | GO:0044409 | entry into host | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1321700ORberghepain-1ANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1321700 OR berghepain-1 AND Plasmodium berghei ANKA |
|
PBANKA_1324100 | PBANKA_1324100.1 | 9 | 9 | 1 | | | forward | protein coding | No | 687 | PBANKA_1324100 | ubiquitin carboxyl-terminal hydrolase isozyme L3, putative | ubiquitin carboxyl-terminal hydrolase isozyme L3, putative | 3423568 | | 13 | PbANKA_13_v3:967,866..969,461(+) | PbANKA_13_v3:967866..969461(+) | PbANKA_13_v3 | Plasmodium berghei ANKA | 44 | OG6_101218 | 0 | 228 | 687 | 25860 | 5.25 | 0 | | | GO:0005622 | intracellular | GO:0004843 | thiol-dependent ubiquitin-specific protease activity | GO:0006511 | ubiquitin-dependent protein catabolic process | | | GO:0019784 | NEDD8-specific protease activity | GO:0000338 | protein deneddylation | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1324100ORubiquitin carboxyl-terminal hydrolase isozyme L3, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1324100 OR ubiquitin carboxyl-terminal hydrolase isozyme L3, putative AND Plasmodium berghei ANKA |
|
PBANKA_1328300 | PBANKA_1328300.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2112 | PBANKA_1328300 | ATP-dependent zinc metalloprotease FTSH, putative | ATP-dependent zinc metalloprotease FTSH, putative | 3422700 | A0A077XIM6 | 13 | PbANKA_13_v3:1,131,657..1,133,768(-) | PbANKA_13_v3:1131657..1133768(-) | PbANKA_13_v3 | Plasmodium berghei ANKA | 44 | OG6_101196 | 0 | 703 | 2112 | 79312 | 9.51 | 0 | | | GO:0016020 | membrane | GO:0005524;GO:0004222 | ATP binding;metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.24.- (Metalloendopeptidases.) | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1328300ORATP-dependent zinc metalloprotease FTSH, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1328300 OR ATP-dependent zinc metalloprotease FTSH, putative AND Plasmodium berghei ANKA |
|
PBANKA_1329100 | PBANKA_1329100.1 | 13 | 13 | 1 | | | reverse | protein coding | No | 1122 | PBANKA_1329100 | plasmepsin VIII | plasmepsin VIII | 3428295 | | 13 | PbANKA_13_v3:1,158,698..1,161,228(-) | PbANKA_13_v3:1158698..1161228(-) | PbANKA_13_v3 | Plasmodium berghei ANKA | 44 | OG6_124673 | 0 | 373 | 1122 | 42148 | 9.30 | 0 | HMM: MNKFFVFPLLLILNSIVLVKSL, NN: MNKFFVFPLLLILNSIVLVKSLTE | NN Sum: 4, NN D: .72, HMM Prob: .98 | | | GO:0004190 | aspartic-type endopeptidase activity | GO:0006508 | proteolysis | | | | | GO:0071976;GO:0035891 | cell gliding;exit from host cell | | 3.4.17.4 (Gly-Xaa carboxypeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1329100ORplasmepsin VIIIANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1329100 OR plasmepsin VIII AND Plasmodium berghei ANKA |
|
PBANKA_1331800 | PBANKA_1331800.1 | 6 | 6 | 1 | | | reverse | protein coding | No | 654 | PBANKA_1331800 | derlin-1, putative | derlin-1, putative | 3423118 | | 13 | PbANKA_13_v3:1,290,040..1,291,404(-) | PbANKA_13_v3:1290040..1291404(-) | PbANKA_13_v3 | Plasmodium berghei ANKA | 44 | OG6_101672 | 0 | 217 | 654 | 25460 | 7.32 | 5 | NN: MVQLGELLSNIPLITRVYLILSSILMVLCS, HMM: MVQLGELLSNIPLITRVYLILSSILMVLCSLD | NN Sum: 2, NN D: .54, HMM Prob: .1 | | | | | | | GO:0005783;GO:0005789 | endoplasmic reticulum;endoplasmic reticulum membrane | | | GO:0030970;GO:0030433 | retrograde protein transport, ER to cytosol;ubiquitin-dependent ERAD pathway | | | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1331800ORderlin-1, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1331800 OR derlin-1, putative AND Plasmodium berghei ANKA |
|
PBANKA_1332800 | PBANKA_1332800.1 | 3 | 3 | 1 | | | forward | protein coding | No | 8994 | PBANKA_1332800 | acetyl-CoA carboxylase | acetyl-CoA carboxylase | 3428154 | A0A077XIR7 | 13 | PbANKA_13_v3:1,326,375..1,335,790(+) | PbANKA_13_v3:1326375..1335790(+) | PbANKA_13_v3 | Plasmodium berghei ANKA | 41 | OG6_101052 | 0 | 2997 | 8994 | 347669 | 8.03 | 0 | NN: MISIFLLILLFVLIFENPTKSI, HMM: MISIFLLILLFVLIFENPTKSI | NN Sum: 4, NN D: .88, HMM Prob: 1 | | | GO:0005524;GO:0016874;GO:0046872 | ATP binding;ligase activity;metal ion binding | | | GO:0020011 | apicoplast | | | | | 6.4.1.2 (Acetyl-CoA carboxylase) | 6.4.1.2 (Acetyl-CoA carboxylase) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1332800ORacetyl-CoA carboxylaseANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1332800 OR acetyl-CoA carboxylase AND Plasmodium berghei ANKA |
|
PBANKA_1334100 | PBANKA_1334100.1 | 2 | 2 | 1 | | | forward | protein coding | No | 588 | PBANKA_1334100 | proteasome subunit beta type-2, putative | proteasome subunit beta type-2, putative | 3422799 | | 13 | PbANKA_13_v3:1,369,072..1,369,897(+) | PbANKA_13_v3:1369072..1369897(+) | PbANKA_13_v3 | Plasmodium berghei ANKA | 44 | OG6_102061 | 0 | 195 | 588 | 22863 | 8.51 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1334100ORproteasome subunit beta type-2, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1334100 OR proteasome subunit beta type-2, putative AND Plasmodium berghei ANKA |
|
PBANKA_1335100 | PBANKA_1335100.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 5700 | PBANKA_1335100 | conserved Plasmodium protein, unknown function | conserved Plasmodium protein, unknown function | 3421401 | | 13 | PbANKA_13_v3:1,399,273..1,405,343(-) | PbANKA_13_v3:1399273..1405343(-) | PbANKA_13_v3 | Plasmodium berghei ANKA | 0 | OG6_336370 | 0 | 1899 | 5700 | 227952 | 9.49 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1335100ORconserved Plasmodium protein, unknown functionANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1335100 OR conserved Plasmodium protein, unknown function AND Plasmodium berghei ANKA |
|
PBANKA_1335600 | PBANKA_1335600.1 | 3 | 3 | 1 | | | forward | protein coding | No | 3345 | PBANKA_1335600 | M1-family alanyl aminopeptidase, putative | M1-family alanyl aminopeptidase, putative | 3418362 | | 13 | PbANKA_13_v3:1,419,071..1,422,732(+) | PbANKA_13_v3:1419071..1422732(+) | PbANKA_13_v3 | Plasmodium berghei ANKA | 37 | OG6_532703 | 0 | 1114 | 3345 | 135576 | 10.28 | 0 | | | | | GO:0008237;GO:0008270 | metallopeptidase activity;zinc ion binding | | | | | | | | | | 3.4.11.2 (Membrane alanyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1335600ORM1-family alanyl aminopeptidase, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1335600 OR M1-family alanyl aminopeptidase, putative AND Plasmodium berghei ANKA |
|
PBANKA_1338700 | PBANKA_1338700.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1557 | PBANKA_1338700 | plasmepsin V, putative | plasmepsin V, putative | 3426274 | A0A077XKB6 | 13 | PbANKA_13_v3:1,517,696..1,519,252(+) | PbANKA_13_v3:1517696..1519252(+) | PbANKA_13_v3 | Plasmodium berghei ANKA | 44 | OG6_107443 | 0 | 518 | 1557 | 60099 | 7.73 | 1 | NN: MCFSKLYNFITYFIIINILVQANTE, HMM: MCFSKLYNFITYFIIINILVQANTE | NN Sum: 4, NN D: .63, HMM Prob: .12 | | | GO:0004190 | aspartic-type endopeptidase activity | GO:0006508 | proteolysis | GO:0005783 | endoplasmic reticulum | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1338700ORplasmepsin V, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1338700 OR plasmepsin V, putative AND Plasmodium berghei ANKA |
|
PBANKA_1343300 | PBANKA_1343300.1 | 1 | 1 | 1 | | | forward | protein coding | No | 813 | PBANKA_1343300 | proteasome subunit beta type-7, putative | proteasome subunit beta type-7, putative | 3428503 | A0A077XGK6 | 13 | PbANKA_13_v3:1,704,744..1,705,556(+) | PbANKA_13_v3:1704744..1705556(+) | PbANKA_13_v3 | Plasmodium berghei ANKA | 43 | OG6_101382 | 0 | 270 | 813 | 29811 | 8.10 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1343300ORproteasome subunit beta type-7, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1343300 OR proteasome subunit beta type-7, putative AND Plasmodium berghei ANKA |
|
PBANKA_1346200 | PBANKA_1346200.1 | 2 | 2 | 1 | | | forward | protein coding | No | 555 | PBANKA_1346200 | signal peptidase complex catalytic subunit SEC11, putative | signal peptidase complex catalytic subunit SEC11, putative | 3427477 | A0A077XJ45 | 13 | PbANKA_13_v3:1,811,864..1,812,666(+) | PbANKA_13_v3:1811864..1812666(+) | PbANKA_13_v3 | Plasmodium berghei ANKA | 44 | OG6_100807 | 0 | 184 | 555 | 21095 | 6.88 | 3 | | | GO:0016021;GO:0016020 | integral component of membrane;membrane | GO:0008233;GO:0008236 | peptidase activity;serine-type peptidase activity | GO:0006465 | signal peptide processing | GO:0005783;GO:0005787 | endoplasmic reticulum;signal peptidase complex | | | | | 3.4.21.89 (Signal peptidase I) | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1346200ORsignal peptidase complex catalytic subunit SEC11, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1346200 OR signal peptidase complex catalytic subunit SEC11, putative AND Plasmodium berghei ANKA |
|
PBANKA_1350800 | PBANKA_1350800.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 2883 | PBANKA_1350800 | mitochondrial intermediate peptidase, putative | mitochondrial intermediate peptidase, putative | 3424401 | A0A077XGT2 | 13 | PbANKA_13_v3:1,932,749..1,935,740(-) | PbANKA_13_v3:1932749..1935740(-) | PbANKA_13_v3 | Plasmodium berghei ANKA | 44 | OG6_102110 | 0 | 960 | 2883 | 114212 | 8.26 | 0 | | | | | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | GO:0005739 | mitochondrion | | | | | 3.4.24.59 (Mitochondrial intermediate peptidase) | 3.4.24.59 (Mitochondrial intermediate peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1350800ORmitochondrial intermediate peptidase, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1350800 OR mitochondrial intermediate peptidase, putative AND Plasmodium berghei ANKA |
|
PBANKA_1352100 | PBANKA_1352100.1 | 8 | 8 | 1 | | | reverse | protein coding | No | 1356 | PBANKA_1352100 | SprT-like domain-containing protein, putative | SprT-like domain-containing protein, putative | 3425713 | | 13 | PbANKA_13_v3:1,982,644..1,984,750(-) | PbANKA_13_v3:1982644..1984750(-) | PbANKA_13_v3 | Plasmodium berghei ANKA | 45 | OG6_104384 | 0 | 451 | 1356 | 53323 | 9.19 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1352100ORSprT-like domain-containing protein, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1352100 OR SprT-like domain-containing protein, putative AND Plasmodium berghei ANKA |
|
PBANKA_1358100 | PBANKA_1358100.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1608 | PBANKA_1358100 | rhomboid protease ROM6 | rhomboid protease ROM6 | 3429057 | A0A077XH60 | 13 | PbANKA_13_v3:2,215,383..2,216,990(-) | PbANKA_13_v3:2215383..2216990(-) | PbANKA_13_v3 | Plasmodium berghei ANKA | 44 | OG6_124366 | 0 | 535 | 1608 | 63940 | 10.06 | 4 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | 3.4.21.105 (Rhomboid protease) | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1358100ORrhomboid protease ROM6ANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1358100 OR rhomboid protease ROM6 AND Plasmodium berghei ANKA |
|
PBANKA_1362500 | PBANKA_1362500.1 | 2 | 2 | 1 | | | forward | protein coding | No | 729 | PBANKA_1362500 | peptidase, putative | peptidase, putative | 3425851 | A0A077XJJ6 | 13 | PbANKA_13_v3:2,388,327..2,389,361(+) | PbANKA_13_v3:2388327..2389361(+) | PbANKA_13_v3 | Plasmodium berghei ANKA | 44 | OG6_110253 | 0 | 242 | 729 | 27482 | 8.10 | 5 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1362500ORpeptidase, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1362500 OR peptidase, putative AND Plasmodium berghei ANKA |
|
PBANKA_1404100 | PBANKA_1404100.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 993 | PBANKA_1404100 | site-2 protease S2P | site-2 protease S2P | 3427345 | A0A077XJQ3 | 14 | PbANKA_14_v3:229,815..230,942(-) | PbANKA_14_v3:229815..230942(-) | PbANKA_14_v3 | Plasmodium berghei ANKA | 43 | OG6_107106 | 0 | 330 | 993 | 38985 | 6.67 | 7 | | | | | | | | | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1404100ORsite-2 protease S2PANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1404100 OR site-2 protease S2P AND Plasmodium berghei ANKA |
|
PBANKA_1404900 | PBANKA_1404900.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1182 | PBANKA_1404900 | 26S protease regulatory subunit 10B, putative | 26S protease regulatory subunit 10B, putative | 3423228 | A0A077XHL1 | 14 | PbANKA_14_v3:253,613..254,794(-) | PbANKA_14_v3:253613..254794(-) | PbANKA_14_v3 | Plasmodium berghei ANKA | 44 | OG6_101751 | 0 | 393 | 1182 | 44720 | 9.23 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | GO:0008540 | proteasome regulatory particle, base subcomplex | | | GO:0070682;GO:0006511 | proteasome regulatory particle assembly;ubiquitin-dependent protein catabolic process | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1404900OR26S protease regulatory subunit 10B, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1404900 OR 26S protease regulatory subunit 10B, putative AND Plasmodium berghei ANKA |
|
PBANKA_1410000 | PBANKA_1410000.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 1263 | PBANKA_1410000 | 26S protease regulatory subunit 7, putative | 26S protease regulatory subunit 7, putative | 3428982 | A0A077XKU9 | 14 | PbANKA_14_v3:426,704..428,276(-) | PbANKA_14_v3:426704..428276(-) | PbANKA_14_v3 | Plasmodium berghei ANKA | 44 | OG6_101899 | 0 | 420 | 1263 | 46816 | 6.67 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | | | | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1410000OR26S protease regulatory subunit 7, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1410000 OR 26S protease regulatory subunit 7, putative AND Plasmodium berghei ANKA |
|
PBANKA_1410300 | PBANKA_1410300.1 | 1 | 1 | 1 | | | forward | protein coding | No | 3195 | PBANKA_1410300 | M1-family alanyl aminopeptidase, putative | M1-family alanyl aminopeptidase, putative | 3428776 | A0A077XJR7 | 14 | PbANKA_14_v3:435,622..438,816(+) | PbANKA_14_v3:435622..438816(+) | PbANKA_14_v3 | Plasmodium berghei ANKA | 44 | OG6_106799 | 0 | 1064 | 3195 | 123351 | 6.74 | 0 | HMM: MVLKKLLCFNLFLIIILTF, NN: MVLKKLLCFNLFLIIILTF | NN Sum: 2, NN D: .61, HMM Prob: .8 | | | GO:0008237;GO:0008270 | metallopeptidase activity;zinc ion binding | | | GO:0020020;GO:0005634 | food vacuole;nucleus | | | | | | 3.4.11.2 (Membrane alanyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1410300ORM1-family alanyl aminopeptidase, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1410300 OR M1-family alanyl aminopeptidase, putative AND Plasmodium berghei ANKA |
|
PBANKA_1415500 | PBANKA_1415500.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1929 | PBANKA_1415500 | U4/U6.U5 tri-snRNP-associated protein 2, putative | U4/U6.U5 tri-snRNP-associated protein 2, putative | 3428068 | | 14 | PbANKA_14_v3:621,860..623,788(+) | PbANKA_14_v3:621860..623788(+) | PbANKA_14_v3 | Plasmodium berghei ANKA | 45 | OG6_102786 | 0 | 642 | 1929 | 74424 | 8.48 | 0 | | | | | GO:0036459;GO:0008270 | thiol-dependent ubiquitinyl hydrolase activity;zinc ion binding | GO:0016579 | protein deubiquitination | | | | | GO:0000398;GO:0000245 | mRNA splicing, via spliceosome;spliceosomal complex assembly | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1415500ORU4/U6.U5 tri-snRNP-associated protein 2, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1415500 OR U4/U6.U5 tri-snRNP-associated protein 2, putative AND Plasmodium berghei ANKA |
|
PBANKA_1417600 | PBANKA_1417600.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2211 | PBANKA_1417600 | ubiquitin carboxyl-terminal hydrolase MINDY, putative | ubiquitin carboxyl-terminal hydrolase MINDY, putative | 3428705 | A0A077XJV7 | 14 | PbANKA_14_v3:699,789..701,999(+) | PbANKA_14_v3:699789..701999(+) | PbANKA_14_v3 | Plasmodium berghei ANKA | 44 | OG6_102202 | 0 | 736 | 2211 | 85815 | 8.50 | 0 | | | | | GO:1990380;GO:0004843 | Lys48-specific deubiquitinase activity;thiol-dependent ubiquitin-specific protease activity | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1417600ORubiquitin carboxyl-terminal hydrolase MINDY, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1417600 OR ubiquitin carboxyl-terminal hydrolase MINDY, putative AND Plasmodium berghei ANKA |
|
PBANKA_1418700 | PBANKA_1418700.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 966 | PBANKA_1418700 | microsomal signal peptidase, putative | microsomal signal peptidase, putative | 3423709 | A0A077XHQ4 | 14 | PbANKA_14_v3:742,643..743,608(-) | PbANKA_14_v3:742643..743608(-) | PbANKA_14_v3 | Plasmodium berghei ANKA | 44 | OG6_100609 | 0 | 321 | 966 | 38104 | 10.24 | 1 | | | GO:0016021;GO:0016020 | integral component of membrane;membrane | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1418700ORmicrosomal signal peptidase, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1418700 OR microsomal signal peptidase, putative AND Plasmodium berghei ANKA |
|
PBANKA_1425300 | PBANKA_1425300.1 | 12 | 12 | 1 | | | forward | protein coding | No | 1299 | PBANKA_1425300 | trypsin-like serine protease, putative | trypsin-like serine protease, putative | 3428570 | | 14 | PbANKA_14_v3:965,491..968,634(+) | PbANKA_14_v3:965491..968634(+) | PbANKA_14_v3 | Plasmodium berghei ANKA | 39 | OG6_100391 | 0 | 432 | 1299 | 50041 | 8.96 | 1 | NN: MKKSNLSLFKSIVKHSWRASLFCYSTIFIHSSVNTLLAS, HMM: MKKSNLSLFKSIVKHSWRASLFCYSTIFIHSSVNTLLAS | NN Sum: 0, NN D: .22, HMM Prob: .65 | | | GO:0005515 | protein binding | | | | | | | | | | 3.4.21.107 (Peptidase Do) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1425300ORtrypsin-like serine protease, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1425300 OR trypsin-like serine protease, putative AND Plasmodium berghei ANKA |
|
PBANKA_1425350 | PBANKA_1425350.1 | 5 | 5 | 1 | | | forward | protein coding | No | 876 | PBANKA_1425350 | GTP-binding protein YihA3, putative | GTP-binding protein YihA3, putative | 3428569 | | 14 | PbANKA_14_v3:968,690..970,269(+) | PbANKA_14_v3:968690..970269(+) | PbANKA_14_v3 | Plasmodium berghei ANKA | 131 | OG6_101142 | 2 | 291 | 876 | 34220 | 10.10 | 1 | NN: MLNSKTSRIYCTIFILFLCINTVLTW, HMM: MLNSKTSRIYCTIFILFLCINTVLTW | NN Sum: 4, NN D: .81, HMM Prob: .56 | | | GO:0005525 | GTP binding | | | GO:0020011;GO:0005829 | apicoplast;cytosol | GO:0003924;GO:0043022 | GTPase activity;ribosome binding | | | | 3.6.5.1 (Heterotrimeric G-protein GTPase) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1425350ORGTP-binding protein YihA3, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1425350 OR GTP-binding protein YihA3, putative AND Plasmodium berghei ANKA |
|
PBANKA_1427800 | PBANKA_1427800.1 | 1 | 1 | 1 | | | forward | protein coding | No | 16569 | PBANKA_1427800 | peptidase family C50, putative | peptidase family C50, putative | 3428545 | | 14 | PbANKA_14_v3:1,069,052..1,085,620(+) | PbANKA_14_v3:1069052..1085620(+) | PbANKA_14_v3 | Plasmodium berghei ANKA | 36 | OG6_150828 | 0 | 5522 | 16569 | 657682 | 9.41 | 7 | | | | | GO:0008233 | peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.49 (Separase) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1427800ORpeptidase family C50, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1427800 OR peptidase family C50, putative AND Plasmodium berghei ANKA |
|
PBANKA_1433500 | PBANKA_1433500.1 | 3 | 3 | 1 | | | forward | protein coding | No | 1233 | PBANKA_1433500 | PPPDE peptidase domain-containing protein, putative | PPPDE peptidase domain-containing protein, putative | 3428487 | A0A077XI60 | 14 | PbANKA_14_v3:1,249,205..1,250,776(+) | PbANKA_14_v3:1249205..1250776(+) | PbANKA_14_v3 | Plasmodium berghei ANKA | 44 | OG6_102579 | 0 | 410 | 1233 | 47458 | 5.78 | 1 | | | | | | | | | | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1433500ORPPPDE peptidase domain-containing protein, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1433500 OR PPPDE peptidase domain-containing protein, putative AND Plasmodium berghei ANKA |
|
PBANKA_1441600 | PBANKA_1441600.1 | 6 | 6 | 1 | | | forward | protein coding | No | 1155 | PBANKA_1441600 | ataxin-3, putative | ataxin-3, putative | 3419264 | | 14 | PbANKA_14_v3:1,571,105..1,573,006(+) | PbANKA_14_v3:1571105..1573006(+) | PbANKA_14_v3 | Plasmodium berghei ANKA | 44 | OG6_104644 | 0 | 384 | 1155 | 45126 | 6.78 | 0 | | | | | GO:0005515;GO:0004843 | protein binding;thiol-dependent ubiquitin-specific protease activity | GO:0016579 | protein deubiquitination | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1441600ORataxin-3, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1441600 OR ataxin-3, putative AND Plasmodium berghei ANKA |
|
PBANKA_1445100 | PBANKA_1445100.1 | 5 | 5 | 1 | | | reverse | protein coding | No | 624 | PBANKA_1445100 | ATP-dependent protease subunit ClpQ, putative | ATP-dependent protease subunit ClpQ, putative | 3425641 | | 14 | PbANKA_14_v3:1,732,182..1,733,336(-) | PbANKA_14_v3:1732182..1733336(-) | PbANKA_14_v3 | Plasmodium berghei ANKA | 44 | OG6_107204 | 0 | 207 | 624 | 22889 | 8.48 | 0 | | | GO:0009376;GO:0005839 | HslUV protease complex;proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0006508;GO:0051603 | proteolysis;proteolysis involved in cellular protein catabolic process | GO:0005739 | mitochondrion | | | | | 3.4.25.2 (HslU--HslV peptidase) | 3.4.25.2 (HslU--HslV peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1445100ORATP-dependent protease subunit ClpQ, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1445100 OR ATP-dependent protease subunit ClpQ, putative AND Plasmodium berghei ANKA |
|
PBANKA_1448500 | PBANKA_1448500.1 | 3 | 3 | 1 | | | forward | protein coding | No | 2832 | PBANKA_1448500 | sentrin-specific protease 1, putative | sentrin-specific protease 1, putative | 3420283 | | 14 | PbANKA_14_v3:1,872,540..1,875,550(+) | PbANKA_14_v3:1872540..1875550(+) | PbANKA_14_v3 | Plasmodium berghei ANKA | 44 | OG6_101235 | 0 | 943 | 2832 | 111700 | 8.72 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.68 (Ulp1 peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1448500ORsentrin-specific protease 1, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1448500 OR sentrin-specific protease 1, putative AND Plasmodium berghei ANKA |
|
PBANKA_1449000 | PBANKA_1449000.1 | 6 | 6 | 1 | | | reverse | protein coding | No | 1734 | PBANKA_1449000 | microgamete surface protein MiGS, putative | microgamete surface protein MiGS, putative | 3425674 | | 14 | PbANKA_14_v3:1,897,825..1,900,136(-) | PbANKA_14_v3:1897825..1900136(-) | PbANKA_14_v3 | Plasmodium berghei ANKA | 44 | OG6_127652 | 0 | 577 | 1734 | 65381 | 4.85 | 1 | HMM: MSQRYLVIIHCVFLLLNLFKTNCY, NN: MSQRYLVIIHCVFLLLNLFKTNCY | NN Sum: 4, NN D: .83, HMM Prob: .88 | | | | | | | GO:0009986;GO:0044310 | cell surface;osmiophilic body | | | | | | 3.4.23.3 (Gastricsin) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1449000ORmicrogamete surface protein MiGS, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1449000 OR microgamete surface protein MiGS, putative AND Plasmodium berghei ANKA |
|
PBANKA_1454100 | PBANKA_1454100.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2589 | PBANKA_1454100 | ATP-dependent zinc metalloprotease FTSH 1, putative | ATP-dependent zinc metalloprotease FTSH 1, putative | 3427754 | | 14 | PbANKA_14_v3:2,080,148..2,082,736(+) | PbANKA_14_v3:2080148..2082736(+) | PbANKA_14_v3 | Plasmodium berghei ANKA | 91 | OG6_100384 | 1 | 862 | 2589 | 98480 | 8.49 | 1 | | | GO:0016020 | membrane | GO:0005524;GO:0004222 | ATP binding;metalloendopeptidase activity | GO:0006508 | proteolysis | GO:0020011;GO:0005739 | apicoplast;mitochondrion | GO:0005524;GO:0004176;GO:0004222 | ATP binding;ATP-dependent peptidase activity;metalloendopeptidase activity | GO:0006508;GO:0042493 | proteolysis;response to drug | 3.4.24.- (Metalloendopeptidases.) | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1454100ORATP-dependent zinc metalloprotease FTSH 1, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1454100 OR ATP-dependent zinc metalloprotease FTSH 1, putative AND Plasmodium berghei ANKA |
|
PBANKA_1454400 | PBANKA_1454400.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1542 | PBANKA_1454400 | 3-hydroxyisobutyryl-CoA hydrolase, putative | 3-hydroxyisobutyryl-CoA hydrolase, putative | 3426061 | A0A077XKG2 | 14 | PbANKA_14_v3:2,107,612..2,109,153(+) | PbANKA_14_v3:2107612..2109153(+) | PbANKA_14_v3 | Plasmodium berghei ANKA | 49 | OG6_102025 | 0 | 513 | 1542 | 60636 | 8.72 | 0 | | | | | GO:0003860 | 3-hydroxyisobutyryl-CoA hydrolase activity | | | | | | | | | 3.1.2.4 (3-hydroxyisobutyryl-CoA hydrolase) | 3.1.2.4 (3-hydroxyisobutyryl-CoA hydrolase) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1454400OR3-hydroxyisobutyryl-CoA hydrolase, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1454400 OR 3-hydroxyisobutyryl-CoA hydrolase, putative AND Plasmodium berghei ANKA |
|
PBANKA_1460700 | PBANKA_1460700.1 | 8 | 8 | 1 | | | forward | protein coding | No | 1668 | PBANKA_1460700 | dipeptidyl aminopeptidase 2 | dipeptidyl aminopeptidase 2 | 3420952 | | 14 | PbANKA_14_v3:2,307,116..2,309,656(+) | PbANKA_14_v3:2307116..2309656(+) | PbANKA_14_v3 | Plasmodium berghei ANKA | 90 | OG6_103622 | 1 | 555 | 1668 | 64942 | 8.68 | 1 | HMM: MKYFLFYFLIIFLIGFVKGD, NN: MKYFLFYFLIIFLIGFVKGD | NN Sum: 4, NN D: .93, HMM Prob: 1 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | GO:0044310 | osmiophilic body | | | | | | 3.4.14.1 (Dipeptidyl-peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1460700ORdipeptidyl aminopeptidase 2ANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1460700 OR dipeptidyl aminopeptidase 2 AND Plasmodium berghei ANKA |
|
PBANKA_1461800 | PBANKA_1461800.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1269 | PBANKA_1461800 | 26S protease regulatory subunit 8, putative | 26S protease regulatory subunit 8, putative | 3424398 | A0A077XL53 | 14 | PbANKA_14_v3:2,337,461..2,338,729(-) | PbANKA_14_v3:2337461..2338729(-) | PbANKA_14_v3 | Plasmodium berghei ANKA | 44 | OG6_101513 | 0 | 422 | 1269 | 48007 | 7.06 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | GO:0008540 | proteasome regulatory particle, base subcomplex | | | GO:0070682;GO:0043161 | proteasome regulatory particle assembly;proteasome-mediated ubiquitin-dependent protein catabolic process | | 3.6.4.3 (Transferred entry: 5.6.1.1) | https://pubmed.ncbi.nlm.nih.gov/?term=PBANKA_1461800OR26S protease regulatory subunit 8, putativeANDPlasmodium berghei ANKA | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PBANKA_1461800 OR 26S protease regulatory subunit 8, putative AND Plasmodium berghei ANKA |
