|
PCHAS_0101000 | PCHAS_0101000.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1452 | PCHAS_0101000 | lysophospholipase, putative | lysophospholipase, putative | 3492235 | A0A077TKU2 | 1 | PCHAS_01_v3:43,752..45,203(+) | PCHAS_01_v3:43752..45203(+) | PCHAS_01_v3 | Plasmodium chabaudi chabaudi | 434 | OG6_100231 | 27 | 483 | 1452 | 54778 | 4.34 | 1 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0101000ORlysophospholipase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0101000 OR lysophospholipase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0103300 | PCHAS_0103300.1 | 20 | 20 | 1 | | | reverse | protein coding | No | 5517 | PCHAS_0103300 | centrosomal protein CEP76, putative | centrosomal protein CEP76, putative | 3496290 | A0A077TG35 | 1 | PCHAS_01_v3:123,636..131,318(-) | PCHAS_01_v3:123636..131318(-) | PCHAS_01_v3 | Plasmodium chabaudi chabaudi | 46 | OG6_126374 | 0 | 1838 | 5517 | 218317 | 6.46 | 0 | | | | | | | | | | | | | | | | 1.3.-.- (Acting on the CH-CH group of donors.) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0103300ORcentrosomal protein CEP76, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0103300 OR centrosomal protein CEP76, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0107700 | PCHAS_0107700.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 708 | PCHAS_0107700 | proteasome subunit alpha type-2, putative | proteasome subunit alpha type-2, putative | 3496395 | A0A077TG61 | 1 | PCHAS_01_v3:290,078..290,889(-) | PCHAS_01_v3:290078..290889(-) | PCHAS_01_v3 | Plasmodium chabaudi chabaudi | 43 | OG6_101969 | 0 | 235 | 708 | 26400 | 4.86 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0107700ORproteasome subunit alpha type-2, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0107700 OR proteasome subunit alpha type-2, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0203800 | PCHAS_0203800.1 | 4 | 4 | 1 | | | forward | protein coding | No | 657 | PCHAS_0203800 | proteasome subunit beta type-3, putative | proteasome subunit beta type-3, putative | 3495325 | A0A077TGF6 | 2 | PCHAS_02_v3:171,079..172,069(+) | PCHAS_02_v3:171079..172069(+) | PCHAS_02_v3 | Plasmodium chabaudi chabaudi | 45 | OG6_101970 | 0 | 218 | 657 | 24499 | 4.59 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | GO:0019774 | proteasome core complex, beta-subunit complex | | | GO:0006511 | ubiquitin-dependent protein catabolic process | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0203800ORproteasome subunit beta type-3, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0203800 OR proteasome subunit beta type-3, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0207200 | PCHAS_0207200.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 8766 | PCHAS_0207200 | ubiquitin carboxyl-terminal hydrolase 1, putative | ubiquitin carboxyl-terminal hydrolase 1, putative | 3492881 | A0A077TII7 | 2 | PCHAS_02_v3:283,419..292,546(-) | PCHAS_02_v3:283419..292546(-) | PCHAS_02_v3 | Plasmodium chabaudi chabaudi | 38 | OG6_129339 | 0 | 2921 | 8766 | 345435 | 8.42 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | GO:0042493 | response to drug | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0207200ORubiquitin carboxyl-terminal hydrolase 1, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0207200 OR ubiquitin carboxyl-terminal hydrolase 1, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0208100 | PCHAS_0208100.1 | 1 | 1 | 1 | | | forward | protein coding | No | 4407 | PCHAS_0208100 | zinc-carboxypeptidase, putative | zinc-carboxypeptidase, putative | 3497800 | A0A077TH82 | 2 | PCHAS_02_v3:323,653..328,059(+) | PCHAS_02_v3:323653..328059(+) | PCHAS_02_v3 | Plasmodium chabaudi chabaudi | 36 | OG6_101273 | 0 | 1468 | 4407 | 169614 | 9.67 | 0 | | | | | GO:0004181;GO:0008270 | metallocarboxypeptidase activity;zinc ion binding | GO:0006508 | proteolysis | | | | | | | | 3.4.17.10 (Carboxypeptidase E) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0208100ORzinc-carboxypeptidase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0208100 OR zinc-carboxypeptidase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0209000 | PCHAS_0209000.1 | 4 | 4 | 1 | | | reverse | protein coding | No | 8169 | PCHAS_0209000 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | 3498742 | A0A077TLD2 | 2 | PCHAS_02_v3:365,266..373,831(-) | PCHAS_02_v3:365266..373831(-) | PCHAS_02_v3 | Plasmodium chabaudi chabaudi | 46 | OG6_101317 | 0 | 2722 | 8169 | 317573 | 8.24 | 0 | | | | | GO:0005515;GO:0036459 | protein binding;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0209000ORubiquitin carboxyl-terminal hydrolase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0209000 OR ubiquitin carboxyl-terminal hydrolase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0209900 | PCHAS_0209900.1 | 3 | 3 | 1 | | | forward | protein coding | No | 771 | PCHAS_0209900 | proteasome subunit alpha type-5, putative | proteasome subunit alpha type-5, putative | 3494554 | A0A077TKB5 | 2 | PCHAS_02_v3:396,196..397,255(+) | PCHAS_02_v3:396196..397255(+) | PCHAS_02_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_101621 | 0 | 256 | 771 | 28316 | 4.79 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0209900ORproteasome subunit alpha type-5, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0209900 OR proteasome subunit alpha type-5, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0211200 | PCHAS_0211200.1 | 4 | 4 | 1 | | | reverse | protein coding | No | 1686 | PCHAS_0211200 | alpha/beta hydrolase, putative | alpha/beta hydrolase, putative | 3496869 | A0A077TIL6 | 2 | PCHAS_02_v3:454,723..457,174(-) | PCHAS_02_v3:454723..457174(-) | PCHAS_02_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_110414 | 0 | 561 | 1686 | 65485 | 8.54 | 0 | | | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | | | GO:0016298 | lipase activity | GO:0006629 | lipid metabolic process | | 3.-.-.- (Hydrolases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0211200ORalpha/beta hydrolase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0211200 OR alpha/beta hydrolase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0306900 | PCHAS_0306900.1 | 6 | 6 | 1 | | | reverse | protein coding | No | 2178 | PCHAS_0306900 | serine repeat antigen 5, putative | serine repeat antigen 5, putative | 3493003 | A0A077TLN6 | 3 | PCHAS_03_v3:225,165..227,998(-) | PCHAS_03_v3:225165..227998(-) | PCHAS_03_v3 | Plasmodium chabaudi chabaudi | 376 | OG6_126098 | 4 | 725 | 2178 | 83906 | 7.12 | 0 | HMM: MKTYKIKYFLLISLFINLIKQAKSK, NN: MKTYKIKYFLLISLFINLIKQAKSK | NN Sum: 4, NN D: .76, HMM Prob: .63 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0306900ORserine repeat antigen 5, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0306900 OR serine repeat antigen 5, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0307000 | PCHAS_0307000.1 | 4 | 4 | 1 | | | reverse | protein coding | No | 2751 | PCHAS_0307000 | serine repeat antigen 4, putative | serine repeat antigen 4, putative | 3493509 | A0A077THI3 | 3 | PCHAS_03_v3:229,353..232,506(-) | PCHAS_03_v3:229353..232506(-) | PCHAS_03_v3 | Plasmodium chabaudi chabaudi | 376 | OG6_126098 | 4 | 916 | 2751 | 105141 | 5.04 | 0 | NN: MNSRLYLLLVSCAIFTINVHEIKTQ, HMM: MNSRLYLLLVSCAIFTINVHEIKTQ | NN Sum: 4, NN D: .58, HMM Prob: .9 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0307000ORserine repeat antigen 4, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0307000 OR serine repeat antigen 4, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0307100 | PCHAS_0307100.1 | 4 | 4 | 1 | | | reverse | protein coding | No | 3495 | PCHAS_0307100 | serine repeat antigen 3, putative | serine repeat antigen 3, putative | 3497611 | A0A077TIT6 | 3 | PCHAS_03_v3:233,614..237,500(-) | PCHAS_03_v3:233614..237500(-) | PCHAS_03_v3 | Plasmodium chabaudi chabaudi | 376 | OG6_126098 | 4 | 1164 | 3495 | 130123 | 4.70 | 0 | NN: MARLSSIVFIICLLLCNNVISD, HMM: MARLSSIVFIICLLLCNNVISD | NN Sum: 4, NN D: .88, HMM Prob: 1 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | GO:0005737;GO:0030430 | cytoplasm;host cell cytoplasm | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0307100ORserine repeat antigen 3, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0307100 OR serine repeat antigen 3, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0307200 | PCHAS_0307200.1 | 4 | 4 | 1 | | | reverse | protein coding | No | 3303 | PCHAS_0307200 | serine repeat antigen 2, putative | serine repeat antigen 2, putative | 3497067 | A0A077TGW5 | 3 | PCHAS_03_v3:238,841..242,580(-) | PCHAS_03_v3:238841..242580(-) | PCHAS_03_v3 | Plasmodium chabaudi chabaudi | 376 | OG6_126098 | 4 | 1100 | 3303 | 120273 | 4.70 | 0 | HMM: MKKCIPLIFLLYAMLGNDIINCR, NN: MKKCIPLIFLLYAMLGNDIINCR | NN Sum: 4, NN D: .62, HMM Prob: .95 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0307200ORserine repeat antigen 2, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0307200 OR serine repeat antigen 2, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0307300 | PCHAS_0307300.1 | 4 | 4 | 1 | | | reverse | protein coding | No | 3909 | PCHAS_0307300 | serine repeat antigen 1, putative | serine repeat antigen 1, putative | 3492484 | A0A077TKL8 | 3 | PCHAS_03_v3:244,094..248,449(-) | PCHAS_03_v3:244094..248449(-) | PCHAS_03_v3 | Plasmodium chabaudi chabaudi | 376 | OG6_126098 | 4 | 1302 | 3909 | 142834 | 4.46 | 0 | NN: MRRLSILFILYALLIRNSIETD, HMM: MRRLSILFILYALLIRNSI | NN Sum: 3, NN D: .65, HMM Prob: .99 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0307300ORserine repeat antigen 1, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0307300 OR serine repeat antigen 1, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0313700 | PCHAS_0313700.1 | 2 | 2 | 1 | | | forward | protein coding | No | 3657 | PCHAS_0313700 | conserved Plasmodium protein, unknown function | conserved Plasmodium protein, unknown function | 3493591 | A0A077TH37 | 3 | PCHAS_03_v3:471,782..475,554(+) | PCHAS_03_v3:471782..475554(+) | PCHAS_03_v3 | Plasmodium chabaudi chabaudi | 20 | OG6_532626 | 0 | 1218 | 3657 | 142481 | 8.81 | 12 | | | | | | | | | GO:0016021 | integral component of membrane | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0313700ORconserved Plasmodium protein, unknown functionANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0313700 OR conserved Plasmodium protein, unknown function AND Plasmodium chabaudi chabaudi |
|
PCHAS_0319000 | PCHAS_0319000.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1587 | PCHAS_0319000 | lysophospholipase, putative | lysophospholipase, putative | 3496659 | A0A077TKN0 | 3 | PCHAS_03_v3:661,529..663,115(+) | PCHAS_03_v3:661529..663115(+) | PCHAS_03_v3 | Plasmodium chabaudi chabaudi | 434 | OG6_100231 | 27 | 528 | 1587 | 59776 | 8.05 | 0 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0319000ORlysophospholipase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0319000 OR lysophospholipase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0406600 | PCHAS_0406600.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 990 | PCHAS_0406600 | ATP-dependent Clp protease proteolytic subunit, putative | ATP-dependent Clp protease proteolytic subunit, putative | 3499287 | A0A077TL90 | 4 | PCHAS_04_v3:242,813..243,802(-) | PCHAS_04_v3:242813..243802(-) | PCHAS_04_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_100939 | 0 | 329 | 990 | 38081 | 10.01 | 0 | NN: MIYLILFILLISIKNNTIETK, HMM: MIYLILFILLISIKNNTI | NN Sum: 4, NN D: .57, HMM Prob: .28 | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0020011 | apicoplast | | | | | 3.4.21.92 (Endopeptidase Clp) | 3.4.21.92 (Endopeptidase Clp) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0406600ORATP-dependent Clp protease proteolytic subunit, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0406600 OR ATP-dependent Clp protease proteolytic subunit, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0410600 | PCHAS_0410600.1 | 15 | 15 | 1 | | | forward | protein coding | No | 1329 | PCHAS_0410600 | plasmepsin VI, putative | plasmepsin VI, putative | 3496935 | A0A077TLC5 | 4 | PCHAS_04_v3:393,623..396,546(+) | PCHAS_04_v3:393623..396546(+) | PCHAS_04_v3 | Plasmodium chabaudi chabaudi | 158 | OG6_100536 | 1 | 442 | 1329 | 50407 | 6.99 | 1 | HMM: MPNFRIKSYLFLYLSFLLFFEIITI, NN: MPNFRIKSYLFLYLSFLLFFEIITIFHVSSI | NN Sum: 4, NN D: .76, HMM Prob: .27 | | | GO:0004190 | aspartic-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0410600ORplasmepsin VI, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0410600 OR plasmepsin VI, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0412850 | PCHAS_0412850.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3885 | PCHAS_0412850 | conserved Plasmodium protein, unknown function | conserved Plasmodium protein, unknown function | 3494727 | A0A077THH7 | 4 | PCHAS_04_v3:457,466..461,350(-) | PCHAS_04_v3:457466..461350(-) | PCHAS_04_v3 | Plasmodium chabaudi chabaudi | 42 | OG6_533302 | 0 | 1294 | 3885 | 155000 | 9.81 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0412850ORconserved Plasmodium protein, unknown functionANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0412850 OR conserved Plasmodium protein, unknown function AND Plasmodium chabaudi chabaudi |
|
PCHAS_0412900 | PCHAS_0412900.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1131 | PCHAS_0412900 | DER1-like protein, putative | DER1-like protein, putative | 3488933 | A0A077TLE4 | 4 | PCHAS_04_v3:461,587..462,717(-) | PCHAS_04_v3:461587..462717(-) | PCHAS_04_v3 | Plasmodium chabaudi chabaudi | 87 | OG6_130104 | 1 | 376 | 1131 | 45592 | 9.86 | 3 | HMM: MLIYRFLFFLSIIASVRYYYCDAK, NN: MLIYRFLFFLSIIASVRYY | NN Sum: 4, NN D: .8, HMM Prob: .85 | | | | | | | GO:0020011 | apicoplast | | | GO:0030433 | ubiquitin-dependent ERAD pathway | | | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0412900ORDER1-like protein, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0412900 OR DER1-like protein, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0417700 | PCHAS_0417700.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 4125 | PCHAS_0417700 | ubiquitin specific protease, putative | ubiquitin specific protease, putative | 3488300 | A0A077TID0 | 4 | PCHAS_04_v3:657,134..661,435(-) | PCHAS_04_v3:657134..661435(-) | PCHAS_04_v3 | Plasmodium chabaudi chabaudi | 35 | OG6_122792 | 0 | 1374 | 4125 | 158611 | 8.31 | 0 | | | | | GO:0004843;GO:0036459 | thiol-dependent ubiquitin-specific protease activity;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0417700ORubiquitin specific protease, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0417700 OR ubiquitin specific protease, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0417900 | PCHAS_0417900.1 | 1 | 1 | 1 | | | forward | protein coding | No | 558 | PCHAS_0417900 | signal peptidase complex subunit 3, putative | signal peptidase complex subunit 3, putative | 3498491 | A0A077THM1 | 4 | PCHAS_04_v3:665,530..666,087(+) | PCHAS_04_v3:665530..666087(+) | PCHAS_04_v3 | Plasmodium chabaudi chabaudi | 43 | OG6_102447 | 0 | 185 | 558 | 21733 | 5.93 | 1 | NN: MDTLLNRINIIFYSMALCLVTLCLFNYGSSF, HMM: MDTLLNRINIIFYSMALCLVTLCLFNYGSSF | NN Sum: 4, NN D: .79, HMM Prob: .18 | GO:0016021;GO:0005787 | integral component of membrane;signal peptidase complex | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | | | | | | | 3.4.21.89 (Signal peptidase I) | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0417900ORsignal peptidase complex subunit 3, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0417900 OR signal peptidase complex subunit 3, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0420600 | PCHAS_0420600.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1269 | PCHAS_0420600 | lysophospholipase, putative | lysophospholipase, putative | 27794609 | A0A077TMF0 | 4 | PCHAS_04_v3:793,428..794,696(-) | PCHAS_04_v3:793428..794696(-) | PCHAS_04_v3 | Plasmodium chabaudi chabaudi | 434 | OG6_100231 | 27 | 422 | 1269 | 48781 | 8.67 | 0 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0420600ORlysophospholipase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0420600 OR lysophospholipase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0501600 | PCHAS_0501600.1 | 2 | 2 | 1 | | | forward | protein coding | No | 1593 | PCHAS_0501600 | enoyl-CoA hydratase-related protein, putative | enoyl-CoA hydratase-related protein, putative | 3490977 | A0A077X996 | 5 | PCHAS_05_v3:68,735..70,565(+) | PCHAS_05_v3:68735..70565(+) | PCHAS_05_v3 | Plasmodium chabaudi chabaudi | 43 | OG6_134153 | 0 | 530 | 1593 | 62441 | 8.85 | 0 | | | | | GO:0003860 | 3-hydroxyisobutyryl-CoA hydrolase activity | | | | | | | | | 4.2.1.17 (Enoyl-CoA hydratase) | 3.1.2.4 (3-hydroxyisobutyryl-CoA hydrolase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0501600ORenoyl-CoA hydratase-related protein, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0501600 OR enoyl-CoA hydratase-related protein, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0502700 | PCHAS_0502700.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2235 | PCHAS_0502700 | peptidase, putative | peptidase, putative | 3491315 | A0A077X9C0 | 5 | PCHAS_05_v3:103,419..105,653(-) | PCHAS_05_v3:103419..105653(-) | PCHAS_05_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_124535 | 0 | 744 | 2235 | 85259 | 5.06 | 2 | HMM: MDIKNTICKGFNFSLILIVVVICIFGF, NN: MDIKNTICKGFNFSLILIVVVICIFGF | NN Sum: 4, NN D: .61, HMM Prob: .01 | | | | | | | | | | | | | | 3.1.3.16 (Protein-serine/threonine phosphatase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0502700ORpeptidase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0502700 OR peptidase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0504200 | PCHAS_0504200.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 375 | PCHAS_0504200 | autophagy-related protein 8, putative | autophagy-related protein 8, putative | 3498472 | A0A077X8D7 | 5 | PCHAS_05_v3:171,061..171,435(-) | PCHAS_05_v3:171061..171435(-) | PCHAS_05_v3 | Plasmodium chabaudi chabaudi | 45 | OG6_100707 | 0 | 124 | 375 | 14644 | 8.06 | 0 | | | | | | | | | GO:0020011;GO:0031410 | apicoplast;cytoplasmic vesicle | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0504200ORautophagy-related protein 8, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0504200 OR autophagy-related protein 8, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0514700 | PCHAS_0514700.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1653 | PCHAS_0514700 | tRNA N6-adenosine threonylcarbamoyltransferase, putative | tRNA N6-adenosine threonylcarbamoyltransferase, putative | 3497838 | A0A077X8Z3 | 5 | PCHAS_05_v3:553,321..554,973(-) | PCHAS_05_v3:553321..554973(-) | PCHAS_05_v3 | Plasmodium chabaudi chabaudi | 88 | OG6_100288 | 1 | 550 | 1653 | 63572 | 7.98 | 0 | | | | | | | | | | | | | | | 2.3.1.234 (N(6)-L-threonylcarbamoyladenine synthase) | 2.3.1.234 (N(6)-L-threonylcarbamoyladenine synthase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0514700ORtRNA N6-adenosine threonylcarbamoyltransferase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0514700 OR tRNA N6-adenosine threonylcarbamoyltransferase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0516400 | PCHAS_0516400.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 786 | PCHAS_0516400 | DER1-like protein, putative | DER1-like protein, putative | 3485925 | A0A077XBH2 | 5 | PCHAS_05_v3:597,668..598,737(-) | PCHAS_05_v3:597668..598737(-) | PCHAS_05_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_113960 | 0 | 261 | 786 | 30725 | 9.74 | 5 | NN: MDLSGPEVWYNNLPNVTKYMILIIFFVTLLITCNLL, HMM: MDLSGPEVWYNNLPNVTKYMILIIFFVTLLITCNLL | NN Sum: 3, NN D: .48, HMM Prob: .01 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0516400ORDER1-like protein, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0516400 OR DER1-like protein, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0517700 | PCHAS_0517700.1 | 8 | 8 | 1 | | | forward | protein coding | No | 1422 | PCHAS_0517700 | plasmepsin VII, putative | plasmepsin VII, putative | 3496127 | A0A077X919 | 5 | PCHAS_05_v3:637,563..639,939(+) | PCHAS_05_v3:637563..639939(+) | PCHAS_05_v3 | Plasmodium chabaudi chabaudi | 46 | OG6_139465 | 0 | 473 | 1422 | 54618 | 8.83 | 1 | NN: MKNVYYYFSIIFFLKLFLCNCILAI, HMM: MKNVYYYFSIIFFLKLFLCNCILAI | NN Sum: 4, NN D: .81, HMM Prob: .68 | | | GO:0004190 | aspartic-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0517700ORplasmepsin VII, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0517700 OR plasmepsin VII, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0601700 | PCHAS_0601700.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1296 | PCHAS_0601700 | lysophospholipase, putative | lysophospholipase, putative | 3499031 | A0A077THQ4 | 6 | PCHAS_06_v3:70,775..72,070(+) | PCHAS_06_v3:70775..72070(+) | PCHAS_06_v3 | Plasmodium chabaudi chabaudi | 434 | OG6_100231 | 27 | 431 | 1296 | 49655 | 8.63 | 0 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0601700ORlysophospholipase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0601700 OR lysophospholipase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0606400 | PCHAS_0606400.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3594 | PCHAS_0606400 | conserved protein, unknown function | conserved protein, unknown function | 3492605 | A0A077TML3 | 6 | PCHAS_06_v3:238,313..241,906(-) | PCHAS_06_v3:238313..241906(-) | PCHAS_06_v3 | Plasmodium chabaudi chabaudi | 43 | OG6_102131 | 0 | 1197 | 3594 | 136524 | 6.20 | 4 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0606400ORconserved protein, unknown functionANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0606400 OR conserved protein, unknown function AND Plasmodium chabaudi chabaudi |
|
PCHAS_0613700 | PCHAS_0613700.1 | 1 | 1 | 1 | | | forward | protein coding | No | 726 | PCHAS_0613700 | ATP-dependent Clp protease proteolytic subunit, putative | ATP-dependent Clp protease proteolytic subunit, putative | 3494623 | A0A077THZ8 | 6 | PCHAS_06_v3:517,665..518,390(+) | PCHAS_06_v3:517665..518390(+) | PCHAS_06_v3 | Plasmodium chabaudi chabaudi | 42 | OG6_113660 | 0 | 241 | 726 | 28046 | 9.64 | 0 | HMM: MRIFWIFIINFIYFCVCK, NN: MRIFWIFIINFIYFCVCK | NN Sum: 4, NN D: .63, HMM Prob: .15 | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0020011 | apicoplast | | | | | 3.4.21.92 (Endopeptidase Clp) | 3.4.21.92 (Endopeptidase Clp) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0613700ORATP-dependent Clp protease proteolytic subunit, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0613700 OR ATP-dependent Clp protease proteolytic subunit, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0613800 | PCHAS_0613800.1 | 2 | 2 | 1 | | | forward | protein coding | No | 2556 | PCHAS_0613800 | conserved protein, unknown function | conserved protein, unknown function | 3494624 | A0A077TLX7 | 6 | PCHAS_06_v3:518,674..521,337(+) | PCHAS_06_v3:518674..521337(+) | PCHAS_06_v3 | Plasmodium chabaudi chabaudi | 45 | OG6_146174 | 0 | 851 | 2556 | 101249 | 8.30 | 0 | | | | | | | | | | | | | | | | 3.4.21.92 (Endopeptidase Clp) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0613800ORconserved protein, unknown functionANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0613800 OR conserved protein, unknown function AND Plasmodium chabaudi chabaudi |
|
PCHAS_0618000 | PCHAS_0618000.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1404 | PCHAS_0618000 | conserved Plasmodium protein, unknown function | conserved Plasmodium protein, unknown function | 3489760 | A0A077TIW9 | 6 | PCHAS_06_v3:698,471..699,874(-) | PCHAS_06_v3:698471..699874(-) | PCHAS_06_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_533066 | 0 | 467 | 1404 | 54280 | 9.40 | 5 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0618000ORconserved Plasmodium protein, unknown functionANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0618000 OR conserved Plasmodium protein, unknown function AND Plasmodium chabaudi chabaudi |
|
PCHAS_0621500 | PCHAS_0621500.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2994 | PCHAS_0621500 | zinc finger protein, putative | zinc finger protein, putative | 3488278 | A0A077TJ04 | 6 | PCHAS_06_v3:799,578..802,571(-) | PCHAS_06_v3:799578..802571(-) | PCHAS_06_v3 | Plasmodium chabaudi chabaudi | 0 | OG6_505648 | 0 | 997 | 2994 | 118644 | 8.63 | 0 | | | | | GO:0008270 | zinc ion binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0621500ORzinc finger protein, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0621500 OR zinc finger protein, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0625000 | PCHAS_0625000.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2376 | PCHAS_0625000 | lysophospholipase, putative | lysophospholipase, putative | 3493418 | A0A077TJD4 | 6 | PCHAS_06_v3:945,410..947,785(+) | PCHAS_06_v3:945410..947785(+) | PCHAS_06_v3 | Plasmodium chabaudi chabaudi | 434 | OG6_100231 | 27 | 791 | 2376 | 86310 | 3.81 | 0 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0625000ORlysophospholipase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0625000 OR lysophospholipase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0625700 | PCHAS_0625700.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1281 | PCHAS_0625700 | lysophospholipase, putative | lysophospholipase, putative | 3492784 | A0A077THQ5 | 6 | PCHAS_06_v3:972,017..973,297(-) | PCHAS_06_v3:972017..973297(-) | PCHAS_06_v3 | Plasmodium chabaudi chabaudi | 434 | OG6_100231 | 27 | 426 | 1281 | 49249 | 6.58 | 0 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0625700ORlysophospholipase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0625700 OR lysophospholipase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0627400 | PCHAS_0627400.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1305 | PCHAS_0627400 | lysophospholipase, putative | lysophospholipase, putative | 3486147 | A0A077TN23 | 6 | PCHAS_06_v3:1,035,865..1,037,169(-) | PCHAS_06_v3:1035865..1037169(-) | PCHAS_06_v3 | Plasmodium chabaudi chabaudi | 434 | OG6_100231 | 27 | 434 | 1305 | 49367 | 7.91 | 0 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0627400ORlysophospholipase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0627400 OR lysophospholipase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0707200 | PCHAS_0707200.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1044 | PCHAS_0707200 | alpha/beta hydrolase, putative | alpha/beta hydrolase, putative | 3488870 | A0A077TKI8 | 7 | PCHAS_07_v3:268,753..269,796(-) | PCHAS_07_v3:268753..269796(-) | PCHAS_07_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_101420 | 0 | 347 | 1044 | 40282 | 9.28 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0707200ORalpha/beta hydrolase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0707200 OR alpha/beta hydrolase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0708500 | PCHAS_0708500.1 | 5 | 5 | 1 | | | reverse | protein coding | No | 933 | PCHAS_0708500 | OTU domain-containing protein, putative | OTU domain-containing protein, putative | 3492489 | A0A077TNK9 | 7 | PCHAS_07_v3:311,335..312,654(-) | PCHAS_07_v3:311335..312654(-) | PCHAS_07_v3 | Plasmodium chabaudi chabaudi | 43 | OG6_102788 | 0 | 310 | 933 | 36862 | 5.19 | 0 | | | | | | | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0708500OROTU domain-containing protein, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0708500 OR OTU domain-containing protein, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0713000 | PCHAS_0713000.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 3585 | PCHAS_0713000 | subtilisin-like protease 2, putative | subtilisin-like protease 2, putative | 3491665 | A0A077TMN3 | 7 | PCHAS_07_v3:491,213..494,933(-) | PCHAS_07_v3:491213..494933(-) | PCHAS_07_v3 | Plasmodium chabaudi chabaudi | 42 | OG6_100121 | 0 | 1194 | 3585 | 137449 | 6.65 | 1 | NN: MLRTFYVLSLILIEFILHKGQ, HMM: MLRTFYVLSLILIEFILHKGQ | NN Sum: 3, NN D: .59, HMM Prob: .13 | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0020009;GO:0044310 | microneme;osmiophilic body | | | | | | 3.4.21.66 (Thermitase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0713000ORsubtilisin-like protease 2, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0713000 OR subtilisin-like protease 2, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0716500 | PCHAS_0716500.1 | 5 | 5 | 1 | | | reverse | protein coding | No | 1509 | PCHAS_0716500 | alpha/beta hydrolase, putative | alpha/beta hydrolase, putative | 3497748 | A0A077TMR1 | 7 | PCHAS_07_v3:614,016..615,985(-) | PCHAS_07_v3:614016..615985(-) | PCHAS_07_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_105308 | 0 | 502 | 1509 | 59233 | 8.55 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0716500ORalpha/beta hydrolase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0716500 OR alpha/beta hydrolase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0721300 | PCHAS_0721300.1 | 11 | 11 | 1 | | | forward | protein coding | No | 864 | PCHAS_0721300 | BEM46-like protein, putative | BEM46-like protein, putative | 3489688 | A0A077TIX8 | 7 | PCHAS_07_v3:779,628..781,649(+) | PCHAS_07_v3:779628..781649(+) | PCHAS_07_v3 | Plasmodium chabaudi chabaudi | 45 | OG6_101827 | 0 | 287 | 864 | 32605 | 9.09 | 1 | NN: MVLKKLIISIVVAIIAVLVVINTT, HMM: MVLKKLIISIVVAIIAVLVVINTT | NN Sum: 3, NN D: .69, HMM Prob: .13 | | | | | | | | | GO:0016298 | lipase activity | GO:0006629 | lipid metabolic process | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0721300ORBEM46-like protein, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0721300 OR BEM46-like protein, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0723300 | PCHAS_0723300.1 | 1 | 1 | 1 | | | forward | protein coding | No | 3135 | PCHAS_0723300 | chaperone protein ClpB1, putative | chaperone protein ClpB1, putative | 3487340 | A0A077TIZ3 | 7 | PCHAS_07_v3:847,730..850,864(+) | PCHAS_07_v3:847730..850864(+) | PCHAS_07_v3 | Plasmodium chabaudi chabaudi | 95 | OG6_100223 | 1 | 1044 | 3135 | 118835 | 8.88 | 0 | HMM: MQTNLIALFVIISVSFLCKQGDGK, NN: MQTNLIALFVIISVSFLCKQGDGK | NN Sum: 4, NN D: .65, HMM Prob: .89 | | | GO:0005524 | ATP binding | GO:0019538 | protein metabolic process | | | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0723300ORchaperone protein ClpB1, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0723300 OR chaperone protein ClpB1, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0724700 | PCHAS_0724700.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 1188 | PCHAS_0724700 | 26S protease regulatory subunit 6B, putative | 26S protease regulatory subunit 6B, putative | 3497305 | A0A077TKZ8 | 7 | PCHAS_07_v3:886,027..887,539(-) | PCHAS_07_v3:886027..887539(-) | PCHAS_07_v3 | Plasmodium chabaudi chabaudi | 42 | OG6_101965 | 0 | 395 | 1188 | 45190 | 9.45 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | GO:0008540 | proteasome regulatory particle, base subcomplex | | | GO:0070682;GO:0006511 | proteasome regulatory particle assembly;ubiquitin-dependent protein catabolic process | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0724700OR26S protease regulatory subunit 6B, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0724700 OR 26S protease regulatory subunit 6B, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0725000 | PCHAS_0725000.1 | 4 | 4 | 1 | | | reverse | protein coding | No | 2571 | PCHAS_0725000 | ubiquitin carboxyl-terminal hydrolase 13, putative | ubiquitin carboxyl-terminal hydrolase 13, putative | 3485303 | A0A077TP18 | 7 | PCHAS_07_v3:892,159..895,077(-) | PCHAS_07_v3:892159..895077(-) | PCHAS_07_v3 | Plasmodium chabaudi chabaudi | 42 | OG6_101380 | 0 | 856 | 2571 | 98476 | 5.02 | 0 | | | | | GO:0004843;GO:0036459;GO:0008270 | thiol-dependent ubiquitin-specific protease activity;thiol-dependent ubiquitinyl hydrolase activity;zinc ion binding | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | GO:0101005 | ubiquitinyl hydrolase activity | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0725000ORubiquitin carboxyl-terminal hydrolase 13, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0725000 OR ubiquitin carboxyl-terminal hydrolase 13, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0730400 | PCHAS_0730400.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 849 | PCHAS_0730400 | conserved Plasmodium protein, unknown function | conserved Plasmodium protein, unknown function | 3494857 | A0A077TN49 | 7 | PCHAS_07_v3:1,081,870..1,082,865(-) | PCHAS_07_v3:1081870..1082865(-) | PCHAS_07_v3 | Plasmodium chabaudi chabaudi | 43 | OG6_174320 | 0 | 282 | 849 | 33072 | 9.29 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0730400ORconserved Plasmodium protein, unknown functionANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0730400 OR conserved Plasmodium protein, unknown function AND Plasmodium chabaudi chabaudi |
|
PCHAS_0731200 | PCHAS_0731200.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2643 | PCHAS_0731200 | lysophospholipase, putative | lysophospholipase, putative | 3494923 | A0A077TL60 | 7 | PCHAS_07_v3:1,122,214..1,124,856(+) | PCHAS_07_v3:1122214..1124856(+) | PCHAS_07_v3 | Plasmodium chabaudi chabaudi | 434 | OG6_100231 | 27 | 880 | 2643 | 99473 | 6.94 | 0 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0731200ORlysophospholipase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0731200 OR lysophospholipase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0731400 | PCHAS_0731400.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1383 | PCHAS_0731400 | lysophospholipase, putative | lysophospholipase, putative | 3495370 | A0A077TN60 | 7 | PCHAS_07_v3:1,133,176..1,134,558(-) | PCHAS_07_v3:1133176..1134558(-) | PCHAS_07_v3 | Plasmodium chabaudi chabaudi | 434 | OG6_100231 | 27 | 460 | 1383 | 52752 | 5.03 | 0 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0731400ORlysophospholipase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0731400 OR lysophospholipase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0800300 | PCHAS_0800300.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1299 | PCHAS_0800300 | lysophospholipase, putative | lysophospholipase, putative | 3494892 | Q7YZ78 | 8 | PCHAS_08_v3:50,831..52,129(+) | PCHAS_08_v3:50831..52129(+) | PCHAS_08_v3 | Plasmodium chabaudi chabaudi | 434 | OG6_100231 | 27 | 432 | 1299 | 49314 | 6.51 | 0 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0800300ORlysophospholipase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0800300 OR lysophospholipase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0807700 | PCHAS_0807700.1 | 1 | 1 | 1 | | | forward | protein coding | No | 684 | PCHAS_0807700 | 26S proteasome non-ATPase regulatory subunit 9, putative | 26S proteasome non-ATPase regulatory subunit 9, putative | 3495513 | A0A077TNC5 | 8 | PCHAS_08_v3:392,967..393,650(+) | PCHAS_08_v3:392967..393650(+) | PCHAS_08_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_102356 | 0 | 227 | 684 | 26381 | 6.26 | 0 | | | | | GO:0005515 | protein binding | | | GO:0005838 | proteasome regulatory particle | | | GO:0070682 | proteasome regulatory particle assembly | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0807700OR26S proteasome non-ATPase regulatory subunit 9, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0807700 OR 26S proteasome non-ATPase regulatory subunit 9, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0808500 | PCHAS_0808500.1 | 2 | 2 | 1 | | | forward | protein coding | No | 759 | PCHAS_0808500 | proteasome subunit alpha type-3, putative | proteasome subunit alpha type-3, putative | 3495220 | A0A077TLF5 | 8 | PCHAS_08_v3:441,892..442,751(+) | PCHAS_08_v3:441892..442751(+) | PCHAS_08_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_102011 | 0 | 252 | 759 | 28822 | 5.89 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0808500ORproteasome subunit alpha type-3, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0808500 OR proteasome subunit alpha type-3, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0809200 | PCHAS_0809200.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2286 | PCHAS_0809200 | ATP-dependent protease ATPase subunit ClpY, putative | ATP-dependent protease ATPase subunit ClpY, putative | 3498480 | A0A077TPI5 | 8 | PCHAS_08_v3:460,135..462,420(-) | PCHAS_08_v3:460135..462420(-) | PCHAS_08_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_106348 | 0 | 761 | 2286 | 86902 | 8.76 | 0 | | | GO:0009376;GO:0005737 | HslUV protease complex;cytoplasm | GO:0005524;GO:0016887;GO:0070011 | ATP binding;ATPase activity;peptidase activity, acting on L-amino acid peptides | | | GO:0009376 | HslUV protease complex | | | | | | 2.7.1.71 (Shikimate kinase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0809200ORATP-dependent protease ATPase subunit ClpY, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0809200 OR ATP-dependent protease ATPase subunit ClpY, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0814200 | PCHAS_0814200.1 | 2 | 2 | 1 | | | forward | protein coding | No | 954 | PCHAS_0814200 | 26S proteasome regulatory subunit RPN8, putative | 26S proteasome regulatory subunit RPN8, putative | 3499364 | A0A077TPP1 | 8 | PCHAS_08_v3:633,672..634,749(+) | PCHAS_08_v3:633672..634749(+) | PCHAS_08_v3 | Plasmodium chabaudi chabaudi | 47 | OG6_102054 | 0 | 317 | 954 | 36484 | 7.10 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 3.1.3.16 (Protein-serine/threonine phosphatase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0814200OR26S proteasome regulatory subunit RPN8, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0814200 OR 26S proteasome regulatory subunit RPN8, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0814800 | PCHAS_0814800.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 1308 | PCHAS_0814800 | protease, putative | protease, putative | 3498351 | A0A077TKA3 | 8 | PCHAS_08_v3:646,720..648,278(-) | PCHAS_08_v3:646720..648278(-) | PCHAS_08_v3 | Plasmodium chabaudi chabaudi | 43 | OG6_112025 | 0 | 435 | 1308 | 51692 | 9.90 | 8 | NN: MMFRVLTFLWFNIIWFMRIEGF, HMM: MMFRVLTFLWFNIIWFMRIEGF | NN Sum: 4, NN D: .85, HMM Prob: .89 | GO:0016020 | membrane | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0814800ORprotease, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0814800 OR protease, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0819600 | PCHAS_0819600.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 948 | PCHAS_0819600 | eukaryotic translation initiation factor 3 subunit F, putative | eukaryotic translation initiation factor 3 subunit F, putative | 3495689 | A0A077TNR5 | 8 | PCHAS_08_v3:795,690..796,749(-) | PCHAS_08_v3:795690..796749(-) | PCHAS_08_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_103242 | 0 | 315 | 948 | 36143 | 6.96 | 0 | | | | | GO:0005515 | protein binding | | | GO:0005852 | eukaryotic translation initiation factor 3 complex | GO:0003743 | translation initiation factor activity | GO:0006413 | translational initiation | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0819600OReukaryotic translation initiation factor 3 subunit F, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0819600 OR eukaryotic translation initiation factor 3 subunit F, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0820400 | PCHAS_0820400.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 744 | PCHAS_0820400 | PPPDE peptidase, putative | PPPDE peptidase, putative | 3494986 | A0A077TLY5 | 8 | PCHAS_08_v3:828,829..829,689(-) | PCHAS_08_v3:828829..829689(-) | PCHAS_08_v3 | Plasmodium chabaudi chabaudi | 90 | OG6_101256 | 1 | 247 | 744 | 28728 | 8.99 | 0 | | | | | | | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0820400ORPPPDE peptidase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0820400 OR PPPDE peptidase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0824300 | PCHAS_0824300.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 699 | PCHAS_0824300 | OTU domain-containing protein, putative | OTU domain-containing protein, putative | 27794740 | A0A077TKM2 | 8 | PCHAS_08_v3:961,473..962,171(-) | PCHAS_08_v3:961473..962171(-) | PCHAS_08_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_124705 | 0 | 232 | 699 | 27685 | 9.38 | 0 | | | | | | | | | GO:0005737 | cytoplasm | | | GO:0016579 | protein deubiquitination | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0824300OROTU domain-containing protein, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0824300 OR OTU domain-containing protein, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0832900 | PCHAS_0832900.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 828 | PCHAS_0832900 | proteasome subunit beta type-6, putative | proteasome subunit beta type-6, putative | 3494030 | A0A077TK79 | 8 | PCHAS_08_v3:1,249,470..1,250,297(-) | PCHAS_08_v3:1249470..1250297(-) | PCHAS_08_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_101390 | 0 | 275 | 828 | 31673 | 6.77 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | GO:0005622 | intracellular | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0832900ORproteasome subunit beta type-6, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0832900 OR proteasome subunit beta type-6, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0833400 | PCHAS_0833400.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1497 | PCHAS_0833400 | M18 aspartyl aminopeptidase, putative | M18 aspartyl aminopeptidase, putative | 3497202 | A0A077TK84 | 8 | PCHAS_08_v3:1,263,550..1,265,046(-) | PCHAS_08_v3:1263550..1265046(-) | PCHAS_08_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_102047 | 0 | 498 | 1497 | 57048 | 6.90 | 0 | | | | | GO:0004177;GO:0008270 | aminopeptidase activity;zinc ion binding | GO:0006508 | proteolysis | | | | | | | 3.4.11.21 (Aspartyl aminopeptidase) | 3.4.11.21 (Aspartyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0833400ORM18 aspartyl aminopeptidase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0833400 OR M18 aspartyl aminopeptidase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0834700 | PCHAS_0834700.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1449 | PCHAS_0834700 | mitochondrial-processing peptidase subunit beta, putative | mitochondrial-processing peptidase subunit beta, putative | 3498249 | A0A077TKV8 | 8 | PCHAS_08_v3:1,300,556..1,302,004(-) | PCHAS_08_v3:1300556..1302004(-) | PCHAS_08_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_100777 | 0 | 482 | 1449 | 55139 | 6.25 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | GO:0006508 | proteolysis | GO:0017087 | mitochondrial processing peptidase complex | GO:0004222 | metalloendopeptidase activity | GO:0006627 | protein processing involved in protein targeting to mitochondrion | 3.4.24.64 (Mitochondrial processing peptidase) | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0834700ORmitochondrial-processing peptidase subunit beta, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0834700 OR mitochondrial-processing peptidase subunit beta, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0837400 | PCHAS_0837400.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1314 | PCHAS_0837400 | lysophospholipase, putative | lysophospholipase, putative | 3495935 | A0A077TKB4 | 8 | PCHAS_08_v3:1,381,162..1,382,475(-) | PCHAS_08_v3:1381162..1382475(-) | PCHAS_08_v3 | Plasmodium chabaudi chabaudi | 434 | OG6_100231 | 27 | 437 | 1314 | 50278 | 6.58 | 0 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0837400ORlysophospholipase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0837400 OR lysophospholipase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0900061 | PCHAS_0900061.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1320 | PCHAS_0900061 | lysophospholipase, putative | lysophospholipase, putative | 3485797 | A0A077THN5 | 9 | PCHAS_09_v3:58,748..60,067(+) | PCHAS_09_v3:58748..60067(+) | PCHAS_09_v3 | Plasmodium chabaudi chabaudi | 434 | OG6_100231 | 27 | 439 | 1320 | 50820 | 5.51 | 0 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0900061ORlysophospholipase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0900061 OR lysophospholipase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0908600 | PCHAS_0908600.1 | 3 | 3 | 1 | | | forward | protein coding | No | 699 | PCHAS_0908600 | Josephin domain-containing protein, putative | Josephin domain-containing protein, putative | 3493920 | A0A077XGF3 | 9 | PCHAS_09_v3:366,535..367,835(+) | PCHAS_09_v3:366535..367835(+) | PCHAS_09_v3 | Plasmodium chabaudi chabaudi | 43 | OG6_104335 | 0 | 232 | 699 | 27530 | 8.08 | 0 | | | | | GO:0004843 | thiol-dependent ubiquitin-specific protease activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0908600ORJosephin domain-containing protein, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0908600 OR Josephin domain-containing protein, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0910800 | PCHAS_0910800.1 | 4 | 4 | 1 | | | forward | protein coding | No | 837 | PCHAS_0910800 | rhomboid protease ROM1, putative | rhomboid protease ROM1, putative | 3496255 | A0A077XCQ3 | 9 | PCHAS_09_v3:446,533..447,845(+) | PCHAS_09_v3:446533..447845(+) | PCHAS_09_v3 | Plasmodium chabaudi chabaudi | 93 | OG6_100562 | 1 | 278 | 837 | 31133 | 9.68 | 6 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | GO:0009986;GO:0020009 | cell surface;microneme | | | | | | 3.4.21.- (Serine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0910800ORrhomboid protease ROM1, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0910800 OR rhomboid protease ROM1, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0911900 | PCHAS_0911900.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1416 | PCHAS_0911900 | chabaupain 2 | chabaupain 2 | 3490212 | A0A077XEJ2 | 9 | PCHAS_09_v3:484,769..486,184(-) | PCHAS_09_v3:484769..486184(-) | PCHAS_09_v3 | Plasmodium chabaudi chabaudi | 159 | OG6_100116 | 1 | 471 | 1416 | 54606 | 7.40 | 1 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0911900ORchabaupain 2ANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0911900 OR chabaupain 2 AND Plasmodium chabaudi chabaudi |
|
PCHAS_0912300 | PCHAS_0912300.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 2481 | PCHAS_0912300 | rhoptry neck protein 4, putative | rhoptry neck protein 4, putative | 3485604 | A0A077XCR4 | 9 | PCHAS_09_v3:495,718..498,568(-) | PCHAS_09_v3:495718..498568(-) | PCHAS_09_v3 | Plasmodium chabaudi chabaudi | 40 | OG6_211592 | 0 | 826 | 2481 | 92412 | 4.78 | 0 | HMM: MSGIRLFYVCIFIVLSTFIHTAKSF, NN: MSGIRLFYVCIFIVLSTFIHTAKSF | NN Sum: 4, NN D: .87, HMM Prob: .9 | | | | | | | GO:1990225 | rhoptry neck | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0912300ORrhoptry neck protein 4, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0912300 OR rhoptry neck protein 4, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0912400 | PCHAS_0912400.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 4401 | PCHAS_0912400 | serine esterase, putative | serine esterase, putative | 3495531 | A0A077XEJ7 | 9 | PCHAS_09_v3:499,699..504,099(-) | PCHAS_09_v3:499699..504099(-) | PCHAS_09_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_154686 | 0 | 1466 | 4401 | 173009 | 8.68 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0912400ORserine esterase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0912400 OR serine esterase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0912500 | PCHAS_0912500.1 | 7 | 7 | 1 | | | reverse | protein coding | No | 681 | PCHAS_0912500 | pyridoxine biosynthesis protein PDX2, putative | pyridoxine biosynthesis protein PDX2, putative | 3495729 | A0A077XC02 | 9 | PCHAS_09_v3:505,661..506,985(-) | PCHAS_09_v3:505661..506985(-) | PCHAS_09_v3 | Plasmodium chabaudi chabaudi | 49 | OG6_103407 | 0 | 226 | 681 | 25490 | 6.62 | 0 | | | | | GO:0004359 | glutaminase activity | GO:0042823;GO:0042819 | pyridoxal phosphate biosynthetic process;vitamin B6 biosynthetic process | | | | | | | | 3.5.1.2 (Glutaminase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0912500ORpyridoxine biosynthesis protein PDX2, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0912500 OR pyridoxine biosynthesis protein PDX2, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0913000 | PCHAS_0913000.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2046 | PCHAS_0913000 | dipeptidyl aminopeptidase 1, putative | dipeptidyl aminopeptidase 1, putative | 3496752 | A0A077XC07 | 9 | PCHAS_09_v3:518,258..520,303(-) | PCHAS_09_v3:518258..520303(-) | PCHAS_09_v3 | Plasmodium chabaudi chabaudi | 90 | OG6_103622 | 1 | 681 | 2046 | 78239 | 6.06 | 1 | HMM: MKKLNKFINLLLISLHILYVSYVSAD, NN: MKKLNKFINLLLISLHILYVSYVSAD | NN Sum: 4, NN D: .86, HMM Prob: .98 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.14.1 (Dipeptidyl-peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0913000ORdipeptidyl aminopeptidase 1, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0913000 OR dipeptidyl aminopeptidase 1, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0913100 | PCHAS_0913100.1 | 4 | 4 | 1 | | | reverse | protein coding | No | 2733 | PCHAS_0913100 | heat shock protein 101, putative | heat shock protein 101, putative | 3494972 | A0A077XGJ4 | 9 | PCHAS_09_v3:523,103..526,239(-) | PCHAS_09_v3:523103..526239(-) | PCHAS_09_v3 | Plasmodium chabaudi chabaudi | 95 | OG6_100223 | 1 | 910 | 2733 | 103055 | 9.35 | 0 | HMM: MLRNIIKNYLLAIVLVLSVLKVDIAVLAS, NN: MLRNIIKNYLLAIVLVLSVLKVDIAV | NN Sum: 3, NN D: .68, HMM Prob: .7 | | | GO:0005524 | ATP binding | GO:0019538 | protein metabolic process | GO:0097619;GO:0020026;GO:0020005 | PTEX complex;merozoite dense granule;symbiont-containing vacuole membrane | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0913100ORheat shock protein 101, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0913100 OR heat shock protein 101, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0913400 | PCHAS_0913400.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1260 | PCHAS_0913400 | ubiquitin carboxyl-terminal hydrolase UCH54, putative | ubiquitin carboxyl-terminal hydrolase UCH54, putative | 3494027 | A0A077XEK7 | 9 | PCHAS_09_v3:537,472..538,731(+) | PCHAS_09_v3:537472..538731(+) | PCHAS_09_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_102753 | 0 | 419 | 1260 | 49189 | 4.75 | 0 | | | GO:0005622 | intracellular | GO:0004843 | thiol-dependent ubiquitin-specific protease activity | GO:0006511 | ubiquitin-dependent protein catabolic process | | | GO:0019784 | NEDD8-specific protease activity | GO:0000338;GO:0016579 | protein deneddylation;protein deubiquitination | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0913400ORubiquitin carboxyl-terminal hydrolase UCH54, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0913400 OR ubiquitin carboxyl-terminal hydrolase UCH54, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0914500 | PCHAS_0914500.1 | 1 | 1 | 1 | | | forward | protein coding | No | 3813 | PCHAS_0914500 | insulinase, putative | insulinase, putative | 3497379 | A0A077XC18 | 9 | PCHAS_09_v3:570,236..574,048(+) | PCHAS_09_v3:570236..574048(+) | PCHAS_09_v3 | Plasmodium chabaudi chabaudi | 47 | OG6_105738 | 0 | 1270 | 3813 | 146033 | 5.20 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | 3.4.24.56 (Insulysin) | 3.4.24.56 (Insulysin) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0914500ORinsulinase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0914500 OR insulinase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0915800 | PCHAS_0915800.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2892 | PCHAS_0915800 | ATP-dependent zinc metalloprotease FTSH, putative | ATP-dependent zinc metalloprotease FTSH, putative | 3494789 | A0A077XCU1 | 9 | PCHAS_09_v3:609,519..612,410(-) | PCHAS_09_v3:609519..612410(-) | PCHAS_09_v3 | Plasmodium chabaudi chabaudi | 91 | OG6_100384 | 1 | 963 | 2892 | 109651 | 9.35 | 1 | | | GO:0016021;GO:0016020 | integral component of membrane;membrane | GO:0005524;GO:0004222;GO:0008270 | ATP binding;metalloendopeptidase activity;zinc ion binding | GO:0006508 | proteolysis | | | | | | | 3.4.24.- (Metalloendopeptidases.) | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0915800ORATP-dependent zinc metalloprotease FTSH, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0915800 OR ATP-dependent zinc metalloprotease FTSH, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0917800 | PCHAS_0917800.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 5145 | PCHAS_0917800 | peptidase M16, putative | peptidase M16, putative | 3486315 | A0A077XCV6 | 9 | PCHAS_09_v3:677,833..682,977(-) | PCHAS_09_v3:677833..682977(-) | PCHAS_09_v3 | Plasmodium chabaudi chabaudi | 43 | OG6_108964 | 0 | 1714 | 5145 | 200641 | 6.38 | 0 | HMM: MYFNIFIFLIILVYENQSSCQ, NN: MYFNIFIFLIILVYENQSSCQ | NN Sum: 4, NN D: .67, HMM Prob: .79 | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.55 (Pitrilysin) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0917800ORpeptidase M16, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0917800 OR peptidase M16, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0922600 | PCHAS_0922600.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1785 | PCHAS_0922600 | steryl ester hydrolase, putative | steryl ester hydrolase, putative | 3491818 | A0A077XC63 | 9 | PCHAS_09_v3:861,647..863,431(-) | PCHAS_09_v3:861647..863431(-) | PCHAS_09_v3 | Plasmodium chabaudi chabaudi | 35 | OG6_100408 | 0 | 594 | 1785 | 68813 | 6.32 | 0 | | | | | | | GO:0006629 | lipid metabolic process | | | | | | | 3.1.1.13 (Sterol esterase) | 3.1.1.3 (Triacylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0922600ORsteryl ester hydrolase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0922600 OR steryl ester hydrolase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0924900 | PCHAS_0924900.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1386 | PCHAS_0924900 | GPI-anchor transamidase, putative | GPI-anchor transamidase, putative | 27794795 | A0A077XET1 | 9 | PCHAS_09_v3:933,388..934,773(+) | PCHAS_09_v3:933388..934773(+) | PCHAS_09_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_101767 | 0 | 461 | 1386 | 54845 | 8.58 | 2 | HMM: MELKIGIVIYLLVAIKCVIGS, NN: MELKIGIVIYLLVAIKCVIGS | NN Sum: 4, NN D: .75, HMM Prob: .82 | | | GO:0008233 | peptidase activity | GO:0006508 | proteolysis | | | GO:0003923 | GPI-anchor transamidase activity | GO:0016255 | attachment of GPI anchor to protein | | 3.-.-.- (Hydrolases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0924900ORGPI-anchor transamidase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0924900 OR GPI-anchor transamidase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0928200 | PCHAS_0928200.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1356 | PCHAS_0928200 | 26S protease regulatory subunit 6A, putative | 26S protease regulatory subunit 6A, putative | 3498186 | A0A077XC93 | 9 | PCHAS_09_v3:1,025,857..1,027,212(+) | PCHAS_09_v3:1025857..1027212(+) | PCHAS_09_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_101915 | 0 | 451 | 1356 | 50899 | 4.78 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | GO:0008540 | proteasome regulatory particle, base subcomplex | | | GO:0070682;GO:0006511 | proteasome regulatory particle assembly;ubiquitin-dependent protein catabolic process | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0928200OR26S protease regulatory subunit 6A, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0928200 OR 26S protease regulatory subunit 6A, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0931000 | PCHAS_0931000.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1677 | PCHAS_0931000 | apical membrane antigen 1, putative | apical membrane antigen 1, putative | 3488885 | G3FDP3 | 9 | PCHAS_09_v3:1,120,979..1,122,655(+) | PCHAS_09_v3:1120979..1122655(+) | PCHAS_09_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_130922 | 0 | 558 | 1677 | 63785 | 6.22 | 1 | HMM: MKEIYYIVILCSLYLINLGNCS, NN: MKEIYYIVILCSLYLINLGNCS | NN Sum: 4, NN D: .53, HMM Prob: .66 | GO:0016020 | membrane | | | GO:0009405 | pathogenesis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0931000ORapical membrane antigen 1, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0931000 OR apical membrane antigen 1, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0933600 | PCHAS_0933600.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1293 | PCHAS_0933600 | alpha/beta hydrolase, putative | alpha/beta hydrolase, putative | 3492701 | A0A077XCD1 | 9 | PCHAS_09_v3:1,234,204..1,235,496(-) | PCHAS_09_v3:1234204..1235496(-) | PCHAS_09_v3 | Plasmodium chabaudi chabaudi | 67 | OG6_129556 | 0 | 430 | 1293 | 49929 | 9.24 | 2 | | | | | | | | | | | | | | | | 3.4.11.- (Aminopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0933600ORalpha/beta hydrolase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0933600 OR alpha/beta hydrolase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0933700 | PCHAS_0933700.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1125 | PCHAS_0933700 | SPRY domain, putative | SPRY domain, putative | 3493237 | A0A077XH17 | 9 | PCHAS_09_v3:1,237,516..1,238,640(+) | PCHAS_09_v3:1237516..1238640(+) | PCHAS_09_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_102272 | 0 | 374 | 1125 | 43429 | 8.74 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0933700ORSPRY domain, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0933700 OR SPRY domain, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0935300 | PCHAS_0935300.1 | 4 | 4 | 1 | | | forward | protein coding | No | 801 | PCHAS_0935300 | rhomboid protease ROM3, putative | rhomboid protease ROM3, putative | 3493568 | A0A077XF62 | 9 | PCHAS_09_v3:1,293,477..1,294,722(+) | PCHAS_09_v3:1293477..1294722(+) | PCHAS_09_v3 | Plasmodium chabaudi chabaudi | 93 | OG6_100562 | 1 | 266 | 801 | 30339 | 7.89 | 7 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | 3.4.21.105 (Rhomboid protease) | 3.4.21.- (Serine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0935300ORrhomboid protease ROM3, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0935300 OR rhomboid protease ROM3, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_0937800 | PCHAS_0937800.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2541 | PCHAS_0937800 | lysophospholipase, putative | lysophospholipase, putative | 3493461 | A0A077XD92 | 9 | PCHAS_09_v3:1,392,718..1,395,258(-) | PCHAS_09_v3:1392718..1395258(-) | PCHAS_09_v3 | Plasmodium chabaudi chabaudi | 434 | OG6_100231 | 27 | 846 | 2541 | 98616 | 3.90 | 1 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_0937800ORlysophospholipase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_0937800 OR lysophospholipase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1000900 | PCHAS_1000900.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1455 | PCHAS_1000900 | lysophospholipase, putative | lysophospholipase, putative | 27794825 | A0A077YFE6 | 10 | PCHAS_10_v3:34,020..35,474(+) | PCHAS_10_v3:34020..35474(+) | PCHAS_10_v3 | Plasmodium chabaudi chabaudi | 434 | OG6_100231 | 27 | 484 | 1455 | 55721 | 4.92 | 0 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1000900ORlysophospholipase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1000900 OR lysophospholipase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1001200 | PCHAS_1001200.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1395 | PCHAS_1001200 | lysophospholipase, putative | lysophospholipase, putative | 3484960 | A0A077YE96 | 10 | PCHAS_10_v3:47,223..48,617(-) | PCHAS_10_v3:47223..48617(-) | PCHAS_10_v3 | Plasmodium chabaudi chabaudi | 434 | OG6_100231 | 27 | 464 | 1395 | 52879 | 5.03 | 0 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1001200ORlysophospholipase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1001200 OR lysophospholipase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1002000 | PCHAS_1002000.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1161 | PCHAS_1002000 | ubiquitin specific protease, putative | ubiquitin specific protease, putative | 3494832 | A0A077YE07 | 10 | PCHAS_10_v3:81,096..82,256(+) | PCHAS_10_v3:81096..82256(+) | PCHAS_10_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_208753 | 0 | 386 | 1161 | 45820 | 7.82 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1002000ORubiquitin specific protease, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1002000 OR ubiquitin specific protease, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1002400 | PCHAS_1002400.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2169 | PCHAS_1002400 | alpha/beta hydrolase, putative | alpha/beta hydrolase, putative | 3491849 | A0A077YFG0 | 10 | PCHAS_10_v3:100,229..102,397(-) | PCHAS_10_v3:100229..102397(-) | PCHAS_10_v3 | Plasmodium chabaudi chabaudi | 135 | OG6_100915 | 2 | 722 | 2169 | 80115 | 9.66 | 0 | | | | | | | | | | | | | | | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1002400ORalpha/beta hydrolase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1002400 OR alpha/beta hydrolase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1003300 | PCHAS_1003300.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 2448 | PCHAS_1003300 | dipeptidyl aminopeptidase 3, putative | dipeptidyl aminopeptidase 3, putative | 3495980 | A0A077YDC1 | 10 | PCHAS_10_v3:151,718..154,361(-) | PCHAS_10_v3:151718..154361(-) | PCHAS_10_v3 | Plasmodium chabaudi chabaudi | 38 | OG6_533572 | 0 | 815 | 2448 | 95904 | 7.13 | 0 | NN: MILIPLFFCIFLNYIKCD, HMM: MILIPLFFCIFLNYIKCD | NN Sum: 4, NN D: .73, HMM Prob: .8 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | GO:0045177;GO:0044164 | apical part of cell;host cell cytosol | GO:0004177 | aminopeptidase activity | | | 3.4.14.4 (Dipeptidyl-peptidase III) | 3.4.14.4 (Dipeptidyl-peptidase III) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1003300ORdipeptidyl aminopeptidase 3, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1003300 OR dipeptidyl aminopeptidase 3, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1007400 | PCHAS_1007400.1 | 5 | 5 | 1 | | | forward | protein coding | No | 2055 | PCHAS_1007400 | tRNA N6-adenosine threonylcarbamoyltransferase, putative | tRNA N6-adenosine threonylcarbamoyltransferase, putative | 3491699 | A0A077YFK8 | 10 | PCHAS_10_v3:310,148..312,673(+) | PCHAS_10_v3:310148..312673(+) | PCHAS_10_v3 | Plasmodium chabaudi chabaudi | 88 | OG6_100288 | 1 | 684 | 2055 | 79239 | 9.60 | 1 | HMM: MKLRVSTCIVFFLLFFIPCLFNSY, NN: MKLRVSTCIVFFLLFFIPCLFNSY | NN Sum: 4, NN D: .75, HMM Prob: .39 | | | | | | | | | | | | | 2.3.1.234 (N(6)-L-threonylcarbamoyladenine synthase) | 2.3.1.234 (N(6)-L-threonylcarbamoyladenine synthase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1007400ORtRNA N6-adenosine threonylcarbamoyltransferase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1007400 OR tRNA N6-adenosine threonylcarbamoyltransferase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1011100 | PCHAS_1011100.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1692 | PCHAS_1011100 | methionine aminopeptidase 2, putative | methionine aminopeptidase 2, putative | 3489463 | A0A077YHI5 | 10 | PCHAS_10_v3:447,799..449,490(-) | PCHAS_10_v3:447799..449490(-) | PCHAS_10_v3 | Plasmodium chabaudi chabaudi | 45 | OG6_100815 | 0 | 563 | 1692 | 64370 | 8.44 | 0 | | | | | GO:0004177;GO:0008235 | aminopeptidase activity;metalloexopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1011100ORmethionine aminopeptidase 2, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1011100 OR methionine aminopeptidase 2, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1012100 | PCHAS_1012100.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 288 | PCHAS_1012100 | signal peptidase complex subunit SPC1, putative | signal peptidase complex subunit SPC1, putative | 3495837 | A0A077YHJ6 | 10 | PCHAS_10_v3:506,782..507,380(-) | PCHAS_10_v3:506782..507380(-) | PCHAS_10_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_103297 | 0 | 95 | 288 | 10610 | 9.95 | 2 | | | GO:0016021;GO:0005787 | integral component of membrane;signal peptidase complex | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1012100ORsignal peptidase complex subunit SPC1, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1012100 OR signal peptidase complex subunit SPC1, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1013100 | PCHAS_1013100.1 | 1 | 1 | 1 | | | forward | protein coding | No | 3369 | PCHAS_1013100 | conserved Plasmodium protein, unknown function | conserved Plasmodium protein, unknown function | 3497559 | A0A077YHL3 | 10 | PCHAS_10_v3:552,718..556,086(+) | PCHAS_10_v3:552718..556086(+) | PCHAS_10_v3 | Plasmodium chabaudi chabaudi | 42 | OG6_532401 | 0 | 1122 | 3369 | 133426 | 9.54 | 0 | | | | | GO:0003677 | DNA binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1013100ORconserved Plasmodium protein, unknown functionANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1013100 OR conserved Plasmodium protein, unknown function AND Plasmodium chabaudi chabaudi |
|
PCHAS_1015300 | PCHAS_1015300.1 | 8 | 8 | 1 | | | reverse | protein coding | No | 1842 | PCHAS_1015300 | plasmepsin IX, putative | plasmepsin IX, putative | 3494146 | A0A077YDP2 | 10 | PCHAS_10_v3:625,509..628,225(-) | PCHAS_10_v3:625509..628225(-) | PCHAS_10_v3 | Plasmodium chabaudi chabaudi | 91 | OG6_119797 | 1 | 613 | 1842 | 72372 | 6.43 | 1 | NN: MFFLNFKKLRKNYFLALLTHPTITVLFFIYIFNFVTSD, HMM: MFFLNFKKLRKNYFLALLTHPTITVLFFIYIFNFVTSD | NN Sum: 4, NN D: .62, HMM Prob: .06 | | | GO:0004190 | aspartic-type endopeptidase activity | GO:0006508 | proteolysis | GO:0020008 | rhoptry | | | | | | 3.4.23.1 (Pepsin A) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1015300ORplasmepsin IX, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1015300 OR plasmepsin IX, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1017100 | PCHAS_1017100.1 | 2 | 2 | 1 | | | forward | protein coding | No | 1134 | PCHAS_1017100 | proliferation-associated protein 2g4, putative | proliferation-associated protein 2g4, putative | 27794843 | A0A077YHS5 | 10 | PCHAS_10_v3:688,391..689,730(+) | PCHAS_10_v3:688391..689730(+) | PCHAS_10_v3 | Plasmodium chabaudi chabaudi | 42 | OG6_101895 | 0 | 377 | 1134 | 42512 | 8.24 | 0 | | | | | | | | | | | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1017100ORproliferation-associated protein 2g4, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1017100 OR proliferation-associated protein 2g4, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1018300 | PCHAS_1018300.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3117 | PCHAS_1018300 | lipase, putative | lipase, putative | 3489448 | A0A077YDQ7 | 10 | PCHAS_10_v3:728,237..731,353(-) | PCHAS_10_v3:728237..731353(-) | PCHAS_10_v3 | Plasmodium chabaudi chabaudi | 43 | OG6_145929 | 0 | 1038 | 3117 | 123566 | 6.37 | 1 | | | | | | | GO:0006629 | lipid metabolic process | | | | | | | 3.1.1.3 (Triacylglycerol lipase) | 3.1.1.3 (Triacylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1018300ORlipase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1018300 OR lipase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1020100 | PCHAS_1020100.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1236 | PCHAS_1020100 | enoyl-CoA hydratase, putative | enoyl-CoA hydratase, putative | 3497577 | A0A077YHV1 | 10 | PCHAS_10_v3:783,451..784,686(+) | PCHAS_10_v3:783451..784686(+) | PCHAS_10_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_102410 | 0 | 411 | 1236 | 48441 | 8.32 | 0 | | | | | GO:0003824 | catalytic activity | GO:0008152 | metabolic process | | | | | | | 4.2.1.17 (Enoyl-CoA hydratase) | 4.2.1.17 (Enoyl-CoA hydratase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1020100ORenoyl-CoA hydratase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1020100 OR enoyl-CoA hydratase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1026200 | PCHAS_1026200.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 2904 | PCHAS_1026200 | cysteine protease ATG4, putative | cysteine protease ATG4, putative | 27794856 | A0A077YEZ5 | 10 | PCHAS_10_v3:1,012,423..1,015,593(-) | PCHAS_10_v3:1012423..1015593(-) | PCHAS_10_v3 | Plasmodium chabaudi chabaudi | 41 | OG6_100501 | 0 | 967 | 2904 | 113750 | 9.82 | 0 | | | | | | | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1026200ORcysteine protease ATG4, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1026200 OR cysteine protease ATG4, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1027300 | PCHAS_1027300.1 | 1 | 1 | 1 | | | forward | protein coding | No | 5076 | PCHAS_1027300 | metacaspase-3, putative | metacaspase-3, putative | 3490393 | A0A077YDX2 | 10 | PCHAS_10_v3:1,062,950..1,068,025(+) | PCHAS_10_v3:1062950..1068025(+) | PCHAS_10_v3 | Plasmodium chabaudi chabaudi | 46 | OG6_119794 | 0 | 1691 | 5076 | 197251 | 9.11 | 0 | | | | | | | | | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1027300ORmetacaspase-3, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1027300 OR metacaspase-3, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1028600 | PCHAS_1028600.1 | 1 | 1 | 1 | | | forward | protein coding | No | 3198 | PCHAS_1028600 | ATP-dependent protease, putative | ATP-dependent protease, putative | 3484504 | A0A077YI38 | 10 | PCHAS_10_v3:1,105,513..1,108,710(+) | PCHAS_10_v3:1105513..1108710(+) | PCHAS_10_v3 | Plasmodium chabaudi chabaudi | 47 | OG6_100411 | 0 | 1065 | 3198 | 123582 | 8.59 | 0 | | | | | GO:0005524;GO:0004176;GO:0004252 | ATP binding;ATP-dependent peptidase activity;serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1028600ORATP-dependent protease, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1028600 OR ATP-dependent protease, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1028800 | PCHAS_1028800.1 | 1 | 1 | 1 | | | forward | protein coding | No | 3543 | PCHAS_1028800 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | 3498393 | A0A077YDY8 | 10 | PCHAS_10_v3:1,112,434..1,115,976(+) | PCHAS_10_v3:1112434..1115976(+) | PCHAS_10_v3 | Plasmodium chabaudi chabaudi | 48 | OG6_101457 | 0 | 1180 | 3543 | 140381 | 10.04 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1028800ORubiquitin carboxyl-terminal hydrolase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1028800 OR ubiquitin carboxyl-terminal hydrolase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1029000 | PCHAS_1029000.1 | 5 | 5 | 1 | | | forward | protein coding | No | 6252 | PCHAS_1029000 | atypical protein kinase, ABC-1 family, putative | atypical protein kinase, ABC-1 family, putative | 27794860 | A0A077YEN1 | 10 | PCHAS_10_v3:1,120,454..1,127,299(+) | PCHAS_10_v3:1120454..1127299(+) | PCHAS_10_v3 | Plasmodium chabaudi chabaudi | 48 | OG6_112296 | 0 | 2083 | 6252 | 243476 | 9.72 | 0 | | | | | | | | | | | | | | | | 1.14.13.- (With NADH or NADPH as one donor, and incorporation of one atom of oxygen.) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1029000ORatypical protein kinase, ABC-1 family, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1029000 OR atypical protein kinase, ABC-1 family, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1032100 | PCHAS_1032100.1 | 4 | 4 | 1 | | | forward | protein coding | No | 1908 | PCHAS_1032100 | rhomboid protease ROM8, putative | rhomboid protease ROM8, putative | 27794862 | A0A077YI71 | 10 | PCHAS_10_v3:1,232,031..1,234,540(+) | PCHAS_10_v3:1232031..1234540(+) | PCHAS_10_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_533440 | 0 | 635 | 1908 | 73458 | 10.06 | 6 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1032100ORrhomboid protease ROM8, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1032100 OR rhomboid protease ROM8, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1033200 | PCHAS_1033200.1 | 7 | 7 | 1 | | | reverse | protein coding | No | 936 | PCHAS_1033200 | alpha/beta hydrolase, putative | alpha/beta hydrolase, putative | 3490231 | A0A077YF60 | 10 | PCHAS_10_v3:1,284,283..1,286,032(-) | PCHAS_10_v3:1284283..1286032(-) | PCHAS_10_v3 | Plasmodium chabaudi chabaudi | 43 | OG6_112275 | 0 | 311 | 936 | 36299 | 9.48 | 0 | | | | | | | | | GO:0005737 | cytoplasm | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1033200ORalpha/beta hydrolase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1033200 OR alpha/beta hydrolase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1034000 | PCHAS_1034000.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1158 | PCHAS_1034000 | DNA damage-inducible protein 1, putative | DNA damage-inducible protein 1, putative | 3496061 | A0A077YER8 | 10 | PCHAS_10_v3:1,314,768..1,315,925(-) | PCHAS_10_v3:1314768..1315925(-) | PCHAS_10_v3 | Plasmodium chabaudi chabaudi | 45 | OG6_101685 | 0 | 385 | 1158 | 43834 | 5.02 | 0 | | | | | GO:0004190 | aspartic-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1034000ORDNA damage-inducible protein 1, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1034000 OR DNA damage-inducible protein 1, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1035200 | PCHAS_1035200.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1350 | PCHAS_1035200 | plasmepsin IV, putative | plasmepsin IV, putative | 3498933 | A0A077YF81 | 10 | PCHAS_10_v3:1,372,340..1,373,689(-) | PCHAS_10_v3:1372340..1373689(-) | PCHAS_10_v3 | Plasmodium chabaudi chabaudi | 158 | OG6_100536 | 1 | 449 | 1350 | 50164 | 5.19 | 1 | | | | | GO:0004190 | aspartic-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1035200ORplasmepsin IV, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1035200 OR plasmepsin IV, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1036400 | PCHAS_1036400.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3366 | PCHAS_1036400 | ATP-dependent Clp protease regulatory subunit ClpC, putative | ATP-dependent Clp protease regulatory subunit ClpC, putative | 3496469 | A0A077YGE8 | 10 | PCHAS_10_v3:1,410,833..1,414,198(-) | PCHAS_10_v3:1410833..1414198(-) | PCHAS_10_v3 | Plasmodium chabaudi chabaudi | 42 | OG6_532618 | 0 | 1121 | 3366 | 130038 | 8.03 | 1 | HMM: MKDYHILIAIFMILGFVLNVRISK, NN: MKDYHILIAIFMILGFVLNV | NN Sum: 4, NN D: .69, HMM Prob: .18 | | | GO:0005524 | ATP binding | GO:0019538 | protein metabolic process | GO:0020011 | apicoplast | | | | | | 3.4.21.92 (Endopeptidase Clp) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1036400ORATP-dependent Clp protease regulatory subunit ClpC, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1036400 OR ATP-dependent Clp protease regulatory subunit ClpC, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1036500 | PCHAS_1036500.1 | 2 | 2 | 1 | | | forward | protein coding | No | 4287 | PCHAS_1036500 | WD repeat-containing protein 65, putative | WD repeat-containing protein 65, putative | 3496101 | A0A077YEU3 | 10 | PCHAS_10_v3:1,415,545..1,420,014(+) | PCHAS_10_v3:1415545..1420014(+) | PCHAS_10_v3 | Plasmodium chabaudi chabaudi | 50 | OG6_102663 | 0 | 1428 | 4287 | 168333 | 6.92 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1036500ORWD repeat-containing protein 65, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1036500 OR WD repeat-containing protein 65, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1041500 | PCHAS_1041500.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1458 | PCHAS_1041500 | lysophospholipase, putative | lysophospholipase, putative | 27794874 | A0A077YEY9 | 10 | PCHAS_10_v3:1,591,598..1,593,055(-) | PCHAS_10_v3:1591598..1593055(-) | PCHAS_10_v3 | Plasmodium chabaudi chabaudi | 434 | OG6_100231 | 27 | 485 | 1458 | 55990 | 6.05 | 0 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1041500ORlysophospholipase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1041500 OR lysophospholipase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1041600 | PCHAS_1041600.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1395 | PCHAS_1041600 | lysophospholipase, putative | lysophospholipase, putative | 3492014 | A0A077YIF6 | 10 | PCHAS_10_v3:1,596,177..1,597,571(-) | PCHAS_10_v3:1596177..1597571(-) | PCHAS_10_v3 | Plasmodium chabaudi chabaudi | 434 | OG6_100231 | 27 | 464 | 1395 | 53108 | 7.14 | 0 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1041600ORlysophospholipase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1041600 OR lysophospholipase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1041700 | PCHAS_1041700.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1341 | PCHAS_1041700 | lysophospholipase, putative | lysophospholipase, putative | 3493433 | A0A077YFE4 | 10 | PCHAS_10_v3:1,601,180..1,602,520(-) | PCHAS_10_v3:1601180..1602520(-) | PCHAS_10_v3 | Plasmodium chabaudi chabaudi | 434 | OG6_100231 | 27 | 446 | 1341 | 51331 | 6.44 | 0 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1041700ORlysophospholipase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1041700 OR lysophospholipase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1100400 | PCHAS_1100400.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1293 | PCHAS_1100400 | lysophospholipase, putative | lysophospholipase, putative | 27794879 | A0A077TQB2 | 11 | PCHAS_11_v3:13,209..14,501(+) | PCHAS_11_v3:13209..14501(+) | PCHAS_11_v3 | Plasmodium chabaudi chabaudi | 434 | OG6_100231 | 27 | 430 | 1293 | 49387 | 7.18 | 0 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1100400ORlysophospholipase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1100400 OR lysophospholipase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1106200 | PCHAS_1106200.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1860 | PCHAS_1106200 | rhomboid protease ROM4, putative | rhomboid protease ROM4, putative | 3488346 | A0A077TPL0 | 11 | PCHAS_11_v3:212,665..214,524(-) | PCHAS_11_v3:212665..214524(-) | PCHAS_11_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_126349 | 0 | 619 | 1860 | 70006 | 9.30 | 7 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | 3.4.21.105 (Rhomboid protease) | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1106200ORrhomboid protease ROM4, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1106200 OR rhomboid protease ROM4, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1106500 | PCHAS_1106500.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1758 | PCHAS_1106500 | subtilisin-like protease 3, putative | subtilisin-like protease 3, putative | 3498565 | A0A077TMM3 | 11 | PCHAS_11_v3:220,249..222,006(-) | PCHAS_11_v3:220249..222006(-) | PCHAS_11_v3 | Plasmodium chabaudi chabaudi | 42 | OG6_532299 | 0 | 585 | 1758 | 66516 | 9.75 | 0 | | | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0005737 | cytoplasm | | | | | | 3.4.21.62 (Subtilisin) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1106500ORsubtilisin-like protease 3, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1106500 OR subtilisin-like protease 3, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1106600 | PCHAS_1106600.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2583 | PCHAS_1106600 | PIMMS2 protein, putative | PIMMS2 protein, putative | 27794887 | A0A077TKG3 | 11 | PCHAS_11_v3:223,380..225,962(-) | PCHAS_11_v3:223380..225962(-) | PCHAS_11_v3 | Plasmodium chabaudi chabaudi | 1 | OG6_131822 | 0 | 860 | 2583 | 101170 | 4.53 | 0 | HMM: MVLLNGKRKYIAVVAIFYSFIILLVKEKFPY, NN: MVLLNGKRKYIAVVAIFYSFIILLVKEK | NN Sum: 2, NN D: .5, HMM Prob: 0 | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0071944;GO:0009986 | cell periphery;cell surface | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1106600ORPIMMS2 protein, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1106600 OR PIMMS2 protein, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1106800 | PCHAS_1106800.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1797 | PCHAS_1106800 | subtilisin-like protease 1, putative | subtilisin-like protease 1, putative | 3499155 | A0A077TQE9 | 11 | PCHAS_11_v3:228,386..230,182(-) | PCHAS_11_v3:228386..230182(-) | PCHAS_11_v3 | Plasmodium chabaudi chabaudi | 49 | OG6_121085 | 0 | 598 | 1797 | 67217 | 6.22 | 0 | HMM: MEFSKMRTVFIYACVVSLALCTVSAH, NN: MEFSKMRTVFIYACVVSLALCTVSAH | NN Sum: 4, NN D: .78, HMM Prob: .9 | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0044311;GO:0020003 | exoneme;symbiont-containing vacuole | | | | | 3.4.21.62 (Subtilisin) | 3.4.21.62 (Subtilisin) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1106800ORsubtilisin-like protease 1, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1106800 OR subtilisin-like protease 1, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1114300 | PCHAS_1114300.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 1368 | PCHAS_1114300 | rhomboid protease ROM9, putative | rhomboid protease ROM9, putative | 3499151 | A0A077TPT6 | 11 | PCHAS_11_v3:506,394..508,058(-) | PCHAS_11_v3:506394..508058(-) | PCHAS_11_v3 | Plasmodium chabaudi chabaudi | 6 | OG6_101864 | 0 | 455 | 1368 | 53422 | 10.36 | 5 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1114300ORrhomboid protease ROM9, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1114300 OR rhomboid protease ROM9, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1117300 | PCHAS_1117300.1 | 8 | 8 | 1 | | | reverse | protein coding | No | 828 | PCHAS_1117300 | rhomboid protease ROM10, putative | rhomboid protease ROM10, putative | 3495168 | A0A077TPW7 | 11 | PCHAS_11_v3:608,924..610,554(-) | PCHAS_11_v3:608924..610554(-) | PCHAS_11_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_103838 | 0 | 275 | 828 | 31872 | 8.62 | 6 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1117300ORrhomboid protease ROM10, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1117300 OR rhomboid protease ROM10, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1125500 | PCHAS_1125500.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1404 | PCHAS_1125500 | E3 ubiquitin-protein ligase RNF5, putative | E3 ubiquitin-protein ligase RNF5, putative | 3498495 | A0A077TLN3 | 11 | PCHAS_11_v3:892,417..893,820(-) | PCHAS_11_v3:892417..893820(-) | PCHAS_11_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_102074 | 0 | 467 | 1404 | 53947 | 4.86 | 1 | | | | | | | | | | | | | | | 6.3.2.19 (Transferred entry: 2.3.2.23, 2.3.2.27 and 6.2.1.45) | 6.3.2.19 (Transferred entry: 2.3.2.23, 2.3.2.27 and 6.2.1.45) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1125500ORE3 ubiquitin-protein ligase RNF5, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1125500 OR E3 ubiquitin-protein ligase RNF5, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1125700 | PCHAS_1125700.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 570 | PCHAS_1125700 | protein DJ-1, putative | protein DJ-1, putative | 3495861 | A0A077TKZ9 | 11 | PCHAS_11_v3:896,845..897,908(-) | PCHAS_11_v3:896845..897908(-) | PCHAS_11_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_101257 | 0 | 189 | 570 | 20488 | 7.50 | 0 | | | | | | | | | GO:0005829 | cytosol | GO:0008233;GO:0036524 | peptidase activity;protein deglycase activity | GO:0036525;GO:0006457 | protein deglycation;protein folding | | 2.7.1.50 (Hydroxyethylthiazole kinase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1125700ORprotein DJ-1, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1125700 OR protein DJ-1, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1126600 | PCHAS_1126600.1 | 8 | 8 | 1 | | | forward | protein coding | No | 990 | PCHAS_1126600 | protease, putative | protease, putative | 3490177 | A0A077TN85 | 11 | PCHAS_11_v3:960,171..962,374(+) | PCHAS_11_v3:960171..962374(+) | PCHAS_11_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_168022 | 0 | 329 | 990 | 38498 | 7.94 | 8 | | | | | GO:0008233 | peptidase activity | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1126600ORprotease, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1126600 OR protease, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1127600 | PCHAS_1127600.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2220 | PCHAS_1127600 | phospholipase, putative | phospholipase, putative | 3498259 | A0A077TN95 | 11 | PCHAS_11_v3:987,277..989,496(+) | PCHAS_11_v3:987277..989496(+) | PCHAS_11_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_101376 | 0 | 739 | 2220 | 85219 | 4.57 | 1 | NN: MRTFLFIIILYNCICLTLIYSF, HMM: MRTFLFIIILYNCICLTLIYSF | NN Sum: 4, NN D: .74, HMM Prob: .92 | | | GO:0008374 | O-acyltransferase activity | GO:0006629 | lipid metabolic process | | | | | | | 2.3.1.43 (Phosphatidylcholine--sterol O-acyltransferase) | 2.3.1.43 (Phosphatidylcholine--sterol O-acyltransferase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1127600ORphospholipase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1127600 OR phospholipase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1129900 | PCHAS_1129900.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 741 | PCHAS_1129900 | proteasome subunit alpha type-4, putative | proteasome subunit alpha type-4, putative | 3491558 | A0A077TQW8 | 11 | PCHAS_11_v3:1,084,734..1,085,569(-) | PCHAS_11_v3:1084734..1085569(-) | PCHAS_11_v3 | Plasmodium chabaudi chabaudi | 45 | OG6_101968 | 0 | 246 | 741 | 27730 | 7.32 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1129900ORproteasome subunit alpha type-4, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1129900 OR proteasome subunit alpha type-4, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1130000 | PCHAS_1130000.1 | 4 | 4 | 1 | | | forward | protein coding | No | 726 | PCHAS_1130000 | proteasome subunit alpha type-7, putative | proteasome subunit alpha type-7, putative | 3499145 | A0A077TLT3 | 11 | PCHAS_11_v3:1,087,011..1,088,051(+) | PCHAS_11_v3:1087011..1088051(+) | PCHAS_11_v3 | Plasmodium chabaudi chabaudi | 45 | OG6_101207 | 0 | 241 | 726 | 27199 | 7.34 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1130000ORproteasome subunit alpha type-7, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1130000 OR proteasome subunit alpha type-7, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1130900 | PCHAS_1130900.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1800 | PCHAS_1130900 | metacaspase-1, putative | metacaspase-1, putative | 3496270 | A0A077TQX9 | 11 | PCHAS_11_v3:1,110,212..1,112,011(-) | PCHAS_11_v3:1110212..1112011(-) | PCHAS_11_v3 | Plasmodium chabaudi chabaudi | 83 | OG6_101407 | 1 | 599 | 1800 | 70537 | 8.91 | 0 | | | | | | | | | | | GO:0008233 | peptidase activity | GO:0006915;GO:0006508 | apoptotic process;proteolysis | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1130900ORmetacaspase-1, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1130900 OR metacaspase-1, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1132100 | PCHAS_1132100.1 | 7 | 7 | 1 | | | forward | protein coding | No | 609 | PCHAS_1132100 | ubiquitin-conjugating enzyme E2, putative | ubiquitin-conjugating enzyme E2, putative | 3490888 | A0A077TNE1 | 11 | PCHAS_11_v3:1,154,934..1,156,425(+) | PCHAS_11_v3:1154934..1156425(+) | PCHAS_11_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_103192 | 0 | 202 | 609 | 22803 | 5.11 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 6.3.2.19 (Transferred entry: 2.3.2.23, 2.3.2.27 and 6.2.1.45) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1132100ORubiquitin-conjugating enzyme E2, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1132100 OR ubiquitin-conjugating enzyme E2, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1134100 | PCHAS_1134100.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1002 | PCHAS_1134100 | rhomboid protease ROM7, putative | rhomboid protease ROM7, putative | 27794911 | A0A077TNG8 | 11 | PCHAS_11_v3:1,229,634..1,230,635(-) | PCHAS_11_v3:1229634..1230635(-) | PCHAS_11_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_533468 | 0 | 333 | 1002 | 39739 | 9.97 | 4 | NN: MNLSILLIFIIYITRGNSL, HMM: MNLSILLIFIIYITRGN | NN Sum: 4, NN D: .79, HMM Prob: .97 | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | GO:0020011 | apicoplast | | | | | 3.4.21.105 (Rhomboid protease) | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1134100ORrhomboid protease ROM7, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1134100 OR rhomboid protease ROM7, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1135600 | PCHAS_1135600.1 | 1 | 1 | 1 | | | forward | protein coding | No | 5304 | PCHAS_1135600 | conserved Plasmodium protein, unknown function | conserved Plasmodium protein, unknown function | 3499203 | A0A077TNM2 | 11 | PCHAS_11_v3:1,289,408..1,294,711(+) | PCHAS_11_v3:1289408..1294711(+) | PCHAS_11_v3 | Plasmodium chabaudi chabaudi | 46 | OG6_156430 | 0 | 1767 | 5304 | 205612 | 9.53 | 4 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1135600ORconserved Plasmodium protein, unknown functionANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1135600 OR conserved Plasmodium protein, unknown function AND Plasmodium chabaudi chabaudi |
|
PCHAS_1136500 | PCHAS_1136500.1 | 1 | 1 | 1 | | | forward | protein coding | No | 3441 | PCHAS_1136500 | falcilysin, putative | falcilysin, putative | 3496372 | A0A077TR58 | 11 | PCHAS_11_v3:1,324,558..1,327,998(+) | PCHAS_11_v3:1324558..1327998(+) | PCHAS_11_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_101809 | 0 | 1146 | 3441 | 133156 | 7.07 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | GO:0006508 | proteolysis | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1136500ORfalcilysin, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1136500 OR falcilysin, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1137900 | PCHAS_1137900.1 | 1 | 1 | 1 | | | forward | protein coding | No | 5763 | PCHAS_1137900 | calpain, putative | calpain, putative | 3494170 | A0A077TQP6 | 11 | PCHAS_11_v3:1,377,160..1,382,922(+) | PCHAS_11_v3:1377160..1382922(+) | PCHAS_11_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_103851 | 0 | 1920 | 5763 | 225170 | 9.82 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1137900ORcalpain, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1137900 OR calpain, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1143500 | PCHAS_1143500.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 936 | PCHAS_1143500 | 26S proteasome regulatory subunit RPN11, putative | 26S proteasome regulatory subunit RPN11, putative | 3495041 | A0A077TQT1 | 11 | PCHAS_11_v3:1,566,062..1,567,338(-) | PCHAS_11_v3:1566062..1567338(-) | PCHAS_11_v3 | Plasmodium chabaudi chabaudi | 43 | OG6_101835 | 0 | 311 | 936 | 35122 | 6.63 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1143500OR26S proteasome regulatory subunit RPN11, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1143500 OR 26S proteasome regulatory subunit RPN11, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1145800 | PCHAS_1145800.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1350 | PCHAS_1145800 | lysophospholipase, putative | lysophospholipase, putative | 3496726 | A0A077TNT5 | 11 | PCHAS_11_v3:1,655,600..1,656,949(-) | PCHAS_11_v3:1655600..1656949(-) | PCHAS_11_v3 | Plasmodium chabaudi chabaudi | 434 | OG6_100231 | 27 | 449 | 1350 | 51208 | 6.70 | 0 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1145800ORlysophospholipase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1145800 OR lysophospholipase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1146100 | PCHAS_1146100.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1296 | PCHAS_1146100 | lysophospholipase, putative | lysophospholipase, putative | 3485110 | A0A077TRC9 | 11 | PCHAS_11_v3:1,669,255..1,670,550(-) | PCHAS_11_v3:1669255..1670550(-) | PCHAS_11_v3 | Plasmodium chabaudi chabaudi | 434 | OG6_100231 | 27 | 431 | 1296 | 49336 | 8.18 | 0 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1146100ORlysophospholipase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1146100 OR lysophospholipase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1204600 | PCHAS_1204600.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 2100 | PCHAS_1204600 | peptidase, putative | peptidase, putative | 3499066 | A0A077TMF8 | 12 | PCHAS_12_v3:164,322..166,616(-) | PCHAS_12_v3:164322..166616(-) | PCHAS_12_v3 | Plasmodium chabaudi chabaudi | 45 | OG6_100561 | 0 | 699 | 2100 | 83258 | 9.49 | 0 | | | | | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.24.15 (Thimet oligopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1204600ORpeptidase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1204600 OR peptidase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1205800 | PCHAS_1205800.1 | 9 | 9 | 1 | | | forward | protein coding | No | 705 | PCHAS_1205800 | PPPDE peptidase, putative | PPPDE peptidase, putative | 27794946 | A0A077TLU4 | 12 | PCHAS_12_v3:194,805..196,310(+) | PCHAS_12_v3:194805..196310(+) | PCHAS_12_v3 | Plasmodium chabaudi chabaudi | 90 | OG6_101256 | 1 | 234 | 705 | 26551 | 9.74 | 0 | | | | | | | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1205800ORPPPDE peptidase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1205800 OR PPPDE peptidase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1207300 | PCHAS_1207300.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 1344 | PCHAS_1207300 | 26S protease regulatory subunit 4, putative | 26S protease regulatory subunit 4, putative | 3494845 | A0A077TLV5 | 12 | PCHAS_12_v3:254,659..256,339(-) | PCHAS_12_v3:254659..256339(-) | PCHAS_12_v3 | Plasmodium chabaudi chabaudi | 45 | OG6_101477 | 0 | 447 | 1344 | 49708 | 8.04 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | GO:0008540 | proteasome regulatory particle, base subcomplex | | | GO:0070682;GO:0006511 | proteasome regulatory particle assembly;ubiquitin-dependent protein catabolic process | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1207300OR26S protease regulatory subunit 4, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1207300 OR 26S protease regulatory subunit 4, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1208500 | PCHAS_1208500.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 1059 | PCHAS_1208500 | metalloprotease, putative | metalloprotease, putative | 3498363 | A0A077TRM5 | 12 | PCHAS_12_v3:289,808..291,226(-) | PCHAS_12_v3:289808..291226(-) | PCHAS_12_v3 | Plasmodium chabaudi chabaudi | 45 | OG6_108834 | 0 | 352 | 1059 | 40597 | 9.45 | 0 | | | | | | | | | | | GO:0008237 | metallopeptidase activity | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1208500ORmetalloprotease, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1208500 OR metalloprotease, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1210500 | PCHAS_1210500.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 813 | PCHAS_1210500 | proteasome subunit beta type-5, putative | proteasome subunit beta type-5, putative | 3487772 | A0A077TRP4 | 12 | PCHAS_12_v3:351,224..352,036(-) | PCHAS_12_v3:351224..352036(-) | PCHAS_12_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_100897 | 0 | 270 | 813 | 30616 | 4.82 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1210500ORproteasome subunit beta type-5, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1210500 OR proteasome subunit beta type-5, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1214400 | PCHAS_1214400.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1416 | PCHAS_1214400 | methionine aminopeptidase 1b, putative | methionine aminopeptidase 1b, putative | 3498809 | A0A077TR90 | 12 | PCHAS_12_v3:508,268..509,683(+) | PCHAS_12_v3:508268..509683(+) | PCHAS_12_v3 | Plasmodium chabaudi chabaudi | 43 | OG6_100342 | 0 | 471 | 1416 | 53834 | 7.93 | 0 | | | | | GO:0004177;GO:0008235 | aminopeptidase activity;metalloexopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1214400ORmethionine aminopeptidase 1b, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1214400 OR methionine aminopeptidase 1b, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1217700 | PCHAS_1217700.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2604 | PCHAS_1217700 | peptidase, putative | peptidase, putative | 3492271 | A0A077TPB1 | 12 | PCHAS_12_v3:627,883..630,486(+) | PCHAS_12_v3:627883..630486(+) | PCHAS_12_v3 | Plasmodium chabaudi chabaudi | 45 | OG6_102438 | 0 | 867 | 2604 | 101088 | 6.80 | 0 | | | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.19.1 (Acylaminoacyl-peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1217700ORpeptidase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1217700 OR peptidase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1218500 | PCHAS_1218500.1 | 8 | 8 | 1 | | | reverse | protein coding | No | 555 | PCHAS_1218500 | signal peptidase complex subunit 2, putative | signal peptidase complex subunit 2, putative | 27794964 | A0A077TRX5 | 12 | PCHAS_12_v3:658,136..659,651(-) | PCHAS_12_v3:658136..659651(-) | PCHAS_12_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_137524 | 0 | 184 | 555 | 22152 | 9.80 | 2 | | | GO:0016021;GO:0005787 | integral component of membrane;signal peptidase complex | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | GO:0005783;GO:0005787 | endoplasmic reticulum;signal peptidase complex | | | GO:0045047;GO:0006465 | protein targeting to ER;signal peptide processing | | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1218500ORsignal peptidase complex subunit 2, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1218500 OR signal peptidase complex subunit 2, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1220900 | PCHAS_1220900.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1959 | PCHAS_1220900 | lysophospholipase, putative | lysophospholipase, putative | 3487312 | A0A077TRF8 | 12 | PCHAS_12_v3:750,623..752,581(-) | PCHAS_12_v3:750623..752581(-) | PCHAS_12_v3 | Plasmodium chabaudi chabaudi | 434 | OG6_100231 | 27 | 652 | 1959 | 74559 | 4.26 | 0 | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1220900ORlysophospholipase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1220900 OR lysophospholipase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1221000 | PCHAS_1221000.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1134 | PCHAS_1221000 | prodrug activation and resistance esterase, putative | prodrug activation and resistance esterase, putative | 3495452 | A0A077TRZ0 | 12 | PCHAS_12_v3:754,788..755,921(-) | PCHAS_12_v3:754788..755921(-) | PCHAS_12_v3 | Plasmodium chabaudi chabaudi | 434 | OG6_100231 | 27 | 377 | 1134 | 42890 | 8.86 | 0 | | | | | | | | | GO:0005737 | cytoplasm | GO:0047372;GO:0016788 | acylglycerol lipase activity;hydrolase activity, acting on ester bonds | GO:0052651;GO:0042493 | monoacylglycerol catabolic process;response to drug | 3.1.1.23 (Acylglycerol lipase) | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1221000ORprodrug activation and resistance esterase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1221000 OR prodrug activation and resistance esterase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1221200 | PCHAS_1221200.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 5682 | PCHAS_1221200 | conserved protein, unknown function | conserved protein, unknown function | 3494250 | A0A077TPD8 | 12 | PCHAS_12_v3:758,192..764,113(-) | PCHAS_12_v3:758192..764113(-) | PCHAS_12_v3 | Plasmodium chabaudi chabaudi | 43 | OG6_113142 | 0 | 1893 | 5682 | 221541 | 9.99 | 4 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1221200ORconserved protein, unknown functionANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1221200 OR conserved protein, unknown function AND Plasmodium chabaudi chabaudi |
|
PCHAS_1223100 | PCHAS_1223100.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1653 | PCHAS_1223100 | plasmepsin X, putative | plasmepsin X, putative | 3498952 | A0A077TPG1 | 12 | PCHAS_12_v3:825,521..827,173(+) | PCHAS_12_v3:825521..827173(+) | PCHAS_12_v3 | Plasmodium chabaudi chabaudi | 91 | OG6_119797 | 1 | 550 | 1653 | 61902 | 5.89 | 0 | NN: MKSVKIVPIFYLVAFFFHNYNEVTCG, HMM: MKSVKIVPIFYLVAFFFHNYNEVTCG | NN Sum: 4, NN D: .53, HMM Prob: .58 | | | | | | | GO:0044311 | exoneme | GO:0004190 | aspartic-type endopeptidase activity | GO:0035891;GO:0006508 | exit from host cell;proteolysis | | 3.4.23.1 (Pepsin A) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1223100ORplasmepsin X, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1223100 OR plasmepsin X, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1223300 | PCHAS_1223300.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3552 | PCHAS_1223300 | conserved Plasmodium protein, unknown function | conserved Plasmodium protein, unknown function | 3490850 | A0A077TRJ0 | 12 | PCHAS_12_v3:833,779..837,330(-) | PCHAS_12_v3:833779..837330(-) | PCHAS_12_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_128391 | 0 | 1183 | 3552 | 141659 | 9.89 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1223300ORconserved Plasmodium protein, unknown functionANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1223300 OR conserved Plasmodium protein, unknown function AND Plasmodium chabaudi chabaudi |
|
PCHAS_1223500 | PCHAS_1223500.1 | 2 | 2 | 1 | | | forward | protein coding | No | 1263 | PCHAS_1223500 | 26S proteasome regulatory subunit RPN10, putative | 26S proteasome regulatory subunit RPN10, putative | 3497479 | A0A077TMY7 | 12 | PCHAS_12_v3:840,661..842,023(+) | PCHAS_12_v3:840661..842023(+) | PCHAS_12_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_102002 | 0 | 420 | 1263 | 47168 | 4.49 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1223500OR26S proteasome regulatory subunit RPN10, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1223500 OR 26S proteasome regulatory subunit RPN10, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1223700 | PCHAS_1223700.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 783 | PCHAS_1223700 | proteasome subunit alpha type-6, putative | proteasome subunit alpha type-6, putative | 3496841 | A0A077TMA2 | 12 | PCHAS_12_v3:847,701..848,854(-) | PCHAS_12_v3:847701..848854(-) | PCHAS_12_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_102240 | 0 | 260 | 783 | 29591 | 4.91 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1223700ORproteasome subunit alpha type-6, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1223700 OR proteasome subunit alpha type-6, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1226200 | PCHAS_1226200.1 | 7 | 7 | 1 | | | forward | protein coding | No | 732 | PCHAS_1226200 | alpha/beta hydrolase, putative | alpha/beta hydrolase, putative | 27794973 | A0A077TMD1 | 12 | PCHAS_12_v3:938,950..940,363(+) | PCHAS_12_v3:938950..940363(+) | PCHAS_12_v3 | Plasmodium chabaudi chabaudi | 135 | OG6_100915 | 2 | 243 | 732 | 28332 | 5.61 | 0 | | | | | | | | | | | | | | | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1226200ORalpha/beta hydrolase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1226200 OR alpha/beta hydrolase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1226800 | PCHAS_1226800.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2046 | PCHAS_1226800 | methionine aminopeptidase 1c, putative | methionine aminopeptidase 1c, putative | 3489625 | A0A077TRN3 | 12 | PCHAS_12_v3:971,865..973,910(-) | PCHAS_12_v3:971865..973910(-) | PCHAS_12_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_171502 | 0 | 681 | 2046 | 80949 | 9.01 | 0 | NN: MNVHIFLLLLFCGTFLCKKNSN, HMM: MNVHIFLLLLFCGTFLCK | NN Sum: 3, NN D: .58, HMM Prob: .96 | | | | | | | | | GO:0003729;GO:0070006;GO:0008235 | mRNA binding;metalloaminopeptidase activity;metalloexopeptidase activity | | | | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1226800ORmethionine aminopeptidase 1c, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1226800 OR methionine aminopeptidase 1c, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1227100 | PCHAS_1227100.1 | 2 | 2 | 1 | | | forward | protein coding | No | 771 | PCHAS_1227100 | proteasome subunit beta type-4, putative | proteasome subunit beta type-4, putative | 3498068 | A0A077TPK1 | 12 | PCHAS_12_v3:983,628..984,523(+) | PCHAS_12_v3:983628..984523(+) | PCHAS_12_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_101718 | 0 | 256 | 771 | 29822 | 6.67 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1227100ORproteasome subunit beta type-4, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1227100 OR proteasome subunit beta type-4, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1229200 | PCHAS_1229200.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 4131 | PCHAS_1229200 | sentrin-specific protease 2, putative | sentrin-specific protease 2, putative | 3493574 | A0A077TPM3 | 12 | PCHAS_12_v3:1,074,954..1,079,381(-) | PCHAS_12_v3:1074954..1079381(-) | PCHAS_12_v3 | Plasmodium chabaudi chabaudi | 34 | OG6_113308 | 0 | 1376 | 4131 | 162589 | 8.38 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.68 (Ulp1 peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1229200ORsentrin-specific protease 2, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1229200 OR sentrin-specific protease 2, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1232100 | PCHAS_1232100.1 | 3 | 3 | 1 | | | forward | protein coding | No | 3744 | PCHAS_1232100 | ubiquitin carboxyl-terminal hydrolase 2, putative | ubiquitin carboxyl-terminal hydrolase 2, putative | 3499116 | A0A077TN56 | 12 | PCHAS_12_v3:1,177,667..1,181,637(+) | PCHAS_12_v3:1177667..1181637(+) | PCHAS_12_v3 | Plasmodium chabaudi chabaudi | 48 | OG6_101021 | 0 | 1247 | 3744 | 144852 | 6.54 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1232100ORubiquitin carboxyl-terminal hydrolase 2, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1232100 OR ubiquitin carboxyl-terminal hydrolase 2, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1232800 | PCHAS_1232800.1 | 3 | 3 | 1 | | | forward | protein coding | No | 3297 | PCHAS_1232800 | FACT complex subunit SPT16, putative | FACT complex subunit SPT16, putative | 3494628 | A0A077TMK0 | 12 | PCHAS_12_v3:1,208,341..1,211,866(+) | PCHAS_12_v3:1208341..1211866(+) | PCHAS_12_v3 | Plasmodium chabaudi chabaudi | 38 | OG6_102309 | 0 | 1098 | 3297 | 127281 | 4.73 | 0 | | | | | | | | | GO:0005634 | nucleus | | | | | | 1.1.1.27 (L-lactate dehydrogenase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1232800ORFACT complex subunit SPT16, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1232800 OR FACT complex subunit SPT16, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1233100 | PCHAS_1233100.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2151 | PCHAS_1233100 | eukaryotic translation initiation factor 3 subunit B, putative | eukaryotic translation initiation factor 3 subunit B, putative | 3494946 | A0A077TN64 | 12 | PCHAS_12_v3:1,219,282..1,221,432(+) | PCHAS_12_v3:1219282..1221432(+) | PCHAS_12_v3 | Plasmodium chabaudi chabaudi | 45 | OG6_101924 | 0 | 716 | 2151 | 84084 | 8.84 | 0 | | | GO:0005852 | eukaryotic translation initiation factor 3 complex | GO:0003723;GO:0003676;GO:0003743;GO:0031369 | RNA binding;nucleic acid binding;translation initiation factor activity;translation initiation factor binding | GO:0006413 | translational initiation | | | | | | | | 3.6.3.14 (Transferred entry: 7.1.2.2) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1233100OReukaryotic translation initiation factor 3 subunit B, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1233100 OR eukaryotic translation initiation factor 3 subunit B, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1233700 | PCHAS_1233700.1 | 4 | 4 | 1 | | | reverse | protein coding | No | 729 | PCHAS_1233700 | proteasome subunit beta type-1, putative | proteasome subunit beta type-1, putative | 3499350 | A0A077TPR7 | 12 | PCHAS_12_v3:1,234,268..1,235,415(-) | PCHAS_12_v3:1234268..1235415(-) | PCHAS_12_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_101631 | 0 | 242 | 729 | 27273 | 6.78 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1233700ORproteasome subunit beta type-1, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1233700 OR proteasome subunit beta type-1, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1238300 | PCHAS_1238300.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 1605 | PCHAS_1238300 | mitochondrial-processing peptidase subunit alpha, putative | mitochondrial-processing peptidase subunit alpha, putative | 3497795 | A0A077TMU8 | 12 | PCHAS_12_v3:1,413,728..1,415,530(-) | PCHAS_12_v3:1413728..1415530(-) | PCHAS_12_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_102381 | 0 | 534 | 1605 | 61185 | 8.88 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | GO:0017087;GO:0005739 | mitochondrial processing peptidase complex;mitochondrion | GO:0004222 | metalloendopeptidase activity | GO:0006627 | protein processing involved in protein targeting to mitochondrion | 3.4.24.64 (Mitochondrial processing peptidase) | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1238300ORmitochondrial-processing peptidase subunit alpha, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1238300 OR mitochondrial-processing peptidase subunit alpha, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1242400 | PCHAS_1242400.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 1602 | PCHAS_1242400 | ubiquitin carboxyl-terminal hydrolase 14, putative | ubiquitin carboxyl-terminal hydrolase 14, putative | 3491409 | A0A077TS59 | 12 | PCHAS_12_v3:1,545,100..1,546,983(-) | PCHAS_12_v3:1545100..1546983(-) | PCHAS_12_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_101892 | 0 | 533 | 1602 | 61847 | 5.92 | 0 | | | | | GO:0005515;GO:0036459 | protein binding;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1242400ORubiquitin carboxyl-terminal hydrolase 14, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1242400 OR ubiquitin carboxyl-terminal hydrolase 14, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1242500 | PCHAS_1242500.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 1011 | PCHAS_1242500 | methionine aminopeptidase 1a, putative | methionine aminopeptidase 1a, putative | 3492089 | A0A077TSN4 | 12 | PCHAS_12_v3:1,548,327..1,549,627(-) | PCHAS_12_v3:1548327..1549627(-) | PCHAS_12_v3 | Plasmodium chabaudi chabaudi | 43 | OG6_124490 | 0 | 336 | 1011 | 38541 | 8.03 | 0 | | | | | GO:0004177;GO:0008235 | aminopeptidase activity;metalloexopeptidase activity | GO:0006508 | proteolysis | | | GO:0003729;GO:0070006 | mRNA binding;metalloaminopeptidase activity | | | 3.4.11.18 (Methionyl aminopeptidase) | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1242500ORmethionine aminopeptidase 1a, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1242500 OR methionine aminopeptidase 1a, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1302900 | PCHAS_1302900.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1428 | PCHAS_1302900 | lysophospholipase, putative | lysophospholipase, putative | 3498425 | A0A077TST9 | 13 | PCHAS_13_v3:99,595..101,022(+) | PCHAS_13_v3:99595..101022(+) | PCHAS_13_v3 | Plasmodium chabaudi chabaudi | 434 | OG6_100231 | 27 | 475 | 1428 | 54388 | 8.18 | 0 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1302900ORlysophospholipase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1302900 OR lysophospholipase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1304600 | PCHAS_1304600.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 762 | PCHAS_1304600 | proteasome subunit alpha type-1, putative | proteasome subunit alpha type-1, putative | 3496079 | A0A077TQA0 | 13 | PCHAS_13_v3:173,050..174,174(-) | PCHAS_13_v3:173050..174174(-) | PCHAS_13_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_102143 | 0 | 253 | 762 | 28852 | 6.26 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1304600ORproteasome subunit alpha type-1, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1304600 OR proteasome subunit alpha type-1, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1305500 | PCHAS_1305500.1 | 7 | 7 | 1 | | | forward | protein coding | No | 5001 | PCHAS_1305500 | metacaspase-2, putative | metacaspase-2, putative | 3497216 | A0A077TNJ2 | 13 | PCHAS_13_v3:221,547..227,435(+) | PCHAS_13_v3:221547..227435(+) | PCHAS_13_v3 | Plasmodium chabaudi chabaudi | 83 | OG6_101407 | 1 | 1666 | 5001 | 193553 | 9.88 | 0 | | | | | | | | | GO:0005737 | cytoplasm | GO:0008234 | cysteine-type peptidase activity | GO:0006915 | apoptotic process | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1305500ORmetacaspase-2, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1305500 OR metacaspase-2, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1307400 | PCHAS_1307400.1 | 6 | 6 | 1 | | | forward | protein coding | No | 4443 | PCHAS_1307400 | stromal-processing peptidase, putative | stromal-processing peptidase, putative | | | 13 | PCHAS_13_v3:305,075..312,555(+) | PCHAS_13_v3:305075..312555(+) | PCHAS_13_v3 | Plasmodium chabaudi chabaudi | 43 | OG6_110270 | 0 | 1480 | 4443 | 174907 | 6.95 | 0 | NN: MKKINEIILSFLFALHFVNCL, HMM: MKKINEIILSFLFALHFVNCL | NN Sum: 4, NN D: .76, HMM Prob: .93 | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | GO:0020011 | apicoplast | | | | | | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1307400ORstromal-processing peptidase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1307400 OR stromal-processing peptidase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1308800 | PCHAS_1308800.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1374 | PCHAS_1308800 | mitochondrial inner membrane protease ATP23, putative | mitochondrial inner membrane protease ATP23, putative | 3494917 | A0A077TSE2 | 13 | PCHAS_13_v3:362,665..364,038(+) | PCHAS_13_v3:362665..364038(+) | PCHAS_13_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_102968 | 0 | 457 | 1374 | 53683 | 9.04 | 0 | | | | | GO:0004222 | metalloendopeptidase activity | | | GO:0005758 | mitochondrial intermembrane space | | | GO:0034982;GO:0033615 | mitochondrial protein processing;mitochondrial proton-transporting ATP synthase complex assembly | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1308800ORmitochondrial inner membrane protease ATP23, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1308800 OR mitochondrial inner membrane protease ATP23, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1313100 | PCHAS_1313100.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1914 | PCHAS_1313100 | M17 leucyl aminopeptidase, putative | M17 leucyl aminopeptidase, putative | 3493455 | A0A077TQI8 | 13 | PCHAS_13_v3:535,138..537,051(-) | PCHAS_13_v3:535138..537051(-) | PCHAS_13_v3 | Plasmodium chabaudi chabaudi | 45 | OG6_100682 | 2 | 637 | 1914 | 71140 | 8.98 | 0 | | | GO:0005737;GO:0005622 | cytoplasm;intracellular | GO:0004177;GO:0030145;GO:0008235 | aminopeptidase activity;manganese ion binding;metalloexopeptidase activity | GO:0019538;GO:0006508 | protein metabolic process;proteolysis | | | | | | | 3.4.11.1 (Leucyl aminopeptidase) | 3.4.11.1 (Leucyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1313100ORM17 leucyl aminopeptidase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1313100 OR M17 leucyl aminopeptidase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1313400 | PCHAS_1313400.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1593 | PCHAS_1313400 | M17 leucyl aminopeptidase, putative | M17 leucyl aminopeptidase, putative | 27795005 | A0A077TT58 | 13 | PCHAS_13_v3:545,884..547,476(-) | PCHAS_13_v3:545884..547476(-) | PCHAS_13_v3 | Plasmodium chabaudi chabaudi | 45 | OG6_100682 | 2 | 530 | 1593 | 58621 | 6.44 | 0 | | | GO:0005737;GO:0005622 | cytoplasm;intracellular | GO:0004177;GO:0030145;GO:0008235 | aminopeptidase activity;manganese ion binding;metalloexopeptidase activity | GO:0019538;GO:0006508 | protein metabolic process;proteolysis | | | | | | | 3.4.11.1 (Leucyl aminopeptidase) | 3.4.11.1 (Leucyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1313400ORM17 leucyl aminopeptidase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1313400 OR M17 leucyl aminopeptidase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1313500 | PCHAS_1313500.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1878 | PCHAS_1313500 | M17 leucyl aminopeptidase, putative | M17 leucyl aminopeptidase, putative | 3497368 | A0A077TNP0 | 13 | PCHAS_13_v3:549,117..550,994(-) | PCHAS_13_v3:549117..550994(-) | PCHAS_13_v3 | Plasmodium chabaudi chabaudi | 45 | OG6_100682 | 2 | 625 | 1878 | 69602 | 8.14 | 0 | | | GO:0005737;GO:0005622 | cytoplasm;intracellular | GO:0004177;GO:0030145;GO:0008235 | aminopeptidase activity;manganese ion binding;metalloexopeptidase activity | GO:0019538;GO:0006508 | protein metabolic process;proteolysis | | | | | | | 3.4.11.1 (Leucyl aminopeptidase) | 3.4.11.1 (Leucyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1313500ORM17 leucyl aminopeptidase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1313500 OR M17 leucyl aminopeptidase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1319300 | PCHAS_1319300.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1062 | PCHAS_1319300 | DER1-like protein, putative | DER1-like protein, putative | 27795013 | A0A077TSN5 | 13 | PCHAS_13_v3:750,762..751,823(-) | PCHAS_13_v3:750762..751823(-) | PCHAS_13_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_160757 | 0 | 353 | 1062 | 41483 | 9.97 | 6 | NN: MKMCIFFYVLLFFIYINGI, HMM: MKMCIFFYVLLFFIYINGI | NN Sum: 4, NN D: .83, HMM Prob: .96 | | | | | | | GO:0020011 | apicoplast | | | GO:0030433 | ubiquitin-dependent ERAD pathway | | | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1319300ORDER1-like protein, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1319300 OR DER1-like protein, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1321400 | PCHAS_1321400.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2304 | PCHAS_1321400 | aminopeptidase P, putative | aminopeptidase P, putative | 3496903 | A0A077TTB9 | 13 | PCHAS_13_v3:833,157..835,460(+) | PCHAS_13_v3:833157..835460(+) | PCHAS_13_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_100896 | 0 | 767 | 2304 | 88764 | 6.64 | 0 | HMM: MRINSLIYANLLFTAIHAN, NN: MRINSLIYANLLFTAIHAN | NN Sum: 3, NN D: .61, HMM Prob: .76 | | | GO:0016787 | hydrolase activity | | | GO:0005829;GO:0020020 | cytosol;food vacuole | GO:0070006;GO:0042803 | metalloaminopeptidase activity;protein homodimerization activity | | | | 3.4.11.9 (Xaa-Pro aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1321400ORaminopeptidase P, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1321400 OR aminopeptidase P, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1324000 | PCHAS_1324000.1 | 9 | 9 | 1 | | | reverse | protein coding | No | 1236 | PCHAS_1324000 | signal peptide peptidase, putative | signal peptide peptidase, putative | 3485492 | A0A077TNW9 | 13 | PCHAS_13_v3:927,308..929,673(-) | PCHAS_13_v3:927308..929673(-) | PCHAS_13_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_102328 | 0 | 411 | 1236 | 47209 | 9.49 | 8 | | | GO:0016021 | integral component of membrane | GO:0004190 | aspartic-type endopeptidase activity | | | | | | | | | 3.4.21.89 (Signal peptidase I) | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1324000ORsignal peptide peptidase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1324000 OR signal peptide peptidase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1325000 | PCHAS_1325000.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1527 | PCHAS_1325000 | chabaupain 1 | chabaupain 1 | 3496342 | Q7Z1Y9 | 13 | PCHAS_13_v3:974,903..976,429(+) | PCHAS_13_v3:974903..976429(+) | PCHAS_13_v3 | Plasmodium chabaudi chabaudi | 159 | OG6_100116 | 1 | 508 | 1527 | 58249 | 5.64 | 1 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1325000ORchabaupain 1ANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1325000 OR chabaupain 1 AND Plasmodium chabaudi chabaudi |
|
PCHAS_1327400 | PCHAS_1327400.1 | 9 | 9 | 1 | | | forward | protein coding | No | 687 | PCHAS_1327400 | ubiquitin carboxyl-terminal hydrolase isozyme L3, putative | ubiquitin carboxyl-terminal hydrolase isozyme L3, putative | 27795024 | A0A077TTJ1 | 13 | PCHAS_13_v3:1,039,476..1,041,004(+) | PCHAS_13_v3:1039476..1041004(+) | PCHAS_13_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_101218 | 0 | 228 | 687 | 25652 | 4.88 | 0 | | | GO:0005622 | intracellular | GO:0004843 | thiol-dependent ubiquitin-specific protease activity | GO:0006511 | ubiquitin-dependent protein catabolic process | | | GO:0019784 | NEDD8-specific protease activity | GO:0000338 | protein deneddylation | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1327400ORubiquitin carboxyl-terminal hydrolase isozyme L3, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1327400 OR ubiquitin carboxyl-terminal hydrolase isozyme L3, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1332900 | PCHAS_1332900.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2112 | PCHAS_1332900 | ATP-dependent zinc metalloprotease FTSH, putative | ATP-dependent zinc metalloprotease FTSH, putative | 3490252 | A0A077TP47 | 13 | PCHAS_13_v3:1,229,891..1,232,002(-) | PCHAS_13_v3:1229891..1232002(-) | PCHAS_13_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_101196 | 0 | 703 | 2112 | 79390 | 9.51 | 0 | | | GO:0016020 | membrane | GO:0005524;GO:0004222 | ATP binding;metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.24.- (Metalloendopeptidases.) | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1332900ORATP-dependent zinc metalloprotease FTSH, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1332900 OR ATP-dependent zinc metalloprotease FTSH, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1333700 | PCHAS_1333700.1 | 13 | 13 | 1 | | | reverse | protein coding | No | 1122 | PCHAS_1333700 | plasmepsin VIII, putative | plasmepsin VIII, putative | 3497087 | A0A077TT23 | 13 | PCHAS_13_v3:1,256,835..1,259,323(-) | PCHAS_13_v3:1256835..1259323(-) | PCHAS_13_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_124673 | 0 | 373 | 1122 | 42178 | 9.20 | 0 | NN: MNIFFVFPLFLILNFIVLVKSL, HMM: MNIFFVFPLFLILNFIVLVKSL | NN Sum: 4, NN D: .77, HMM Prob: .97 | | | GO:0004190 | aspartic-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.17.4 (Gly-Xaa carboxypeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1333700ORplasmepsin VIII, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1333700 OR plasmepsin VIII, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1336400 | PCHAS_1336400.1 | 6 | 6 | 1 | | | reverse | protein coding | No | 657 | PCHAS_1336400 | derlin-1, putative | derlin-1, putative | 3486401 | A0A077TP77 | 13 | PCHAS_13_v3:1,385,000..1,386,317(-) | PCHAS_13_v3:1385000..1386317(-) | PCHAS_13_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_101672 | 0 | 218 | 657 | 25695 | 7.39 | 5 | HMM: MVQLGELLSNIPLITRVYLILSSILMVLCSLD, NN: MVQLGELLSNIPLITRVYLILSSILMVLCS | NN Sum: 2, NN D: .54, HMM Prob: .1 | | | | | | | GO:0005783;GO:0005789 | endoplasmic reticulum;endoplasmic reticulum membrane | | | GO:0030970;GO:0030433 | retrograde protein transport, ER to cytosol;ubiquitin-dependent ERAD pathway | | | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1336400ORderlin-1, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1336400 OR derlin-1, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1337400 | PCHAS_1337400.1 | 3 | 3 | 1 | | | forward | protein coding | No | 8976 | PCHAS_1337400 | acetyl-CoA carboxylase, putative | acetyl-CoA carboxylase, putative | 3485858 | A0A077TP86 | 13 | PCHAS_13_v3:1,419,243..1,428,639(+) | PCHAS_13_v3:1419243..1428639(+) | PCHAS_13_v3 | Plasmodium chabaudi chabaudi | 41 | OG6_101052 | 0 | 2991 | 8976 | 346110 | 6.98 | 0 | HMM: MISIFLSILLFVLIFENPTKSI, NN: MISIFLSILLFVLIFENPTKSI | NN Sum: 4, NN D: .84, HMM Prob: .97 | | | GO:0005524;GO:0016874;GO:0046872 | ATP binding;ligase activity;metal ion binding | | | GO:0020011 | apicoplast | | | | | 6.4.1.2 (Acetyl-CoA carboxylase) | 6.4.1.2 (Acetyl-CoA carboxylase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1337400ORacetyl-CoA carboxylase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1337400 OR acetyl-CoA carboxylase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1338700 | PCHAS_1338700.1 | 2 | 2 | 1 | | | forward | protein coding | No | 588 | PCHAS_1338700 | proteasome subunit beta type-2, putative | proteasome subunit beta type-2, putative | 27795041 | A0A077TT79 | 13 | PCHAS_13_v3:1,461,269..1,462,085(+) | PCHAS_13_v3:1461269..1462085(+) | PCHAS_13_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_102061 | 0 | 195 | 588 | 22880 | 7.90 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1338700ORproteasome subunit beta type-2, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1338700 OR proteasome subunit beta type-2, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1339700 | PCHAS_1339700.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 5436 | PCHAS_1339700 | conserved Plasmodium protein, unknown function | conserved Plasmodium protein, unknown function | 3492332 | A0A077TT92 | 13 | PCHAS_13_v3:1,491,373..1,497,124(-) | PCHAS_13_v3:1491373..1497124(-) | PCHAS_13_v3 | Plasmodium chabaudi chabaudi | 32 | OG6_532336 | 0 | 1811 | 5436 | 214972 | 8.85 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1339700ORconserved Plasmodium protein, unknown functionANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1339700 OR conserved Plasmodium protein, unknown function AND Plasmodium chabaudi chabaudi |
|
PCHAS_1340200 | PCHAS_1340200.1 | 3 | 3 | 1 | | | forward | protein coding | No | 3225 | PCHAS_1340200 | M1-family alanyl aminopeptidase, putative | M1-family alanyl aminopeptidase, putative | 3490874 | A0A077TT96 | 13 | PCHAS_13_v3:1,510,568..1,514,107(+) | PCHAS_13_v3:1510568..1514107(+) | PCHAS_13_v3 | Plasmodium chabaudi chabaudi | 37 | OG6_532703 | 0 | 1074 | 3225 | 130139 | 10.27 | 0 | | | | | GO:0008237;GO:0008270 | metallopeptidase activity;zinc ion binding | | | | | | | | | | 3.4.11.2 (Membrane alanyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1340200ORM1-family alanyl aminopeptidase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1340200 OR M1-family alanyl aminopeptidase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1343300 | PCHAS_1343300.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1596 | PCHAS_1343300 | plasmepsin V, putative | plasmepsin V, putative | 3490641 | A0A077TU65 | 13 | PCHAS_13_v3:1,606,624..1,608,219(+) | PCHAS_13_v3:1606624..1608219(+) | PCHAS_13_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_107443 | 0 | 531 | 1596 | 61540 | 7.61 | 1 | HMM: MGFSKLYKFVTYFIIINILVQANSE, NN: MGFSKLYKFVTYFIIINILVQANSE | NN Sum: 4, NN D: .7, HMM Prob: .48 | | | GO:0004190 | aspartic-type endopeptidase activity | GO:0006508 | proteolysis | GO:0005783 | endoplasmic reticulum | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1343300ORplasmepsin V, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1343300 OR plasmepsin V, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1347900 | PCHAS_1347900.1 | 1 | 1 | 1 | | | forward | protein coding | No | 813 | PCHAS_1347900 | proteasome subunit beta type-7, putative | proteasome subunit beta type-7, putative | 3491434 | A0A077TPI4 | 13 | PCHAS_13_v3:1,788,280..1,789,092(+) | PCHAS_13_v3:1788280..1789092(+) | PCHAS_13_v3 | Plasmodium chabaudi chabaudi | 43 | OG6_101382 | 0 | 270 | 813 | 29752 | 7.92 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1347900ORproteasome subunit beta type-7, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1347900 OR proteasome subunit beta type-7, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1350800 | PCHAS_1350800.1 | 2 | 2 | 1 | | | forward | protein coding | No | 555 | PCHAS_1350800 | signal peptidase complex catalytic subunit SEC11, putative | signal peptidase complex catalytic subunit SEC11, putative | 3495043 | A0A077TUA6 | 13 | PCHAS_13_v3:1,892,561..1,893,349(+) | PCHAS_13_v3:1892561..1893349(+) | PCHAS_13_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_100807 | 0 | 184 | 555 | 20850 | 6.79 | 3 | | | GO:0016021;GO:0016020 | integral component of membrane;membrane | GO:0008233;GO:0008236 | peptidase activity;serine-type peptidase activity | GO:0006465 | signal peptide processing | GO:0005783;GO:0005787 | endoplasmic reticulum;signal peptidase complex | | | | | 3.4.21.89 (Signal peptidase I) | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1350800ORsignal peptidase complex catalytic subunit SEC11, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1350800 OR signal peptidase complex catalytic subunit SEC11, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1355400 | PCHAS_1355400.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 2736 | PCHAS_1355400 | mitochondrial intermediate peptidase, putative | mitochondrial intermediate peptidase, putative | 3498166 | A0A077TPQ0 | 13 | PCHAS_13_v3:2,011,381..2,014,203(-) | PCHAS_13_v3:2011381..2014203(-) | PCHAS_13_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_102110 | 0 | 911 | 2736 | 107965 | 7.62 | 0 | | | | | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | GO:0005739 | mitochondrion | | | | | 3.4.24.59 (Mitochondrial intermediate peptidase) | 3.4.24.59 (Mitochondrial intermediate peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1355400ORmitochondrial intermediate peptidase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1355400 OR mitochondrial intermediate peptidase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1356700 | PCHAS_1356700.1 | 8 | 8 | 1 | | | reverse | protein coding | No | 1365 | PCHAS_1356700 | SprT-like domain-containing protein, putative | SprT-like domain-containing protein, putative | 3498543 | A0A077TTN6 | 13 | PCHAS_13_v3:2,059,424..2,061,489(-) | PCHAS_13_v3:2059424..2061489(-) | PCHAS_13_v3 | Plasmodium chabaudi chabaudi | 45 | OG6_104384 | 0 | 454 | 1365 | 53579 | 9.37 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1356700ORSprT-like domain-containing protein, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1356700 OR SprT-like domain-containing protein, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1362700 | PCHAS_1362700.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1572 | PCHAS_1362700 | rhomboid protease ROM6, putative | rhomboid protease ROM6, putative | 3499395 | A0A077TTS3 | 13 | PCHAS_13_v3:2,286,624..2,288,195(-) | PCHAS_13_v3:2286624..2288195(-) | PCHAS_13_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_124366 | 0 | 523 | 1572 | 62414 | 9.98 | 6 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | 3.4.21.105 (Rhomboid protease) | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1362700ORrhomboid protease ROM6, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1362700 OR rhomboid protease ROM6, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1367100 | PCHAS_1367100.1 | 2 | 2 | 1 | | | forward | protein coding | No | 729 | PCHAS_1367100 | peptidase, putative | peptidase, putative | 3495762 | A0A077TQ14 | 13 | PCHAS_13_v3:2,457,554..2,458,557(+) | PCHAS_13_v3:2457554..2458557(+) | PCHAS_13_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_110253 | 0 | 242 | 729 | 27732 | 7.47 | 4 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1367100ORpeptidase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1367100 OR peptidase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1370600 | PCHAS_1370600.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1254 | PCHAS_1370600 | lysophospholipase, putative | lysophospholipase, putative | 27795078 | A0A077TQ59 | 13 | PCHAS_13_v3:2,573,209..2,574,462(-) | PCHAS_13_v3:2573209..2574462(-) | PCHAS_13_v3 | Plasmodium chabaudi chabaudi | 434 | OG6_100231 | 27 | 417 | 1254 | 47667 | 5.62 | 1 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1370600ORlysophospholipase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1370600 OR lysophospholipase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1400600 | PCHAS_1400600.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1989 | PCHAS_1400600 | lysophospholipase, putative | lysophospholipase, putative | 27795083 | A0A077TU08 | 14 | PCHAS_14_v3:20,888..22,876(-) | PCHAS_14_v3:20888..22876(-) | PCHAS_14_v3 | Plasmodium chabaudi chabaudi | 434 | OG6_100231 | 27 | 662 | 1989 | 75261 | 4.45 | 0 | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1400600ORlysophospholipase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1400600 OR lysophospholipase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1401000 | PCHAS_1401000.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1230 | PCHAS_1401000 | lysophospholipase, putative | lysophospholipase, putative | 3486237 | A0A077TQ73 | 14 | PCHAS_14_v3:37,996..39,225(+) | PCHAS_14_v3:37996..39225(+) | PCHAS_14_v3 | Plasmodium chabaudi chabaudi | 434 | OG6_100231 | 27 | 409 | 1230 | 46732 | 6.86 | 0 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1401000ORlysophospholipase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1401000 OR lysophospholipase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1401451 | PCHAS_1401451.1 | 2 | 2 | 1 | | | forward | protein coding | Yes | 378 | PCHAS_1401451 | lysophospholipase, putative, pseudogene | lysophospholipase, putative, pseudogene | | | 14 | PCHAS_14_v3:57,340..57,718(+) | PCHAS_14_v3:57340..57718(+) | PCHAS_14_v3 | Plasmodium chabaudi chabaudi | 0 | N/A (orthology not determined because poor protein quality) | 0 | 125 | 378 | 14573 | 7.86 | 1 | | | | | | | | | | | | | | | | 2.7.11.1 (Non-specific serine/threonine protein kinase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1401451ORlysophospholipase, putative, pseudogeneANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1401451 OR lysophospholipase, putative, pseudogene AND Plasmodium chabaudi chabaudi |
|
PCHAS_1402100 | PCHAS_1402100.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1290 | PCHAS_1402100 | lysophospholipase, putative | lysophospholipase, putative | 3486939 | A0A077TU21 | 14 | PCHAS_14_v3:86,788..88,077(+) | PCHAS_14_v3:86788..88077(+) | PCHAS_14_v3 | Plasmodium chabaudi chabaudi | 434 | OG6_100231 | 27 | 429 | 1290 | 49137 | 8.96 | 0 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1402100ORlysophospholipase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1402100 OR lysophospholipase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1406000 | PCHAS_1406000.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 993 | PCHAS_1406000 | site-2 protease S2P, putative | site-2 protease S2P, putative | 3486641 | A0A077TQD2 | 14 | PCHAS_14_v3:251,866..252,989(-) | PCHAS_14_v3:251866..252989(-) | PCHAS_14_v3 | Plasmodium chabaudi chabaudi | 43 | OG6_107106 | 0 | 330 | 993 | 38873 | 7.60 | 8 | | | | | | | | | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1406000ORsite-2 protease S2P, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1406000 OR site-2 protease S2P, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1406800 | PCHAS_1406800.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1182 | PCHAS_1406800 | 26S protease regulatory subunit 10B, putative | 26S protease regulatory subunit 10B, putative | 3496077 | A0A077TQC8 | 14 | PCHAS_14_v3:275,159..276,340(-) | PCHAS_14_v3:275159..276340(-) | PCHAS_14_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_101751 | 0 | 393 | 1182 | 44736 | 9.23 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | GO:0008540 | proteasome regulatory particle, base subcomplex | | | GO:0070682;GO:0006511 | proteasome regulatory particle assembly;ubiquitin-dependent protein catabolic process | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1406800OR26S protease regulatory subunit 10B, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1406800 OR 26S protease regulatory subunit 10B, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1411900 | PCHAS_1411900.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 1263 | PCHAS_1411900 | 26S protease regulatory subunit 7, putative | 26S protease regulatory subunit 7, putative | 3492167 | A0A077TSF6 | 14 | PCHAS_14_v3:444,973..446,545(-) | PCHAS_14_v3:444973..446545(-) | PCHAS_14_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_101899 | 0 | 420 | 1263 | 46833 | 6.67 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | | | | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1411900OR26S protease regulatory subunit 7, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1411900 OR 26S protease regulatory subunit 7, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1412200 | PCHAS_1412200.1 | 1 | 1 | 1 | | | forward | protein coding | No | 3186 | PCHAS_1412200 | M1-family alanyl aminopeptidase, putative | M1-family alanyl aminopeptidase, putative | 3498162 | A0A077TV56 | 14 | PCHAS_14_v3:454,022..457,207(+) | PCHAS_14_v3:454022..457207(+) | PCHAS_14_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_106799 | 0 | 1061 | 3186 | 122264 | 7.20 | 0 | HMM: MVTKKLLSFNLFLIIVLTF, NN: MVTKKLLSFNLFLIIVLTFENLSFVKKN | NN Sum: 3, NN D: .58, HMM Prob: .85 | | | GO:0008237;GO:0008270 | metallopeptidase activity;zinc ion binding | | | | | | | | | | 3.4.11.2 (Membrane alanyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1412200ORM1-family alanyl aminopeptidase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1412200 OR M1-family alanyl aminopeptidase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1417300 | PCHAS_1417300.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1899 | PCHAS_1417300 | U4/U6.U5 tri-snRNP-associated protein 2, putative | U4/U6.U5 tri-snRNP-associated protein 2, putative | 3491621 | A0A077TQM6 | 14 | PCHAS_14_v3:636,187..638,085(+) | PCHAS_14_v3:636187..638085(+) | PCHAS_14_v3 | Plasmodium chabaudi chabaudi | 45 | OG6_102786 | 0 | 632 | 1899 | 72621 | 8.38 | 0 | | | | | GO:0036459;GO:0008270 | thiol-dependent ubiquitinyl hydrolase activity;zinc ion binding | GO:0016579 | protein deubiquitination | | | | | GO:0000398;GO:0000245 | mRNA splicing, via spliceosome;spliceosomal complex assembly | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1417300ORU4/U6.U5 tri-snRNP-associated protein 2, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1417300 OR U4/U6.U5 tri-snRNP-associated protein 2, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1419400 | PCHAS_1419400.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2199 | PCHAS_1419400 | ubiquitin carboxyl-terminal hydrolase MINDY, putative | ubiquitin carboxyl-terminal hydrolase MINDY, putative | 3493655 | A0A077TSN1 | 14 | PCHAS_14_v3:712,194..714,392(+) | PCHAS_14_v3:712194..714392(+) | PCHAS_14_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_102202 | 0 | 732 | 2199 | 85033 | 7.93 | 0 | | | | | GO:1990380;GO:0004843 | Lys48-specific deubiquitinase activity;thiol-dependent ubiquitin-specific protease activity | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1419400ORubiquitin carboxyl-terminal hydrolase MINDY, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1419400 OR ubiquitin carboxyl-terminal hydrolase MINDY, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1420500 | PCHAS_1420500.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 993 | PCHAS_1420500 | microsomal signal peptidase, putative | microsomal signal peptidase, putative | 3491679 | A0A077TQY9 | 14 | PCHAS_14_v3:754,761..755,753(-) | PCHAS_14_v3:754761..755753(-) | PCHAS_14_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_100609 | 0 | 330 | 993 | 38895 | 10.07 | 1 | | | GO:0016021;GO:0016020 | integral component of membrane;membrane | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1420500ORmicrosomal signal peptidase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1420500 OR microsomal signal peptidase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1427100 | PCHAS_1427100.1 | 12 | 12 | 1 | | | forward | protein coding | No | 1410 | PCHAS_1427100 | trypsin-like serine protease, putative | trypsin-like serine protease, putative | 3494245 | A0A077TUW7 | 14 | PCHAS_14_v3:972,545..975,627(+) | PCHAS_14_v3:972545..975627(+) | PCHAS_14_v3 | Plasmodium chabaudi chabaudi | 39 | OG6_100391 | 0 | 469 | 1410 | 53695 | 9.33 | 0 | | | | | GO:0005515;GO:0004252 | protein binding;serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.21.107 (Peptidase Do) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1427100ORtrypsin-like serine protease, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1427100 OR trypsin-like serine protease, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1427150 | PCHAS_1427150.1 | 5 | 5 | 1 | | | forward | protein coding | No | 876 | PCHAS_1427150 | GTP-binding protein YihA3, putative | GTP-binding protein YihA3, putative | 3493986 | A0A077TVN6 | 14 | PCHAS_14_v3:975,683..977,244(+) | PCHAS_14_v3:975683..977244(+) | PCHAS_14_v3 | Plasmodium chabaudi chabaudi | 131 | OG6_101142 | 2 | 291 | 876 | 34038 | 9.97 | 1 | HMM: MLNAKTSRIYCILFILFLCINTVLSW, NN: MLNAKTSRIYCILFILFLCINTVLSW | NN Sum: 4, NN D: .86, HMM Prob: .9 | | | GO:0005525 | GTP binding | | | GO:0020011;GO:0005829 | apicoplast;cytosol | GO:0003924;GO:0043022 | GTPase activity;ribosome binding | | | | 3.6.5.1 (Heterotrimeric G-protein GTPase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1427150ORGTP-binding protein YihA3, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1427150 OR GTP-binding protein YihA3, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1429600 | PCHAS_1429600.1 | 1 | 1 | 1 | | | forward | protein coding | No | 16473 | PCHAS_1429600 | peptidase family C50, putative | peptidase family C50, putative | 3495003 | A0A077TVQ4 | 14 | PCHAS_14_v3:1,075,014..1,091,486(+) | PCHAS_14_v3:1075014..1091486(+) | PCHAS_14_v3 | Plasmodium chabaudi chabaudi | 10 | OG6_103054 | 0 | 5490 | 16473 | 653178 | 9.18 | 5 | | | | | GO:0008233 | peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.49 (Separase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1429600ORpeptidase family C50, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1429600 OR peptidase family C50, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1435500 | PCHAS_1435500.1 | 3 | 3 | 1 | | | forward | protein coding | No | 1233 | PCHAS_1435500 | PPPDE peptidase domain-containing protein, putative | PPPDE peptidase domain-containing protein, putative | 3494978 | A0A077TRB1 | 14 | PCHAS_14_v3:1,253,225..1,254,761(+) | PCHAS_14_v3:1253225..1254761(+) | PCHAS_14_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_102579 | 0 | 410 | 1233 | 47251 | 5.72 | 1 | | | | | | | | | | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1435500ORPPPDE peptidase domain-containing protein, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1435500 OR PPPDE peptidase domain-containing protein, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1443600 | PCHAS_1443600.1 | 6 | 6 | 1 | | | forward | protein coding | No | 1155 | PCHAS_1443600 | ataxin-3, putative | ataxin-3, putative | 3496845 | A0A077TRI5 | 14 | PCHAS_14_v3:1,572,254..1,574,121(+) | PCHAS_14_v3:1572254..1574121(+) | PCHAS_14_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_104644 | 0 | 384 | 1155 | 45160 | 6.20 | 0 | | | | | GO:0005515;GO:0004843 | protein binding;thiol-dependent ubiquitin-specific protease activity | GO:0016579 | protein deubiquitination | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1443600ORataxin-3, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1443600 OR ataxin-3, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1447300 | PCHAS_1447300.1 | 5 | 5 | 1 | | | reverse | protein coding | No | 624 | PCHAS_1447300 | ATP-dependent protease subunit ClpQ, putative | ATP-dependent protease subunit ClpQ, putative | 3492276 | A0A077TRM6 | 14 | PCHAS_14_v3:1,729,777..1,730,934(-) | PCHAS_14_v3:1729777..1730934(-) | PCHAS_14_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_107204 | 0 | 207 | 624 | 22848 | 8.48 | 0 | | | GO:0009376;GO:0005839 | HslUV protease complex;proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0006508;GO:0051603 | proteolysis;proteolysis involved in cellular protein catabolic process | | | | | | | 3.4.25.2 (HslU--HslV peptidase) | 3.4.25.2 (HslU--HslV peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1447300ORATP-dependent protease subunit ClpQ, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1447300 OR ATP-dependent protease subunit ClpQ, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1450800 | PCHAS_1450800.1 | 3 | 3 | 1 | | | forward | protein coding | No | 2907 | PCHAS_1450800 | sentrin-specific protease 1, putative | sentrin-specific protease 1, putative | 3496199 | A0A077TTI1 | 14 | PCHAS_14_v3:1,867,333..1,870,413(+) | PCHAS_14_v3:1867333..1870413(+) | PCHAS_14_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_101235 | 0 | 968 | 2907 | 113507 | 8.61 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.68 (Ulp1 peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1450800ORsentrin-specific protease 1, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1450800 OR sentrin-specific protease 1, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1451300 | PCHAS_1451300.1 | 6 | 6 | 1 | | | reverse | protein coding | No | 1785 | PCHAS_1451300 | microgamete surface protein MiGS, putative | microgamete surface protein MiGS, putative | 3497308 | A0A077TTI6 | 14 | PCHAS_14_v3:1,892,543..1,894,898(-) | PCHAS_14_v3:1892543..1894898(-) | PCHAS_14_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_127652 | 0 | 594 | 1785 | 65973 | 6.51 | 1 | NN: MSQRYIVLLHCVFLLLSLFKTDCYSL, HMM: MSQRYIVLLHCVFLLLSLFKTDCY | NN Sum: 4, NN D: .79, HMM Prob: .97 | | | | | | | GO:0009986;GO:0044310 | cell surface;osmiophilic body | | | | | | 3.4.23.3 (Gastricsin) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1451300ORmicrogamete surface protein MiGS, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1451300 OR microgamete surface protein MiGS, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1456400 | PCHAS_1456400.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2589 | PCHAS_1456400 | ATP-dependent zinc metalloprotease FTSH 1, putative | ATP-dependent zinc metalloprotease FTSH 1, putative | 3496917 | A0A077TRV9 | 14 | PCHAS_14_v3:2,071,445..2,074,033(+) | PCHAS_14_v3:2071445..2074033(+) | PCHAS_14_v3 | Plasmodium chabaudi chabaudi | 91 | OG6_100384 | 1 | 862 | 2589 | 97957 | 9.08 | 1 | | | GO:0016020 | membrane | GO:0005524;GO:0004222 | ATP binding;metalloendopeptidase activity | GO:0006508 | proteolysis | GO:0020011;GO:0005739 | apicoplast;mitochondrion | GO:0005524;GO:0004176;GO:0004222 | ATP binding;ATP-dependent peptidase activity;metalloendopeptidase activity | GO:0006508;GO:0042493 | proteolysis;response to drug | 3.4.24.- (Metalloendopeptidases.) | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1456400ORATP-dependent zinc metalloprotease FTSH 1, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1456400 OR ATP-dependent zinc metalloprotease FTSH 1, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1456700 | PCHAS_1456700.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1557 | PCHAS_1456700 | 3-hydroxyisobutyryl-CoA hydrolase, putative | 3-hydroxyisobutyryl-CoA hydrolase, putative | 3497714 | A0A077TRS6 | 14 | PCHAS_14_v3:2,098,667..2,100,223(+) | PCHAS_14_v3:2098667..2100223(+) | PCHAS_14_v3 | Plasmodium chabaudi chabaudi | 49 | OG6_102025 | 0 | 518 | 1557 | 61073 | 8.36 | 0 | | | | | GO:0003860 | 3-hydroxyisobutyryl-CoA hydrolase activity | | | | | | | | | 3.1.2.4 (3-hydroxyisobutyryl-CoA hydrolase) | 3.1.2.4 (3-hydroxyisobutyryl-CoA hydrolase) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1456700OR3-hydroxyisobutyryl-CoA hydrolase, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1456700 OR 3-hydroxyisobutyryl-CoA hydrolase, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1463000 | PCHAS_1463000.1 | 8 | 8 | 1 | | | forward | protein coding | No | 1680 | PCHAS_1463000 | dipeptidyl aminopeptidase 2, putative | dipeptidyl aminopeptidase 2, putative | 3494316 | A0A077TVR9 | 14 | PCHAS_14_v3:2,293,719..2,296,166(+) | PCHAS_14_v3:2293719..2296166(+) | PCHAS_14_v3 | Plasmodium chabaudi chabaudi | 90 | OG6_103622 | 1 | 559 | 1680 | 64755 | 7.60 | 0 | HMM: MKYVLFFLLNVFLIGLAKGD, NN: MKYVLFFLLNVFLIGLAKGD | NN Sum: 4, NN D: .88, HMM Prob: 1 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | GO:0044310 | osmiophilic body | | | | | | 3.4.14.1 (Dipeptidyl-peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1463000ORdipeptidyl aminopeptidase 2, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1463000 OR dipeptidyl aminopeptidase 2, putative AND Plasmodium chabaudi chabaudi |
|
PCHAS_1464100 | PCHAS_1464100.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1266 | PCHAS_1464100 | 26S protease regulatory subunit 8, putative | 26S protease regulatory subunit 8, putative | 3494129 | A0A077TWN9 | 14 | PCHAS_14_v3:2,323,057..2,324,322(-) | PCHAS_14_v3:2323057..2324322(-) | PCHAS_14_v3 | Plasmodium chabaudi chabaudi | 44 | OG6_101513 | 0 | 421 | 1266 | 47827 | 6.80 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | GO:0008540 | proteasome regulatory particle, base subcomplex | | | GO:0070682;GO:0043161 | proteasome regulatory particle assembly;proteasome-mediated ubiquitin-dependent protein catabolic process | | 3.6.4.3 (Transferred entry: 5.6.1.1) | https://pubmed.ncbi.nlm.nih.gov/?term=PCHAS_1464100OR26S protease regulatory subunit 8, putativeANDPlasmodium chabaudi chabaudi | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PCHAS_1464100 OR 26S protease regulatory subunit 8, putative AND Plasmodium chabaudi chabaudi |