|
PF3D7_0102400 | PF3D7_0102400.1 | 1 | 1 | 1 | | | reverse | protein coding | Yes | 1152 | PF3D7_0102400 | lysophospholipase, putative, pseudogene | lysophospholipase, putative, pseudogene | | | 1 | Pf3D7_01_v3:107,197..108,348(-) | Pf3D7_01_v3:107197..108348(-) | Pf3D7_01_v3 | Plasmodium falciparum 3D7 | 0 | N/A (orthology not determined because poor protein quality) | 0 | 383 | 1152 | 44414 | 7.13 | 0 | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | 2.7.11.1 (Non-specific serine/threonine protein kinase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0102400ORlysophospholipase, putative, pseudogeneANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0102400 OR lysophospholipase, putative, pseudogene AND Plasmodium falciparum 3D7 |
|
PF3D7_0103400 | PF3D7_0103400.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 4863 | PF3D7_0103400 | zinc-carboxypeptidase, putative | zinc-carboxypeptidase, putative | | | 1 | Pf3D7_01_v3:147,915..152,777(-) | Pf3D7_01_v3:147915..152777(-) | Pf3D7_01_v3 | Plasmodium falciparum 3D7 | 36 | OG6_101273 | 0 | 1620 | 4863 | 191961 | 8.79 | 0 | | | | | | | | | | | | | | | 3.4.17.10 (Carboxypeptidase E) | 3.4.17.10 (Carboxypeptidase E) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0103400ORzinc-carboxypeptidase, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0103400 OR zinc-carboxypeptidase, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_0104300 | PF3D7_0104300.1 | 3 | 3 | 1 | | | forward | protein coding | No | 10500 | PF3D7_0104300 | ubiquitin carboxyl-terminal hydrolase 1, putative | ubiquitin carboxyl-terminal hydrolase 1, putative | | | 1 | Pf3D7_01_v3:190,269..201,230(+) | Pf3D7_01_v3:190269..201230(+) | Pf3D7_01_v3 | Plasmodium falciparum 3D7 | 38 | OG6_129339 | 0 | 3499 | 10500 | 416036 | 8.74 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | | | GO:0005634 | nucleus | | | GO:0006897;GO:0042493;GO:0006511 | endocytosis;response to drug;ubiquitin-dependent protein catabolic process | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0104300ORubiquitin carboxyl-terminal hydrolase 1, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0104300 OR ubiquitin carboxyl-terminal hydrolase 1, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_0108000 | PF3D7_0108000.1 | 4 | 4 | 1 | | | reverse | protein coding | No | 657 | PF3D7_0108000 | proteasome subunit beta type-3, putative | proteasome subunit beta type-3, putative | | | 1 | Pf3D7_01_v3:328,431..329,558(-) | Pf3D7_01_v3:328431..329558(-) | Pf3D7_01_v3 | Plasmodium falciparum 3D7 | 45 | OG6_101970 | 0 | 218 | 657 | 24509 | 4.78 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | GO:0019774 | proteasome core complex, beta-subunit complex | GO:0004175 | endopeptidase activity | GO:0006511 | ubiquitin-dependent protein catabolic process | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0108000ORproteasome subunit beta type-3, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0108000 OR proteasome subunit beta type-3, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_0207300 | PF3D7_0207300.1 | 5 | 5 | 1 | | | reverse | protein coding | No | 2040 | PF3D7_0207300 | serine repeat antigen 8 | serine repeat antigen 8 | 812665 | O96162 | 2 | Pf3D7_02_v3:290,168..292,703(-) | Pf3D7_02_v3:290168..292703(-) | Pf3D7_02_v3 | Plasmodium falciparum 3D7 | 372 | OG6_126098 | 8 | 679 | 2040 | 79356 | 7.96 | 0 | | | GO:0005739 | mitochondrion | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0207300ORserine repeat antigen 8ANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0207300 OR serine repeat antigen 8 AND Plasmodium falciparum 3D7 |
|
PF3D7_0207400 | PF3D7_0207400.1 | 4 | 4 | 1 | | | reverse | protein coding | No | 2841 | PF3D7_0207400 | serine repeat antigen 7 | serine repeat antigen 7 | 812666 | O96163 | 2 | Pf3D7_02_v3:294,273..297,616(-) | Pf3D7_02_v3:294273..297616(-) | Pf3D7_02_v3 | Plasmodium falciparum 3D7 | 372 | OG6_126098 | 8 | 946 | 2841 | 109637 | 5.57 | 1 | NN: MVYRLFIILVLYVICCTNVIVGQ, HMM: MVYRLFIILVLYVICCTNVIVGQ | NN Sum: 4, NN D: .82, HMM Prob: .97 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | GO:0008234 | cysteine-type peptidase activity | GO:0002377;GO:0006508;GO:0050776 | immunoglobulin production;proteolysis;regulation of immune response | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0207400ORserine repeat antigen 7ANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0207400 OR serine repeat antigen 7 AND Plasmodium falciparum 3D7 |
|
PF3D7_0207500 | PF3D7_0207500.1 | 4 | 4 | 1 | | | reverse | protein coding | No | 3096 | PF3D7_0207500 | serine repeat antigen 6 | serine repeat antigen 6 | 812667 | Q9TY96 | 2 | Pf3D7_02_v3:298,897..302,564(-) | Pf3D7_02_v3:298897..302564(-) | Pf3D7_02_v3 | Plasmodium falciparum 3D7 | 372 | OG6_126098 | 8 | 1031 | 3096 | 118834 | 6.21 | 0 | NN: MICPIFFLYIINVLFTQ, HMM: MICPIFFLYIINVLFTQ | NN Sum: 4, NN D: .68, HMM Prob: .17 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | GO:0005634;GO:0020003 | nucleus;symbiont-containing vacuole | GO:0008234 | cysteine-type peptidase activity | GO:0035891;GO:0002377;GO:0006508;GO:0050776 | exit from host cell;immunoglobulin production;proteolysis;regulation of immune response | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0207500ORserine repeat antigen 6ANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0207500 OR serine repeat antigen 6 AND Plasmodium falciparum 3D7 |
|
PF3D7_0207600 | PF3D7_0207600.1 | 4 | 4 | 1 | | | reverse | protein coding | No | 2994 | PF3D7_0207600 | serine repeat antigen 5 | serine repeat antigen 5 | 812668 | Q9TY95 | 2 | Pf3D7_02_v3:303,593..307,027(-) | Pf3D7_02_v3:303593..307027(-) | Pf3D7_02_v3 | Plasmodium falciparum 3D7 | 372 | OG6_126098 | 8 | 997 | 2994 | 111767 | 5.06 | 0 | HMM: MKSYISLFFILCVIFNKNVIKCTGE, NN: MKSYISLFFILCVIFNKNVIKCT | NN Sum: 2, NN D: .53, HMM Prob: .49 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | GO:1903561;GO:0005634;GO:0020003 | extracellular vesicle;nucleus;symbiont-containing vacuole | GO:0008234;GO:0005515 | cysteine-type peptidase activity;protein binding | GO:0035891;GO:0002377;GO:0006508;GO:0050776 | exit from host cell;immunoglobulin production;proteolysis;regulation of immune response | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0207600ORserine repeat antigen 5ANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0207600 OR serine repeat antigen 5 AND Plasmodium falciparum 3D7 |
|
PF3D7_0207700 | PF3D7_0207700.1 | 4 | 4 | 1 | | | reverse | protein coding | No | 2889 | PF3D7_0207700 | serine repeat antigen 4 | serine repeat antigen 4 | 812669 | O96164 | 2 | Pf3D7_02_v3:308,847..312,155(-) | Pf3D7_02_v3:308847..312155(-) | Pf3D7_02_v3 | Plasmodium falciparum 3D7 | 372 | OG6_126098 | 8 | 962 | 2889 | 108680 | 5.51 | 0 | HMM: MKIHIFLIATIYVLFSEKLIKWTTAS, NN: MKIHIFLIATIYVLFSEKLIKWTTAS | NN Sum: 4, NN D: .61, HMM Prob: .54 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | GO:0020003 | symbiont-containing vacuole | GO:0008234 | cysteine-type peptidase activity | GO:0002377;GO:0006508;GO:0050776 | immunoglobulin production;proteolysis;regulation of immune response | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0207700ORserine repeat antigen 4ANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0207700 OR serine repeat antigen 4 AND Plasmodium falciparum 3D7 |
|
PF3D7_0207800 | PF3D7_0207800.1 | 4 | 4 | 1 | | | reverse | protein coding | No | 2793 | PF3D7_0207800 | serine repeat antigen 3 | serine repeat antigen 3 | 812670 | O96165 | 2 | Pf3D7_02_v3:313,449..316,741(-) | Pf3D7_02_v3:313449..316741(-) | Pf3D7_02_v3 | Plasmodium falciparum 3D7 | 372 | OG6_126098 | 8 | 930 | 2793 | 105422 | 7.15 | 0 | NN: MKFSISLFLILCVLFCKNDIKCT, HMM: MKFSISLFLILCVLFCK | NN Sum: 4, NN D: .62, HMM Prob: .98 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | GO:0008234 | cysteine-type peptidase activity | GO:0002377;GO:0006508;GO:0050776 | immunoglobulin production;proteolysis;regulation of immune response | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0207800ORserine repeat antigen 3ANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0207800 OR serine repeat antigen 3 AND Plasmodium falciparum 3D7 |
|
PF3D7_0207900 | PF3D7_0207900.1 | 4 | 4 | 1 | | | reverse | protein coding | No | 3318 | PF3D7_0207900 | serine repeat antigen 2 | serine repeat antigen 2 | 812671 | O96166 | 2 | Pf3D7_02_v3:317,596..321,310(-) | Pf3D7_02_v3:317596..321310(-) | Pf3D7_02_v3 | Plasmodium falciparum 3D7 | 372 | OG6_126098 | 8 | 1105 | 3318 | 124894 | 6.75 | 0 | NN: MKFHISFFLILYIVFFKNTIKSE, HMM: MKFHISFFLILYIVFFKNTIKSE | NN Sum: 4, NN D: .71, HMM Prob: .6 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | GO:0008234 | cysteine-type peptidase activity | GO:0002377;GO:0006508;GO:0050776 | immunoglobulin production;proteolysis;regulation of immune response | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0207900ORserine repeat antigen 2ANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0207900 OR serine repeat antigen 2 AND Plasmodium falciparum 3D7 |
|
PF3D7_0208000 | PF3D7_0208000.1 | 4 | 4 | 1 | | | reverse | protein coding | No | 2985 | PF3D7_0208000 | serine repeat antigen 1 | serine repeat antigen 1 | 812672 | O96167 | 2 | Pf3D7_02_v3:322,338..325,723(-) | Pf3D7_02_v3:322338..325723(-) | Pf3D7_02_v3 | Plasmodium falciparum 3D7 | 372 | OG6_126098 | 8 | 994 | 2985 | 115494 | 8.10 | 0 | HMM: MKFFIPYVYIICVIFIINVIRTRGE, NN: MKFFIPYVYIICVIFIINVIRTRGE | NN Sum: 4, NN D: .66, HMM Prob: .37 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | GO:0008234 | cysteine-type peptidase activity | GO:0002377;GO:0006508;GO:0050776 | immunoglobulin production;proteolysis;regulation of immune response | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0208000ORserine repeat antigen 1ANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0208000 OR serine repeat antigen 1 AND Plasmodium falciparum 3D7 |
|
PF3D7_0214800 | PF3D7_0214800.1 | 2 | 2 | 1 | | | forward | protein coding | No | 4116 | PF3D7_0214800 | conserved Plasmodium membrane protein, unknown function | conserved Plasmodium membrane protein, unknown function | 812735 | O96228 | 2 | Pf3D7_02_v3:605,045..609,325(+) | Pf3D7_02_v3:605045..609325(+) | Pf3D7_02_v3 | Plasmodium falciparum 3D7 | 20 | OG6_532626 | 0 | 1371 | 4116 | 160633 | 8.59 | 11 | | | | | | | | | GO:0016021 | integral component of membrane | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0214800ORconserved Plasmodium membrane protein, unknown functionANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0214800 OR conserved Plasmodium membrane protein, unknown function AND Plasmodium falciparum 3D7 |
|
PF3D7_0307400 | PF3D7_0307400.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1113 | PF3D7_0307400 | ATP-dependent Clp protease proteolytic subunit | ATP-dependent Clp protease proteolytic subunit | 814391 | O97252 | 3 | Pf3D7_03_v3:321,050..322,162(-) | Pf3D7_03_v3:321050..322162(-) | Pf3D7_03_v3 | Plasmodium falciparum 3D7 | 44 | OG6_100939 | 0 | 370 | 1113 | 43320 | 9.98 | 0 | HMM: MIYLFLFLFLILLKNKKIQTK, NN: MIYLFLFLFLILLKNKKIQTK | NN Sum: 4, NN D: .67, HMM Prob: .47 | | | GO:0004252 | serine-type endopeptidase activity | | | GO:0020011;GO:0009368 | apicoplast;endopeptidase Clp complex | GO:0004176;GO:0016787 | ATP-dependent peptidase activity;hydrolase activity | GO:0006508;GO:0042493 | proteolysis;response to drug | 3.4.21.92 (Endopeptidase Clp) | 3.4.21.92 (Endopeptidase Clp) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0307400ORATP-dependent Clp protease proteolytic subunitANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0307400 OR ATP-dependent Clp protease proteolytic subunit AND Plasmodium falciparum 3D7 |
|
PF3D7_0311700 | PF3D7_0311700.1 | 15 | 15 | 1 | | | forward | protein coding | No | 1299 | PF3D7_0311700 | plasmepsin VI | plasmepsin VI | 814432 | O77350 | 3 | Pf3D7_03_v3:502,698..505,848(+) | Pf3D7_03_v3:502698..505848(+) | Pf3D7_03_v3 | Plasmodium falciparum 3D7 | 155 | OG6_100536 | 4 | 432 | 1299 | 49432 | 7.75 | 1 | NN: MPYFHIFLYILIFCVLVHICPIHTL, HMM: MPYFHIFLYILIFCVLVHICPIHTL | NN Sum: 4, NN D: .75, HMM Prob: .88 | | | | | | | GO:0044310 | osmiophilic body | GO:0004190 | aspartic-type endopeptidase activity | GO:0006508 | proteolysis | 3.4.23.- (Aspartic endopeptidases.) | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0311700ORplasmepsin VIANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0311700 OR plasmepsin VI AND Plasmodium falciparum 3D7 |
|
PF3D7_0314200 | PF3D7_0314200.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 4158 | PF3D7_0314200 | conserved Plasmodium protein, unknown function | conserved Plasmodium protein, unknown function | 814456 | O97275 | 3 | Pf3D7_03_v3:572,666..576,823(-) | Pf3D7_03_v3:572666..576823(-) | Pf3D7_03_v3 | Plasmodium falciparum 3D7 | 42 | OG6_533302 | 0 | 1385 | 4158 | 167647 | 9.92 | 1 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0314200ORconserved Plasmodium protein, unknown functionANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0314200 OR conserved Plasmodium protein, unknown function AND Plasmodium falciparum 3D7 |
|
PF3D7_0314300 | PF3D7_0314300.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1359 | PF3D7_0314300 | DER1-like protein | DER1-like protein | | | 3 | Pf3D7_03_v3:577,008..578,366(-) | Pf3D7_03_v3:577008..578366(-) | Pf3D7_03_v3 | Plasmodium falciparum 3D7 | 87 | OG6_130104 | 1 | 452 | 1359 | 55218 | 10.08 | 4 | NN: MLFYKLICLFLSFIIIIIHGK, HMM: MLFYKLICLFLSFIIIIIHGK | NN Sum: 4, NN D: .84, HMM Prob: .91 | | | | | | | GO:0020011;GO:0016021 | apicoplast;integral component of membrane | | | GO:0030433 | ubiquitin-dependent ERAD pathway | | | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0314300ORDER1-like proteinANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0314300 OR DER1-like protein AND Plasmodium falciparum 3D7 |
|
PF3D7_0317000 | PF3D7_0317000.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 759 | PF3D7_0317000 | proteasome subunit alpha type-3, putative | proteasome subunit alpha type-3, putative | 814484 | O77396 | 3 | Pf3D7_03_v3:682,795..683,685(-) | Pf3D7_03_v3:682795..683685(-) | Pf3D7_03_v3 | Plasmodium falciparum 3D7 | 44 | OG6_102011 | 0 | 252 | 759 | 29289 | 6.85 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | GO:0005839 | proteasome core complex | GO:0004175 | endopeptidase activity | GO:0006511 | ubiquitin-dependent protein catabolic process | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0317000ORproteasome subunit alpha type-3, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0317000 OR proteasome subunit alpha type-3, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_0317800 | PF3D7_0317800.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 678 | PF3D7_0317800 | 26S proteasome non-ATPase regulatory subunit 9, putative | 26S proteasome non-ATPase regulatory subunit 9, putative | 814492 | O77379 | 3 | Pf3D7_03_v3:738,205..738,882(-) | Pf3D7_03_v3:738205..738882(-) | Pf3D7_03_v3 | Plasmodium falciparum 3D7 | 44 | OG6_102356 | 0 | 225 | 678 | 26466 | 6.87 | 0 | | | | | GO:0005515 | protein binding | | | GO:0005838 | proteasome regulatory particle | | | GO:0070682;GO:0006511 | proteasome regulatory particle assembly;ubiquitin-dependent protein catabolic process | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0317800OR26S proteasome non-ATPase regulatory subunit 9, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0317800 OR 26S proteasome non-ATPase regulatory subunit 9, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_0320700 | PF3D7_0320700.1 | 8 | 8 | 1 | | | forward | protein coding | No | 540 | PF3D7_0320700 | signal peptidase complex subunit 2 | signal peptidase complex subunit 2 | 814521 | Q9NFA0 | 3 | Pf3D7_03_v3:865,014..866,420(+) | Pf3D7_03_v3:865014..866420(+) | Pf3D7_03_v3 | Plasmodium falciparum 3D7 | 44 | OG6_137524 | 0 | 179 | 540 | 21011 | 9.42 | 2 | | | GO:0016021;GO:0005787 | integral component of membrane;signal peptidase complex | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | GO:0005783;GO:0005787 | endoplasmic reticulum;signal peptidase complex | GO:0005515 | protein binding | GO:0045047;GO:0006465 | protein targeting to ER;signal peptide processing | 3.4.21.89 (Signal peptidase I) | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0320700ORsignal peptidase complex subunit 2ANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0320700 OR signal peptidase complex subunit 2 AND Plasmodium falciparum 3D7 |
|
PF3D7_0321500 | PF3D7_0321500.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3225 | PF3D7_0321500 | peptidase, putative | peptidase, putative | 814529 | O97289 | 3 | Pf3D7_03_v3:896,546..899,770(-) | Pf3D7_03_v3:896546..899770(-) | Pf3D7_03_v3 | Plasmodium falciparum 3D7 | 45 | OG6_102438 | 0 | 1074 | 3225 | 125892 | 6.58 | 0 | | | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | GO:0005634 | nucleus | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).);3.4.21.26 (Prolyl oligopeptidase) | 3.4.19.1 (Acylaminoacyl-peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0321500ORpeptidase, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0321500 OR peptidase, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_0403500 | PF3D7_0403500.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1203 | PF3D7_0403500 | ubiquitin specific protease, putative | ubiquitin specific protease, putative | 812487 | Q8I1Z5 | 4 | Pf3D7_04_v3:195,543..196,745(+) | Pf3D7_04_v3:195543..196745(+) | Pf3D7_04_v3 | Plasmodium falciparum 3D7 | 44 | OG6_208753 | 0 | 400 | 1203 | 47264 | 8.94 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | GO:0000502 | proteasome complex | | | GO:0016579 | protein deubiquitination | 3.1.2.15 (Deleted entry);3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0403500ORubiquitin specific protease, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0403500 OR ubiquitin specific protease, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_0403800 | PF3D7_0403800.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 2205 | PF3D7_0403800 | alpha/beta hydrolase, putative | alpha/beta hydrolase, putative | 812465 | Q8I1Z1 | 4 | Pf3D7_04_v3:211,515..213,854(-) | Pf3D7_04_v3:211515..213854(-) | Pf3D7_04_v3 | Plasmodium falciparum 3D7 | 135 | OG6_100915 | 2 | 734 | 2205 | 83376 | 9.86 | 0 | | | | | GO:0016787 | hydrolase activity | | | | | | | | | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0403800ORalpha/beta hydrolase, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0403800 OR alpha/beta hydrolase, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_0404700 | PF3D7_0404700.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 2820 | PF3D7_0404700 | dipeptidyl aminopeptidase 3 | dipeptidyl aminopeptidase 3 | 812449 | Q8I1Y2 | 4 | Pf3D7_04_v3:260,454..263,418(-) | Pf3D7_04_v3:260454..263418(-) | Pf3D7_04_v3 | Plasmodium falciparum 3D7 | 38 | OG6_533572 | 0 | 939 | 2820 | 110478 | 5.24 | 0 | NN: MILIFQLFLINILFLNFIKCD, HMM: MILIFQLFLINILFLNFIKCD | NN Sum: 4, NN D: .74, HMM Prob: .79 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | GO:0045177;GO:0044164;GO:0020005 | apical part of cell;host cell cytosol;symbiont-containing vacuole membrane | GO:0004177;GO:0008234 | aminopeptidase activity;cysteine-type peptidase activity | GO:0044409 | entry into host | 3.4.14.4 (Dipeptidyl-peptidase III) | 3.4.14.4 (Dipeptidyl-peptidase III) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0404700ORdipeptidyl aminopeptidase 3ANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0404700 OR dipeptidyl aminopeptidase 3 AND Plasmodium falciparum 3D7 |
|
PF3D7_0408900 | PF3D7_0408900.1 | 6 | 5 | 2 | | | forward | protein coding | No | 2082 | PF3D7_0408900 | tRNA N6-adenosine threonylcarbamoyltransferase | tRNA N6-adenosine threonylcarbamoyltransferase | 812544 | Q9U0J7 | 4 | Pf3D7_04_v3:424,300..427,194(+) | Pf3D7_04_v3:424300..427194(+) | Pf3D7_04_v3 | Plasmodium falciparum 3D7 | 87 | OG6_100288 | 1 | 693 | 2082 | 80849 | 9.62 | 1 | NN: MKNVSTHIAIYLFCYIFLIHYLCYTF, HMM: MKNVSTHIAIYLFCYIFLIHYLCYTF | NN Sum: 3, NN D: .61, HMM Prob: .04 | | | | | | | GO:0020011 | apicoplast | GO:0003677;GO:0005515 | DNA binding;protein binding | | | 2.3.1.234 (N(6)-L-threonylcarbamoyladenine synthase);2.6.99.4 (Transferred entry: 2.3.1.234) | 2.3.1.234 (N(6)-L-threonylcarbamoyladenine synthase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0408900ORtRNA N6-adenosine threonylcarbamoyltransferaseANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0408900 OR tRNA N6-adenosine threonylcarbamoyltransferase AND Plasmodium falciparum 3D7 |
|
PF3D7_0413600 | PF3D7_0413600.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 1179 | PF3D7_0413600 | 26S protease regulatory subunit 6B, putative | 26S protease regulatory subunit 6B, putative | 812570 | Q8I1V1 | 4 | Pf3D7_04_v3:616,914..618,350(-) | Pf3D7_04_v3:616914..618350(-) | Pf3D7_04_v3 | Plasmodium falciparum 3D7 | 42 | OG6_101965 | 0 | 392 | 1179 | 44666 | 7.60 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | GO:0005634;GO:0008540 | nucleus;proteasome regulatory particle, base subcomplex | GO:0016887 | ATPase activity | GO:0070682;GO:0006511 | proteasome regulatory particle assembly;ubiquitin-dependent protein catabolic process | 3.6.4.8 (Transferred entry: 5.6.1.5) | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0413600OR26S protease regulatory subunit 6B, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0413600 OR 26S protease regulatory subunit 6B, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_0413900 | PF3D7_0413900.1 | 4 | 4 | 1 | | | reverse | protein coding | No | 2562 | PF3D7_0413900 | ubiquitin carboxyl-terminal hydrolase 13, putative | ubiquitin carboxyl-terminal hydrolase 13, putative | 812575 | Q8I1U8 | 4 | Pf3D7_04_v3:623,168..626,226(-) | Pf3D7_04_v3:623168..626226(-) | Pf3D7_04_v3 | Plasmodium falciparum 3D7 | 42 | OG6_101380 | 0 | 853 | 2562 | 98470 | 4.97 | 0 | | | | | GO:0005515;GO:0004843;GO:0036459;GO:0008270 | protein binding;thiol-dependent ubiquitin-specific protease activity;thiol-dependent ubiquitinyl hydrolase activity;zinc ion binding | GO:0016579 | protein deubiquitination | | | GO:0004843;GO:0043130;GO:0101005 | thiol-dependent ubiquitin-specific protease activity;ubiquitin binding;ubiquitinyl hydrolase activity | GO:0006511 | ubiquitin-dependent protein catabolic process | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0413900ORubiquitin carboxyl-terminal hydrolase 13, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0413900 OR ubiquitin carboxyl-terminal hydrolase 13, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_0419300 | PF3D7_0419300.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 1041 | PF3D7_0419300 | conserved Plasmodium protein, unknown function | conserved Plasmodium protein, unknown function | 812493 | Q8I1P4 | 4 | Pf3D7_04_v3:855,898..857,049(-) | Pf3D7_04_v3:855898..857049(-) | Pf3D7_04_v3 | Plasmodium falciparum 3D7 | 43 | OG6_174320 | 0 | 346 | 1041 | 41784 | 9.22 | 0 | | | GO:0005737;GO:0031410;GO:0016020 | cytoplasm;cytoplasmic vesicle;membrane | GO:0005524;GO:0003723;GO:0003724;GO:0004197;GO:0017111;GO:0016779;GO:0008233;GO:0005198 | ATP binding;RNA binding;RNA helicase activity;cysteine-type endopeptidase activity;nucleoside-triphosphatase activity;nucleotidyltransferase activity;peptidase activity;structural molecule activity | GO:0018144;GO:0006508 | RNA-protein covalent cross-linking;proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0419300ORconserved Plasmodium protein, unknown functionANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0419300 OR conserved Plasmodium protein, unknown function AND Plasmodium falciparum 3D7 |
|
PF3D7_0506900 | PF3D7_0506900.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2280 | PF3D7_0506900 | rhomboid protease ROM4 | rhomboid protease ROM4 | 812885 | Q8I433 | 5 | Pf3D7_05_v3:288,776..291,055(-) | Pf3D7_05_v3:288776..291055(-) | Pf3D7_05_v3 | Plasmodium falciparum 3D7 | 44 | OG6_126349 | 0 | 759 | 2280 | 86653 | 9.50 | 6 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | GO:0009986;GO:0005886 | cell surface;plasma membrane | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | 3.4.21.105 (Rhomboid protease) | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0506900ORrhomboid protease ROM4ANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0506900 OR rhomboid protease ROM4 AND Plasmodium falciparum 3D7 |
|
PF3D7_0507200 | PF3D7_0507200.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2310 | PF3D7_0507200 | subtilisin-like protease 3 | subtilisin-like protease 3 | 812882 | Q8I430 | 5 | Pf3D7_05_v3:298,427..300,736(-) | Pf3D7_05_v3:298427..300736(-) | Pf3D7_05_v3 | Plasmodium falciparum 3D7 | 42 | OG6_532299 | 0 | 769 | 2310 | 88046 | 9.50 | 0 | | | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0020011;GO:0005737 | apicoplast;cytoplasm | GO:0005515 | protein binding | GO:0006508 | proteolysis | 3.4.21.62 (Subtilisin) | 3.4.21.62 (Subtilisin) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0507200ORsubtilisin-like protease 3ANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0507200 OR subtilisin-like protease 3 AND Plasmodium falciparum 3D7 |
|
PF3D7_0507300 | PF3D7_0507300.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2682 | PF3D7_0507300 | subtilisin-like ookinete protein SOPT | subtilisin-like ookinete protein SOPT | 812879 | Q8I429 | 5 | Pf3D7_05_v3:301,930..304,611(-) | Pf3D7_05_v3:301930..304611(-) | Pf3D7_05_v3 | Plasmodium falciparum 3D7 | 30 | OG6_533144 | 0 | 893 | 2682 | 107038 | 9.67 | 0 | NN: MIYLGKKLLSCTLFVYFLYIHFFLLK, HMM: MIYLGKKLLSCTLFVYFLYIHFFLLK | NN Sum: 2, NN D: .56, HMM Prob: .01 | | | | | | | GO:0020036;GO:0071944;GO:0009986 | Maurer's cleft;cell periphery;cell surface | | | GO:0044409 | entry into host | | | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0507300ORsubtilisin-like ookinete protein SOPTANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0507300 OR subtilisin-like ookinete protein SOPT AND Plasmodium falciparum 3D7 |
|
PF3D7_0507500 | PF3D7_0507500.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2067 | PF3D7_0507500 | subtilisin-like protease 1 | subtilisin-like protease 1 | 812875 | Q8I0V0 | 5 | Pf3D7_05_v3:307,490..309,556(-) | Pf3D7_05_v3:307490..309556(-) | Pf3D7_05_v3 | Plasmodium falciparum 3D7 | 49 | OG6_121085 | 0 | 688 | 2067 | 77645 | 5.92 | 0 | NN: MMLNKKVVALCTLTLHLFCIFLCLGK, HMM: MMLNKKVVALCTLTLHLFCIFLCLGK | NN Sum: 4, NN D: .76, HMM Prob: .88 | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0044311;GO:0020026;GO:0020003 | exoneme;merozoite dense granule;symbiont-containing vacuole | GO:0004252;GO:0008236 | serine-type endopeptidase activity;serine-type peptidase activity | GO:0035891;GO:0006508 | exit from host cell;proteolysis | 3.4.21.62 (Subtilisin) | 3.4.21.62 (Subtilisin) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0507500ORsubtilisin-like protease 1ANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0507500 OR subtilisin-like protease 1 AND Plasmodium falciparum 3D7 |
|
PF3D7_0515100 | PF3D7_0515100.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 1467 | PF3D7_0515100 | rhomboid protease ROM9 | rhomboid protease ROM9 | 812965 | Q8I3V7 | 5 | Pf3D7_05_v3:624,719..626,481(-) | Pf3D7_05_v3:624719..626481(-) | Pf3D7_05_v3 | Plasmodium falciparum 3D7 | 35 | OG6_106921 | 0 | 488 | 1467 | 59159 | 10.21 | 5 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | 3.4.21.105 (Rhomboid protease) | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0515100ORrhomboid protease ROM9ANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0515100 OR rhomboid protease ROM9 AND Plasmodium falciparum 3D7 |
|
PF3D7_0516700 | PF3D7_0516700.1 | 3 | 3 | 1 | | | forward | protein coding | No | 3999 | PF3D7_0516700 | ubiquitin carboxyl-terminal hydrolase 2, putative | ubiquitin carboxyl-terminal hydrolase 2, putative | 812982 | Q8I3U1 | 5 | Pf3D7_05_v3:694,492..698,778(+) | Pf3D7_05_v3:694492..698778(+) | Pf3D7_05_v3 | Plasmodium falciparum 3D7 | 48 | OG6_101021 | 0 | 1332 | 3999 | 156331 | 6.78 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | GO:0004843 | thiol-dependent ubiquitin-specific protease activity | GO:0016579 | protein deubiquitination | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0516700ORubiquitin carboxyl-terminal hydrolase 2, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0516700 OR ubiquitin carboxyl-terminal hydrolase 2, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_0517400 | PF3D7_0517400.1 | 3 | 3 | 1 | | | forward | protein coding | No | 3426 | PF3D7_0517400 | FACT complex subunit SPT16, putative | FACT complex subunit SPT16, putative | 812989 | Q8I3T4 | 5 | Pf3D7_05_v3:731,407..735,162(+) | Pf3D7_05_v3:731407..735162(+) | Pf3D7_05_v3 | Plasmodium falciparum 3D7 | 38 | OG6_102309 | 0 | 1141 | 3426 | 132681 | 4.61 | 0 | | | | | | | | | GO:0005634 | nucleus | | | GO:0006351 | transcription, DNA-templated | | 1.1.1.27 (L-lactate dehydrogenase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0517400ORFACT complex subunit SPT16, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0517400 OR FACT complex subunit SPT16, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_0517700 | PF3D7_0517700.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2151 | PF3D7_0517700 | eukaryotic translation initiation factor 3 subunit B, putative | eukaryotic translation initiation factor 3 subunit B, putative | 812992 | Q8I3T1 | 5 | Pf3D7_05_v3:743,179..745,329(+) | Pf3D7_05_v3:743179..745329(+) | Pf3D7_05_v3 | Plasmodium falciparum 3D7 | 45 | OG6_101924 | 0 | 716 | 2151 | 84056 | 8.28 | 0 | | | GO:0005852 | eukaryotic translation initiation factor 3 complex | GO:0003723;GO:0003676;GO:0003743;GO:0031369 | RNA binding;nucleic acid binding;translation initiation factor activity;translation initiation factor binding | GO:0006413 | translational initiation | GO:0005634 | nucleus | | | | | | 3.6.3.14 (Transferred entry: 7.1.2.2) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0517700OReukaryotic translation initiation factor 3 subunit B, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0517700 OR eukaryotic translation initiation factor 3 subunit B, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_0518300 | PF3D7_0518300.1 | 4 | 4 | 1 | | | reverse | protein coding | No | 723 | PF3D7_0518300 | proteasome subunit beta type-1, putative | proteasome subunit beta type-1, putative | 812998 | C0H4E8 | 5 | Pf3D7_05_v3:759,831..760,998(-) | Pf3D7_05_v3:759831..760998(-) | Pf3D7_05_v3 | Plasmodium falciparum 3D7 | 44 | OG6_101631 | 0 | 240 | 723 | 27267 | 7.09 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | GO:0005634;GO:0005839 | nucleus;proteasome core complex | GO:0004175 | endopeptidase activity | GO:0006511 | ubiquitin-dependent protein catabolic process | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0518300ORproteasome subunit beta type-1, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0518300 OR proteasome subunit beta type-1, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_0523100 | PF3D7_0523100.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 1605 | PF3D7_0523100 | mitochondrial-processing peptidase subunit alpha, putative | mitochondrial-processing peptidase subunit alpha, putative | 813046 | Q8I3N3 | 5 | Pf3D7_05_v3:963,227..965,044(-) | Pf3D7_05_v3:963227..965044(-) | Pf3D7_05_v3 | Plasmodium falciparum 3D7 | 44 | OG6_102381 | 0 | 534 | 1605 | 61772 | 8.85 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | GO:0017087;GO:0005739 | mitochondrial processing peptidase complex;mitochondrion | GO:0004222 | metalloendopeptidase activity | GO:0006627 | protein processing involved in protein targeting to mitochondrion | 3.4.24.64 (Mitochondrial processing peptidase) | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0523100ORmitochondrial-processing peptidase subunit alpha, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0523100 OR mitochondrial-processing peptidase subunit alpha, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_0527200 | PF3D7_0527200.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 1818 | PF3D7_0527200 | ubiquitin carboxyl-terminal hydrolase 14 | ubiquitin carboxyl-terminal hydrolase 14 | 813087 | Q8I3J3 | 5 | Pf3D7_05_v3:1,132,937..1,134,854(-) | Pf3D7_05_v3:1132937..1134854(-) | Pf3D7_05_v3 | Plasmodium falciparum 3D7 | 44 | OG6_101892 | 0 | 605 | 1818 | 70732 | 5.96 | 0 | | | | | GO:0005515;GO:0036459 | protein binding;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | GO:0005634 | nucleus | GO:0070628;GO:0004843 | proteasome binding;thiol-dependent ubiquitin-specific protease activity | GO:0016579 | protein deubiquitination | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0527200ORubiquitin carboxyl-terminal hydrolase 14ANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0527200 OR ubiquitin carboxyl-terminal hydrolase 14 AND Plasmodium falciparum 3D7 |
|
PF3D7_0527300 | PF3D7_0527300.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 984 | PF3D7_0527300 | methionine aminopeptidase 1a, putative | methionine aminopeptidase 1a, putative | 813088 | Q8I3J2 | 5 | Pf3D7_05_v3:1,135,976..1,137,870(-) | Pf3D7_05_v3:1135976..1137870(-) | Pf3D7_05_v3 | Plasmodium falciparum 3D7 | 43 | OG6_124490 | 0 | 327 | 984 | 37410 | 8.57 | 0 | | | | | GO:0004177;GO:0008235 | aminopeptidase activity;metalloexopeptidase activity | GO:0006508 | proteolysis | | | GO:0003729;GO:0070006;GO:0008235 | mRNA binding;metalloaminopeptidase activity;metalloexopeptidase activity | GO:0006508 | proteolysis | 3.4.11.18 (Methionyl aminopeptidase) | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0527300ORmethionine aminopeptidase 1a, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0527300 OR methionine aminopeptidase 1a, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_0603800 | PF3D7_0603800.1 | 20 | 20 | 1 | | | reverse | protein coding | No | 5481 | PF3D7_0603800 | centrosomal protein CEP76, putative | centrosomal protein CEP76, putative | 3885790 | C6KSN6 | 6 | Pf3D7_06_v3:152,541..160,455(-) | Pf3D7_06_v3:152541..160455(-) | Pf3D7_06_v3 | Plasmodium falciparum 3D7 | 46 | OG6_126374 | 0 | 1826 | 5481 | 219256 | 6.84 | 1 | | | | | | | | | GO:0005813;GO:0005634 | centrosome;nucleus | | | | | | 1.3.-.- (Acting on the CH-CH group of donors.) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0603800ORcentrosomal protein CEP76, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0603800 OR centrosomal protein CEP76, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_0608500 | PF3D7_0608500.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 708 | PF3D7_0608500 | proteasome subunit alpha type-2, putative | proteasome subunit alpha type-2, putative | 3885908 | C6KST3 | 6 | Pf3D7_06_v3:351,780..352,775(-) | Pf3D7_06_v3:351780..352775(-) | Pf3D7_06_v3 | Plasmodium falciparum 3D7 | 43 | OG6_101969 | 0 | 235 | 708 | 26528 | 5.17 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | GO:0005634;GO:0005839 | nucleus;proteasome core complex | GO:0004175 | endopeptidase activity | GO:0006511 | ubiquitin-dependent protein catabolic process | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0608500ORproteasome subunit alpha type-2, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0608500 OR proteasome subunit alpha type-2, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_0618600 | PF3D7_0618600.1 | 8 | 8 | 1 | | | reverse | protein coding | No | 825 | PF3D7_0618600 | rhomboid protease ROM10 | rhomboid protease ROM10 | 3885845 | C6KT26 | 6 | Pf3D7_06_v3:775,980..777,835(-) | Pf3D7_06_v3:775980..777835(-) | Pf3D7_06_v3 | Plasmodium falciparum 3D7 | 44 | OG6_103838 | 0 | 274 | 825 | 31339 | 8.76 | 7 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | 3.4.21.105 (Rhomboid protease) | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0618600ORrhomboid protease ROM10ANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0618600 OR rhomboid protease ROM10 AND Plasmodium falciparum 3D7 |
|
PF3D7_0627300 | PF3D7_0627300.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1350 | PF3D7_0627300 | E3 ubiquitin-protein ligase RNF5, putative | E3 ubiquitin-protein ligase RNF5, putative | 3885693 | C6KTA9 | 6 | Pf3D7_06_v3:1,097,300..1,098,649(-) | Pf3D7_06_v3:1097300..1098649(-) | Pf3D7_06_v3 | Plasmodium falciparum 3D7 | 44 | OG6_102074 | 0 | 449 | 1350 | 52811 | 4.61 | 1 | | | | | | | | | | | GO:0008270 | zinc ion binding | | | 6.3.2.19 (Transferred entry: 2.3.2.23, 2.3.2.27 and 6.2.1.45) | 6.3.2.19 (Transferred entry: 2.3.2.23, 2.3.2.27 and 6.2.1.45) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0627300ORE3 ubiquitin-protein ligase RNF5, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0627300 OR E3 ubiquitin-protein ligase RNF5, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_0627500 | PF3D7_0627500.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 570 | PF3D7_0627500 | protein DJ-1 | protein DJ-1 | 3885695 | C6KTB1 | 6 | Pf3D7_06_v3:1,101,734..1,102,852(-) | Pf3D7_06_v3:1101734..1102852(-) | Pf3D7_06_v3 | Plasmodium falciparum 3D7 | 44 | OG6_101257 | 0 | 189 | 570 | 20292 | 7.46 | 0 | | | | | | | | | GO:0009986;GO:0005829 | cell surface;cytosol | GO:0008233;GO:0036524 | peptidase activity;protein deglycase activity | GO:0036525;GO:0006457 | protein deglycation;protein folding | 2.7.1.50 (Hydroxyethylthiazole kinase) | 2.7.1.50 (Hydroxyethylthiazole kinase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0627500ORprotein DJ-1ANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0627500 OR protein DJ-1 AND Plasmodium falciparum 3D7 |
|
PF3D7_0628400 | PF3D7_0628400.1 | 8 | 8 | 1 | | | forward | protein coding | No | 1020 | PF3D7_0628400 | protease, putative | protease, putative | 9221870 | C0H4H7 | 6 | Pf3D7_06_v3:1,176,265..1,178,587(+) | Pf3D7_06_v3:1176265..1178587(+) | Pf3D7_06_v3 | Plasmodium falciparum 3D7 | 44 | OG6_168022 | 0 | 339 | 1020 | 40640 | 6.83 | 7 | | | | | GO:0008233 | peptidase activity | | | GO:0016021 | integral component of membrane | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0628400ORprotease, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0628400 OR protease, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_0629300 | PF3D7_0629300.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2592 | PF3D7_0629300 | phospholipase, putative | phospholipase, putative | 3885733 | C6KTC8 | 6 | Pf3D7_06_v3:1,205,190..1,207,781(+) | Pf3D7_06_v3:1205190..1207781(+) | Pf3D7_06_v3 | Plasmodium falciparum 3D7 | 44 | OG6_101376 | 0 | 863 | 2592 | 99230 | 4.64 | 0 | NN: MSSILLFFVVFQYLLISFSG, HMM: MSSILLFFVVFQYLLISFSG | NN Sum: 3, NN D: .62, HMM Prob: .96 | | | GO:0008374 | O-acyltransferase activity | GO:0006629 | lipid metabolic process | GO:0009986;GO:0020005 | cell surface;symbiont-containing vacuole membrane | GO:0004607;GO:0004620 | phosphatidylcholine-sterol O-acyltransferase activity;phospholipase activity | GO:0035891 | exit from host cell | 2.3.1.43 (Phosphatidylcholine--sterol O-acyltransferase) | 2.3.1.43 (Phosphatidylcholine--sterol O-acyltransferase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0629300ORphospholipase, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0629300 OR phospholipase, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_0702200 | PF3D7_0702200.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1275 | PF3D7_0702200 | lysophospholipase, putative | lysophospholipase, putative | 2654972 | Q8IC45 | 7 | Pf3D7_07_v3:91,867..93,141(-) | Pf3D7_07_v3:91867..93141(-) | Pf3D7_07_v3 | Plasmodium falciparum 3D7 | 453 | OG6_100231 | 8 | 424 | 1275 | 49242 | 5.03 | 0 | | | | | | | | | | | GO:0016787 | hydrolase activity | GO:0006644 | phospholipid metabolic process | 3.1.1.5 (Lysophospholipase) | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0702200ORlysophospholipase, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0702200 OR lysophospholipase, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_0705800 | PF3D7_0705800.1 | 8 | 8 | 1 | | | reverse | protein coding | No | 582 | PF3D7_0705800 | cysteine-rich secretory protein, putative | cysteine-rich secretory protein, putative | 9221892 | C0H4K9 | 7 | Pf3D7_07_v3:287,597..289,088(-) | Pf3D7_07_v3:287597..289088(-) | Pf3D7_07_v3 | Plasmodium falciparum 3D7 | 37 | OG6_101367 | 0 | 193 | 582 | 22608 | 6.89 | 1 | HMM: MIGIMNIFLLFFVFISYIYVNGQ, NN: MIGIMNIFLLFFVFISYIYVNGQ | NN Sum: 4, NN D: .84, HMM Prob: .82 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0705800ORcysteine-rich secretory protein, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0705800 OR cysteine-rich secretory protein, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_0709700 | PF3D7_0709700.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1107 | PF3D7_0709700 | prodrug activation and resistance esterase | prodrug activation and resistance esterase | 2655076 | Q8IBZ2 | 7 | Pf3D7_07_v3:435,089..436,195(-) | Pf3D7_07_v3:435089..436195(-) | Pf3D7_07_v3 | Plasmodium falciparum 3D7 | 453 | OG6_100231 | 8 | 368 | 1107 | 42357 | 9.53 | 0 | | | | | | | | | GO:0005737 | cytoplasm | GO:0047372;GO:0016788 | acylglycerol lipase activity;hydrolase activity, acting on ester bonds | GO:0052651;GO:0042493 | monoacylglycerol catabolic process;response to drug | 3.1.-.- (Acting on ester bonds.);3.1.1.23 (Acylglycerol lipase);3.1.1.5 (Lysophospholipase) | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0709700ORprodrug activation and resistance esteraseANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0709700 OR prodrug activation and resistance esterase AND Plasmodium falciparum 3D7 |
|
PF3D7_0709900 | PF3D7_0709900.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 6933 | PF3D7_0709900 | conserved protein, unknown function | conserved protein, unknown function | 2655201 | Q8IBZ1 | 7 | Pf3D7_07_v3:438,557..445,881(-) | Pf3D7_07_v3:438557..445881(-) | Pf3D7_07_v3 | Plasmodium falciparum 3D7 | 43 | OG6_113142 | 0 | 2310 | 6933 | 274021 | 9.82 | 4 | | | GO:0005737 | cytoplasm | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0709900ORconserved protein, unknown functionANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0709900 OR conserved protein, unknown function AND Plasmodium falciparum 3D7 |
|
PF3D7_0718700 | PF3D7_0718700.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1374 | PF3D7_0718700 | conserved Plasmodium membrane protein, unknown function | conserved Plasmodium membrane protein, unknown function | 2655119 | Q8IBR4 | 7 | Pf3D7_07_v3:831,549..832,922(-) | Pf3D7_07_v3:831549..832922(-) | Pf3D7_07_v3 | Plasmodium falciparum 3D7 | 44 | OG6_533066 | 0 | 457 | 1374 | 53857 | 9.80 | 5 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0718700ORconserved Plasmodium membrane protein, unknown functionANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0718700 OR conserved Plasmodium membrane protein, unknown function AND Plasmodium falciparum 3D7 |
|
PF3D7_0722300 | PF3D7_0722300.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3666 | PF3D7_0722300 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | 2655187 | Q8IBN0 | 7 | Pf3D7_07_v3:949,449..953,114(-) | Pf3D7_07_v3:949449..953114(-) | Pf3D7_07_v3 | Plasmodium falciparum 3D7 | 43 | OG6_532410 | 0 | 1221 | 3666 | 145491 | 8.89 | 0 | | | | | GO:0008270 | zinc ion binding | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0722300ORubiquitin carboxyl-terminal hydrolase, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0722300 OR ubiquitin carboxyl-terminal hydrolase, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_0726500 | PF3D7_0726500.1 | 4 | 4 | 1 | | | reverse | protein coding | No | 9552 | PF3D7_0726500 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | 2655023 | Q8IBJ1 | 7 | Pf3D7_07_v3:1,126,556..1,136,577(-) | Pf3D7_07_v3:1126556..1136577(-) | Pf3D7_07_v3 | Plasmodium falciparum 3D7 | 46 | OG6_101317 | 0 | 3183 | 9552 | 373166 | 8.00 | 0 | | | | | GO:0005515;GO:0036459 | protein binding;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | GO:0005634 | nucleus | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0726500ORubiquitin carboxyl-terminal hydrolase, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0726500 OR ubiquitin carboxyl-terminal hydrolase, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_0727400 | PF3D7_0727400.1 | 3 | 3 | 1 | | | forward | protein coding | No | 771 | PF3D7_0727400 | proteasome subunit alpha type-5, putative | proteasome subunit alpha type-5, putative | 2655165 | Q8IBI3 | 7 | Pf3D7_07_v3:1,162,710..1,163,831(+) | Pf3D7_07_v3:1162710..1163831(+) | Pf3D7_07_v3 | Plasmodium falciparum 3D7 | 44 | OG6_101621 | 0 | 256 | 771 | 28388 | 4.70 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | GO:1903561;GO:0005634;GO:0019773 | extracellular vesicle;nucleus;proteasome core complex, alpha-subunit complex | GO:0004175 | endopeptidase activity | GO:0006511 | ubiquitin-dependent protein catabolic process | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0727400ORproteasome subunit alpha type-5, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0727400 OR proteasome subunit alpha type-5, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_0728700 | PF3D7_0728700.1 | 4 | 4 | 1 | | | reverse | protein coding | No | 2163 | PF3D7_0728700 | alpha/beta hydrolase, putative | alpha/beta hydrolase, putative | 2655032 | Q8IBH1 | 7 | Pf3D7_07_v3:1,226,029..1,228,714(-) | Pf3D7_07_v3:1226029..1228714(-) | Pf3D7_07_v3 | Plasmodium falciparum 3D7 | 44 | OG6_110414 | 0 | 720 | 2163 | 84806 | 9.27 | 0 | | | | | | | | | | | GO:0016298 | lipase activity | GO:0006629 | lipid metabolic process | | 3.-.-.- (Hydrolases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0728700ORalpha/beta hydrolase, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0728700 OR alpha/beta hydrolase, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_0731800 | PF3D7_0731800.1 | 2 | 2 | 1 | | | forward | protein coding | No | 2028 | PF3D7_0731800 | alpha/beta hydrolase, putative | alpha/beta hydrolase, putative | 2654938 | C0H4Q4 | 7 | Pf3D7_07_v3:1,378,618..1,380,769(+) | Pf3D7_07_v3:1378618..1380769(+) | Pf3D7_07_v3 | Plasmodium falciparum 3D7 | 117 | OG6_157547 | 3 | 675 | 2028 | 78378 | 7.85 | 1 | HMM: MSIYFWITYCIFVCVIYYENTFLH, NN: MSIYFWITYCIFVCVIYYE | NN Sum: 2, NN D: .55, HMM Prob: .02 | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0731800ORalpha/beta hydrolase, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0731800 OR alpha/beta hydrolase, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_0801700 | PF3D7_0801700.1 | 3 | 3 | 1 | | | forward | protein coding | No | 5355 | PF3D7_0801700 | sentrin-specific protease 2, putative | sentrin-specific protease 2, putative | 2655355 | C0H4Y4 | 8 | Pf3D7_08_v3:112,299..117,877(+) | Pf3D7_08_v3:112299..117877(+) | Pf3D7_08_v3 | Plasmodium falciparum 3D7 | 34 | OG6_113308 | 0 | 1784 | 5355 | 210878 | 6.59 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | GO:0005634 | nucleus | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | 3.4.22.68 (Ulp1 peptidase);5.3.1.8 (Mannose-6-phosphate isomerase) | 3.4.22.68 (Ulp1 peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0801700ORsentrin-specific protease 2, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0801700 OR sentrin-specific protease 2, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_0803800 | PF3D7_0803800.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 798 | PF3D7_0803800 | proteasome subunit beta type-4 | proteasome subunit beta type-4 | 2655367 | Q7K6A9 | 8 | Pf3D7_08_v3:233,467..234,426(-) | Pf3D7_08_v3:233467..234426(-) | Pf3D7_08_v3 | Plasmodium falciparum 3D7 | 44 | OG6_101718 | 0 | 265 | 798 | 30871 | 6.40 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | GO:0005634;GO:0005839 | nucleus;proteasome core complex | GO:0004175 | endopeptidase activity | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0803800ORproteasome subunit beta type-4ANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0803800 OR proteasome subunit beta type-4 AND Plasmodium falciparum 3D7 |
|
PF3D7_0804400 | PF3D7_0804400.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2223 | PF3D7_0804400 | methionine aminopeptidase 1c, putative | methionine aminopeptidase 1c, putative | 2655407 | Q8IAP0 | 8 | Pf3D7_08_v3:245,711..247,933(+) | Pf3D7_08_v3:245711..247933(+) | Pf3D7_08_v3 | Plasmodium falciparum 3D7 | 44 | OG6_171502 | 0 | 740 | 2223 | 88178 | 9.34 | 0 | HMM: MNISIFFFLFLYSGSICAI, NN: MNISIFFFLFLYSGSICAI | NN Sum: 4, NN D: .81, HMM Prob: .98 | | | | | | | GO:0020011 | apicoplast | GO:0003729;GO:0070006;GO:0008235 | mRNA binding;metalloaminopeptidase activity;metalloexopeptidase activity | GO:0006508 | proteolysis | 3.4.11.18 (Methionyl aminopeptidase) | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0804400ORmethionine aminopeptidase 1c, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0804400 OR methionine aminopeptidase 1c, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_0805000 | PF3D7_0805000.1 | 7 | 7 | 1 | | | reverse | protein coding | No | 738 | PF3D7_0805000 | alpha/beta hydrolase, putative | alpha/beta hydrolase, putative | 2655404 | C0H4R4 | 8 | Pf3D7_08_v3:283,066..284,522(-) | Pf3D7_08_v3:283066..284522(-) | Pf3D7_08_v3 | Plasmodium falciparum 3D7 | 135 | OG6_100915 | 2 | 245 | 738 | 28466 | 6.77 | 0 | | | | | | | | | | | | | | | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0805000ORalpha/beta hydrolase, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0805000 OR alpha/beta hydrolase, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_0807500 | PF3D7_0807500.1 | 3 | 3 | 1 | | | forward | protein coding | No | 783 | PF3D7_0807500 | proteasome subunit alpha type-6, putative | proteasome subunit alpha type-6, putative | 2655251 | Q8IAR3 | 8 | Pf3D7_08_v3:387,219..388,364(+) | Pf3D7_08_v3:387219..388364(+) | Pf3D7_08_v3 | Plasmodium falciparum 3D7 | 44 | OG6_102240 | 0 | 260 | 783 | 29499 | 5.20 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | GO:0005839 | proteasome core complex | GO:0004175 | endopeptidase activity | GO:0006511 | ubiquitin-dependent protein catabolic process | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0807500ORproteasome subunit alpha type-6, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0807500 OR proteasome subunit alpha type-6, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_0807700 | PF3D7_0807700.1 | 5 | 5 | 1 | | | reverse | protein coding | No | 2613 | PF3D7_0807700 | serine protease DegP | serine protease DegP | 2655249 | Q8IAR5 | 8 | Pf3D7_08_v3:395,648..398,787(-) | Pf3D7_08_v3:395648..398787(-) | Pf3D7_08_v3 | Plasmodium falciparum 3D7 | 26 | OG6_105727 | 0 | 870 | 2613 | 101493 | 9.84 | 0 | NN: MDIIFCTPTYCKIMLMIIMLISLRTRCDTN, HMM: MDIIFCTPTYCKIMLMIIMLISLRTRCD | NN Sum: 4, NN D: .71, HMM Prob: .11 | | | GO:0004252 | serine-type endopeptidase activity | | | GO:0005829;GO:0044164;GO:0020002;GO:0020003 | cytosol;host cell cytosol;host cell plasma membrane;symbiont-containing vacuole | GO:0005515 | protein binding | GO:0006508;GO:0006979;GO:0009266 | proteolysis;response to oxidative stress;response to temperature stimulus | 3.4.21.- (Serine endopeptidases.) | 3.4.21.108 (HtrA2 peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0807700ORserine protease DegPANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0807700 OR serine protease DegP AND Plasmodium falciparum 3D7 |
|
PF3D7_0807800 | PF3D7_0807800.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 1446 | PF3D7_0807800 | 26S proteasome regulatory subunit RPN10, putative | 26S proteasome regulatory subunit RPN10, putative | 2655309 | Q8IAR6 | 8 | Pf3D7_08_v3:399,591..401,360(-) | Pf3D7_08_v3:399591..401360(-) | Pf3D7_08_v3 | Plasmodium falciparum 3D7 | 44 | OG6_102002 | 0 | 481 | 1446 | 55066 | 4.45 | 0 | | | | | | | | | GO:0005634 | nucleus | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0807800OR26S proteasome regulatory subunit RPN10, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0807800 OR 26S proteasome regulatory subunit RPN10, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_0808000 | PF3D7_0808000.1 | 1 | 1 | 1 | | | forward | protein coding | No | 4089 | PF3D7_0808000 | conserved Plasmodium protein, unknown function | conserved Plasmodium protein, unknown function | 2655246 | C0H4S9 | 8 | Pf3D7_08_v3:404,996..409,084(+) | Pf3D7_08_v3:404996..409084(+) | Pf3D7_08_v3 | Plasmodium falciparum 3D7 | 44 | OG6_128391 | 0 | 1362 | 4089 | 163919 | 9.34 | 0 | | | GO:0005737 | cytoplasm | GO:0008233;GO:0004252 | peptidase activity;serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0808000ORconserved Plasmodium protein, unknown functionANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0808000 OR conserved Plasmodium protein, unknown function AND Plasmodium falciparum 3D7 |
|
PF3D7_0808200 | PF3D7_0808200.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1722 | PF3D7_0808200 | plasmepsin X | plasmepsin X | 2655308 | Q8IAS0 | 8 | Pf3D7_08_v3:416,344..418,065(-) | Pf3D7_08_v3:416344..418065(-) | Pf3D7_08_v3 | Plasmodium falciparum 3D7 | 91 | OG6_119797 | 1 | 573 | 1722 | 65113 | 5.22 | 0 | NN: MKRISPLNTLFYLSLFFSYTFKGLKCT, HMM: MKRISPLNTLFYLSLFFSYTFKGLKCT | NN Sum: 3, NN D: .52, HMM Prob: .35 | | | | | | | GO:0045177;GO:0044311 | apical part of cell;exoneme | GO:0004190 | aspartic-type endopeptidase activity | GO:0044409;GO:0035891;GO:0006508;GO:0042493 | entry into host;exit from host cell;proteolysis;response to drug | 3.4.23.1 (Pepsin A) | 3.4.23.1 (Pepsin A) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0808200ORplasmepsin XANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0808200 OR plasmepsin X AND Plasmodium falciparum 3D7 |
|
PF3D7_0809600 | PF3D7_0809600.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 17403 | PF3D7_0809600 | peptidase family C50, putative | peptidase family C50, putative | 2655237 | C0H4T3 | 8 | Pf3D7_08_v3:479,980..497,382(-) | Pf3D7_08_v3:479980..497382(-) | Pf3D7_08_v3 | Plasmodium falciparum 3D7 | 36 | OG6_150828 | 0 | 5800 | 17403 | 698185 | 8.27 | 5 | | | GO:0005634 | nucleus | GO:0008233 | peptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.22.49 (Separase) | 3.4.22.49 (Separase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0809600ORpeptidase family C50, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0809600 OR peptidase family C50, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_0812200 | PF3D7_0812200.1 | 13 | 13 | 1 | | | reverse | protein coding | No | 1215 | PF3D7_0812200 | trypsin-like serine protease, putative | trypsin-like serine protease, putative | 2655450 | C0H4U2 | 8 | Pf3D7_08_v3:614,919..617,821(-) | Pf3D7_08_v3:614919..617821(-) | Pf3D7_08_v3 | Plasmodium falciparum 3D7 | 39 | OG6_100391 | 0 | 404 | 1215 | 46413 | 9.88 | 0 | | | | | GO:0005515;GO:0004252 | protein binding;serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.21.107 (Peptidase Do) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0812200ORtrypsin-like serine protease, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0812200 OR trypsin-like serine protease, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_0812220 | PF3D7_0812220.1 | 5 | 5 | 1 | | | reverse | protein coding | No | 882 | PF3D7_0812220 | GTP-binding protein YihA3 | GTP-binding protein YihA3 | | | 8 | Pf3D7_08_v3:613,325..614,862(-) | Pf3D7_08_v3:613325..614862(-) | Pf3D7_08_v3 | Plasmodium falciparum 3D7 | 131 | OG6_101142 | 2 | 293 | 882 | 34864 | 10.01 | 1 | NN: MPNKGKRSYFLYIFYLTFCINLMFIYGF, HMM: MPNKGKRSYFLYIFYLTFCINLMFIYGF | NN Sum: 4, NN D: .56, HMM Prob: .01 | | | GO:0005525 | GTP binding | | | GO:0020011;GO:0005829 | apicoplast;cytosol | GO:0003924;GO:0043022 | GTPase activity;ribosome binding | | | 3.6.5.1 (Heterotrimeric G-protein GTPase) | 3.6.5.1 (Heterotrimeric G-protein GTPase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0812220ORGTP-binding protein YihA3ANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0812220 OR GTP-binding protein YihA3 AND Plasmodium falciparum 3D7 |
|
PF3D7_0816600 | PF3D7_0816600.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3213 | PF3D7_0816600 | chaperone protein ClpB1 | chaperone protein ClpB1 | 2655262 | Q8IB03 | 8 | Pf3D7_08_v3:762,118..765,330(-) | Pf3D7_08_v3:762118..765330(-) | Pf3D7_08_v3 | Plasmodium falciparum 3D7 | 95 | OG6_100223 | 1 | 1070 | 3213 | 122507 | 8.92 | 1 | NN: MVNSFFFCFVIIGLIYVWDITYSK, HMM: MVNSFFFCFVIIGLIYVWDITYSK | NN Sum: 4, NN D: .73, HMM Prob: .58 | | | GO:0005524 | ATP binding | GO:0019538 | protein metabolic process | GO:0020011;GO:0005634 | apicoplast;nucleus | GO:0016887 | ATPase activity | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0816600ORchaperone protein ClpB1ANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0816600 OR chaperone protein ClpB1 AND Plasmodium falciparum 3D7 |
|
PF3D7_0818600 | PF3D7_0818600.1 | 11 | 11 | 1 | | | reverse | protein coding | No | 909 | PF3D7_0818600 | BEM46-like protein, putative | BEM46-like protein, putative | 2655392 | | 8 | Pf3D7_08_v3:845,253..847,380(-) | Pf3D7_08_v3:845253..847380(-) | Pf3D7_08_v3 | Plasmodium falciparum 3D7 | 45 | OG6_101827 | 0 | 302 | 909 | 34920 | 9.10 | 1 | HMM: MRIIKYIFFAFIILALFVCAL, NN: MRIIKYIFFAFIILALFVCAL | NN Sum: 4, NN D: .79, HMM Prob: .65 | | | | | | | GO:0009986;GO:0005886 | cell surface;plasma membrane | GO:0016298 | lipase activity | GO:0048469;GO:0044409;GO:0006629 | cell maturation;entry into host;lipid metabolic process | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0818600ORBEM46-like protein, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0818600 OR BEM46-like protein, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_0823400 | PF3D7_0823400.1 | 5 | 5 | 1 | | | forward | protein coding | No | 1485 | PF3D7_0823400 | alpha/beta hydrolase, putative | alpha/beta hydrolase, putative | 2655379 | C0H4X3 | 8 | Pf3D7_08_v3:1,034,417..1,036,428(+) | Pf3D7_08_v3:1034417..1036428(+) | Pf3D7_08_v3 | Plasmodium falciparum 3D7 | 44 | OG6_105308 | 0 | 494 | 1485 | 58636 | 8.50 | 0 | | | | | GO:0016787 | hydrolase activity | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0823400ORalpha/beta hydrolase, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0823400 OR alpha/beta hydrolase, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_0826200 | PF3D7_0826200.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1809 | PF3D7_0826200 | alpha/beta hydrolase, putative | alpha/beta hydrolase, putative | 2655472 | Q8IB95 | 8 | Pf3D7_08_v3:1,142,499..1,144,307(-) | Pf3D7_08_v3:1142499..1144307(-) | Pf3D7_08_v3 | Plasmodium falciparum 3D7 | 66 | OG6_129556 | 1 | 602 | 1809 | 70694 | 10.07 | 0 | | | | | | | | | | | | | | | | 3.4.11.- (Aminopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0826200ORalpha/beta hydrolase, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0826200 OR alpha/beta hydrolase, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_0826300 | PF3D7_0826300.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1338 | PF3D7_0826300 | SPRY domain, putative | SPRY domain, putative | 2655470 | Q8IB96 | 8 | Pf3D7_08_v3:1,146,167..1,147,504(+) | Pf3D7_08_v3:1146167..1147504(+) | Pf3D7_08_v3 | Plasmodium falciparum 3D7 | 44 | OG6_102272 | 0 | 445 | 1338 | 51931 | 8.33 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0826300ORSPRY domain, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0826300 OR SPRY domain, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_0828000 | PF3D7_0828000.1 | 4 | 4 | 1 | | | forward | protein coding | No | 804 | PF3D7_0828000 | rhomboid protease ROM3 | rhomboid protease ROM3 | 2655357 | C0H4Y7 | 8 | Pf3D7_08_v3:1,210,692..1,211,860(+) | Pf3D7_08_v3:1210692..1211860(+) | Pf3D7_08_v3 | Plasmodium falciparum 3D7 | 92 | OG6_100562 | 2 | 267 | 804 | 30684 | 8.52 | 8 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | 3.4.21.- (Serine endopeptidases.);3.4.21.105 (Rhomboid protease) | 3.4.21.- (Serine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0828000ORrhomboid protease ROM3ANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0828000 OR rhomboid protease ROM3 AND Plasmodium falciparum 3D7 |
|
PF3D7_0902800 | PF3D7_0902800.1 | 4 | 4 | 1 | | | reverse | protein coding | No | 2799 | PF3D7_0902800 | serine repeat antigen 9 | serine repeat antigen 9 | 813307 | Q8I3C0 | 9 | Pf3D7_09_v3:121,621..125,006(-) | Pf3D7_09_v3:121621..125006(-) | Pf3D7_09_v3 | Plasmodium falciparum 3D7 | 372 | OG6_126098 | 8 | 932 | 2799 | 105543 | 4.91 | 0 | HMM: MKVSFTLFFIIYIILNCD, NN: MKVSFTLFFIIYIILNCDVLKCE | NN Sum: 3, NN D: .61, HMM Prob: .77 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | GO:0002377;GO:0050776 | immunoglobulin production;regulation of immune response | 3.4.22.2 (Papain) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0902800ORserine repeat antigen 9ANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0902800 OR serine repeat antigen 9 AND Plasmodium falciparum 3D7 |
|
PF3D7_0904400 | PF3D7_0904400.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 558 | PF3D7_0904400 | signal peptidase complex subunit 3, putative | signal peptidase complex subunit 3, putative | 813323 | Q8I3A5 | 9 | Pf3D7_09_v3:208,168..208,725(-) | Pf3D7_09_v3:208168..208725(-) | Pf3D7_09_v3 | Plasmodium falciparum 3D7 | 43 | OG6_102447 | 0 | 185 | 558 | 22208 | 9.63 | 1 | NN: MDSFLNRLNVLFYSMALCFLILCAFNYGTSF, HMM: MDSFLNRLNVLFYSMALCFLILCAFNYGTSF | NN Sum: 4, NN D: .73, HMM Prob: .34 | GO:0016021;GO:0005787 | integral component of membrane;signal peptidase complex | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | GO:0044310 | osmiophilic body | | | | | 3.4.21.89 (Signal peptidase I) | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0904400ORsignal peptidase complex subunit 3, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0904400 OR signal peptidase complex subunit 3, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_0904600 | PF3D7_0904600.1 | 2 | 2 | 1 | | | forward | protein coding | No | 5313 | PF3D7_0904600 | ubiquitin specific protease, putative | ubiquitin specific protease, putative | 813325 | Q8I3A3 | 9 | Pf3D7_09_v3:212,515..217,983(+) | Pf3D7_09_v3:212515..217983(+) | Pf3D7_09_v3 | Plasmodium falciparum 3D7 | 47 | OG6_101457 | 1 | 1770 | 5313 | 207566 | 6.05 | 0 | | | | | GO:0004843;GO:0036459 | thiol-dependent ubiquitin-specific protease activity;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0904600ORubiquitin specific protease, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0904600 OR ubiquitin specific protease, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_0907400 | PF3D7_0907400.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2769 | PF3D7_0907400 | ATP-dependent protease ATPase subunit ClpY | ATP-dependent protease ATPase subunit ClpY | 813351 | Q8I377 | 9 | Pf3D7_09_v3:351,955..354,723(-) | Pf3D7_09_v3:351955..354723(-) | Pf3D7_09_v3 | Plasmodium falciparum 3D7 | 44 | OG6_106348 | 0 | 922 | 2769 | 106461 | 8.52 | 0 | | | GO:0009376;GO:0005737 | HslUV protease complex;cytoplasm | GO:0005524;GO:0016887;GO:0070011 | ATP binding;ATPase activity;peptidase activity, acting on L-amino acid peptides | | | GO:0005634 | nucleus | GO:0003729;GO:0005515 | mRNA binding;protein binding | | | | 2.7.1.71 (Shikimate kinase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0907400ORATP-dependent protease ATPase subunit ClpYANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0907400 OR ATP-dependent protease ATPase subunit ClpY AND Plasmodium falciparum 3D7 |
|
PF3D7_0912900 | PF3D7_0912900.1 | 2 | 2 | 1 | | | forward | protein coding | No | 1017 | PF3D7_0912900 | 26S proteasome regulatory subunit RPN8, putative | 26S proteasome regulatory subunit RPN8, putative | 813406 | Q8I323 | 9 | Pf3D7_09_v3:567,283..568,640(+) | Pf3D7_09_v3:567283..568640(+) | Pf3D7_09_v3 | Plasmodium falciparum 3D7 | 47 | OG6_102054 | 0 | 338 | 1017 | 39135 | 8.56 | 0 | | | | | GO:0005515 | protein binding | | | GO:0020020;GO:0000502 | food vacuole;proteasome complex | | | | | | 3.1.3.16 (Protein-serine/threonine phosphatase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0912900OR26S proteasome regulatory subunit RPN8, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0912900 OR 26S proteasome regulatory subunit RPN8, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_0913500 | PF3D7_0913500.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 1299 | PF3D7_0913500 | protease, putative | protease, putative | 813412 | Q8I317 | 9 | Pf3D7_09_v3:582,340..583,968(-) | Pf3D7_09_v3:582340..583968(-) | Pf3D7_09_v3 | Plasmodium falciparum 3D7 | 43 | OG6_112025 | 0 | 432 | 1299 | 52129 | 9.88 | 9 | NN: MIIKFFFFSILFLLYANCY, HMM: MIIKFFFFSILFLLYANCY | NN Sum: 4, NN D: .84, HMM Prob: .99 | GO:0016020 | membrane | | | | | GO:0020011 | apicoplast | | | GO:0009657 | plastid organization | | | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0913500ORprotease, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0913500 OR protease, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_0918300 | PF3D7_0918300.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 963 | PF3D7_0918300 | eukaryotic translation initiation factor 3 subunit F, putative | eukaryotic translation initiation factor 3 subunit F, putative | 813459 | Q8I2X0 | 9 | Pf3D7_09_v3:751,358..752,422(-) | Pf3D7_09_v3:751358..752422(-) | Pf3D7_09_v3 | Plasmodium falciparum 3D7 | 44 | OG6_103242 | 0 | 320 | 963 | 36819 | 6.73 | 0 | | | | | GO:0005515 | protein binding | | | GO:0005852;GO:0005634 | eukaryotic translation initiation factor 3 complex;nucleus | GO:0003743 | translation initiation factor activity | GO:0006413 | translational initiation | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0918300OReukaryotic translation initiation factor 3 subunit F, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0918300 OR eukaryotic translation initiation factor 3 subunit F, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_0919200 | PF3D7_0919200.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 753 | PF3D7_0919200 | PPPDE peptidase, putative | PPPDE peptidase, putative | 813468 | Q8I2W1 | 9 | Pf3D7_09_v3:789,514..790,478(-) | Pf3D7_09_v3:789514..790478(-) | Pf3D7_09_v3 | Plasmodium falciparum 3D7 | 90 | OG6_101256 | 1 | 250 | 753 | 29330 | 8.64 | 0 | | | | | | | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0919200ORPPPDE peptidase, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0919200 OR PPPDE peptidase, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_0923100 | PF3D7_0923100.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 669 | PF3D7_0923100 | OTU domain-containing protein, putative | OTU domain-containing protein, putative | 813507 | Q8I2S5 | 9 | Pf3D7_09_v3:941,830..942,498(-) | Pf3D7_09_v3:941830..942498(-) | Pf3D7_09_v3 | Plasmodium falciparum 3D7 | 44 | OG6_124705 | 0 | 222 | 669 | 27069 | 9.38 | 0 | | | | | | | | | GO:0005737 | cytoplasm | | | GO:0016579 | protein deubiquitination | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0923100OROTU domain-containing protein, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0923100 OR OTU domain-containing protein, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_0931800 | PF3D7_0931800.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 849 | PF3D7_0931800 | proteasome subunit beta type-6, putative | proteasome subunit beta type-6, putative | 813589 | Q8I0U7 | 9 | Pf3D7_09_v3:1,273,082..1,273,930(-) | Pf3D7_09_v3:1273082..1273930(-) | Pf3D7_09_v3 | Plasmodium falciparum 3D7 | 44 | OG6_101390 | 0 | 282 | 849 | 32601 | 6.40 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | GO:0005622 | intracellular | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0931800ORproteasome subunit beta type-6, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0931800 OR proteasome subunit beta type-6, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_0932300 | PF3D7_0932300.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1713 | PF3D7_0932300 | M18 aspartyl aminopeptidase | M18 aspartyl aminopeptidase | 813594 | Q8I2J3 | 9 | Pf3D7_09_v3:1,289,315..1,291,027(-) | Pf3D7_09_v3:1289315..1291027(-) | Pf3D7_09_v3 | Plasmodium falciparum 3D7 | 44 | OG6_102047 | 0 | 570 | 1713 | 65634 | 7.07 | 0 | | | | | GO:0004177;GO:0008270 | aminopeptidase activity;zinc ion binding | GO:0006508 | proteolysis | GO:0005829;GO:0005634 | cytosol;nucleus | | | | | 3.4.11.21 (Aspartyl aminopeptidase) | 3.4.11.21 (Aspartyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0932300ORM18 aspartyl aminopeptidaseANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0932300 OR M18 aspartyl aminopeptidase AND Plasmodium falciparum 3D7 |
|
PF3D7_0933600 | PF3D7_0933600.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1455 | PF3D7_0933600 | mitochondrial-processing peptidase subunit beta, putative | mitochondrial-processing peptidase subunit beta, putative | 813605 | Q8I2I2 | 9 | Pf3D7_09_v3:1,331,349..1,332,803(-) | Pf3D7_09_v3:1331349..1332803(-) | Pf3D7_09_v3 | Plasmodium falciparum 3D7 | 44 | OG6_100777 | 0 | 484 | 1455 | 55734 | 6.78 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | GO:0006508 | proteolysis | GO:0017087 | mitochondrial processing peptidase complex | GO:0004222;GO:0008233 | metalloendopeptidase activity;peptidase activity | GO:0006627 | protein processing involved in protein targeting to mitochondrion | 3.4.24.64 (Mitochondrial processing peptidase) | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0933600ORmitochondrial-processing peptidase subunit beta, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0933600 OR mitochondrial-processing peptidase subunit beta, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_0936700 | PF3D7_0936700.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1299 | PF3D7_0936700 | lysophospholipase, putative | lysophospholipase, putative | 813635 | Q8I2F3 | 9 | Pf3D7_09_v3:1,454,422..1,455,720(+) | Pf3D7_09_v3:1454422..1455720(+) | Pf3D7_09_v3 | Plasmodium falciparum 3D7 | 453 | OG6_100231 | 8 | 432 | 1299 | 49554 | 4.51 | 0 | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0936700ORlysophospholipase, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0936700 OR lysophospholipase, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_0937200 | PF3D7_0937200.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1074 | PF3D7_0937200 | lysophospholipase, putative | lysophospholipase, putative | 813640 | Q8I2E8 | 9 | Pf3D7_09_v3:1,471,851..1,472,924(+) | Pf3D7_09_v3:1471851..1472924(+) | Pf3D7_09_v3 | Plasmodium falciparum 3D7 | 453 | OG6_100231 | 8 | 357 | 1074 | 40803 | 6.51 | 0 | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_0937200ORlysophospholipase, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_0937200 OR lysophospholipase, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1001400 | PF3D7_1001400.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 2766 | PF3D7_1001400 | exported lipase 1 | exported lipase 1 | 810176 | Q8IK22 | 10 | Pf3D7_10_v3:74,661..77,572(-) | Pf3D7_10_v3:74661..77572(-) | Pf3D7_10_v3 | Plasmodium falciparum 3D7 | 117 | OG6_157547 | 3 | 921 | 2766 | 107655 | 4.84 | 1 | HMM: MSVHERIRRSICRIFFFLFFLSLSY, NN: MSVHERIRRSICRIFFFLFFLSLSYKT | NN Sum: 3, NN D: .61, HMM Prob: .27 | | | | | | | GO:0020036;GO:0044164 | Maurer's cleft;host cell cytosol | GO:0005515 | protein binding | | | 3.1.1.5 (Lysophospholipase) | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1001400ORexported lipase 1ANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1001400 OR exported lipase 1 AND Plasmodium falciparum 3D7 |
|
PF3D7_1001600 | PF3D7_1001600.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 2292 | PF3D7_1001600 | exported lipase 2 | exported lipase 2 | 810178 | Q8IK20 | 10 | Pf3D7_10_v3:86,538..89,009(-) | Pf3D7_10_v3:86538..89009(-) | Pf3D7_10_v3 | Plasmodium falciparum 3D7 | 117 | OG6_157547 | 3 | 763 | 2292 | 88563 | 7.09 | 0 | | | | | | | | | GO:0044164 | host cell cytosol | | | | | 3.1.1.23 (Acylglycerol lipase) | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1001600ORexported lipase 2ANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1001600 OR exported lipase 2 AND Plasmodium falciparum 3D7 |
|
PF3D7_1005700 | PF3D7_1005700.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 2319 | PF3D7_1005700 | peptidase, putative | peptidase, putative | | | 10 | Pf3D7_10_v3:247,495..249,940(-) | Pf3D7_10_v3:247495..249940(-) | Pf3D7_10_v3 | Plasmodium falciparum 3D7 | 45 | OG6_100561 | 0 | 772 | 2319 | 93972 | 9.69 | 0 | | | | | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.24.16 (Neurolysin) | 3.4.24.15 (Thimet oligopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1005700ORpeptidase, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1005700 OR peptidase, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1006900 | PF3D7_1006900.1 | 8 | 8 | 1 | | | forward | protein coding | No | 660 | PF3D7_1006900 | PPPDE peptidase, putative | PPPDE peptidase, putative | 810227 | Q8IJX2 | 10 | Pf3D7_10_v3:281,459..283,104(+) | Pf3D7_10_v3:281459..283104(+) | Pf3D7_10_v3 | Plasmodium falciparum 3D7 | 90 | OG6_101256 | 1 | 219 | 660 | 24939 | 4.68 | 0 | | | | | | | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1006900ORPPPDE peptidase, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1006900 OR PPPDE peptidase, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1008400 | PF3D7_1008400.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 1347 | PF3D7_1008400 | 26S protease regulatory subunit 4, putative | 26S protease regulatory subunit 4, putative | 810239 | Q8IJW0 | 10 | Pf3D7_10_v3:347,206..348,667(-) | Pf3D7_10_v3:347206..348667(-) | Pf3D7_10_v3 | Plasmodium falciparum 3D7 | 45 | OG6_101477 | 0 | 448 | 1347 | 49838 | 7.58 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | GO:0005634;GO:0008540 | nucleus;proteasome regulatory particle, base subcomplex | | | GO:0070682;GO:0006511 | proteasome regulatory particle assembly;ubiquitin-dependent protein catabolic process | 3.6.4.8 (Transferred entry: 5.6.1.5) | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1008400OR26S protease regulatory subunit 4, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1008400 OR 26S protease regulatory subunit 4, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1009500 | PF3D7_1009500.1 | 4 | 4 | 1 | | | reverse | protein coding | No | 1128 | PF3D7_1009500 | metalloprotease, putative | metalloprotease, putative | 810250 | Q8IJV0 | 10 | Pf3D7_10_v3:383,044..384,793(-) | Pf3D7_10_v3:383044..384793(-) | Pf3D7_10_v3 | Plasmodium falciparum 3D7 | 45 | OG6_108834 | 0 | 375 | 1128 | 43787 | 9.56 | 0 | | | | | | | | | | | GO:0008237 | metallopeptidase activity | | | 3.4.24.- (Metalloendopeptidases.) | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1009500ORmetalloprotease, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1009500 OR metalloprotease, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1011400 | PF3D7_1011400.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 816 | PF3D7_1011400 | proteasome subunit beta type-5 | proteasome subunit beta type-5 | 810269 | Q8IJT1 | 10 | Pf3D7_10_v3:441,140..441,955(-) | Pf3D7_10_v3:441140..441955(-) | Pf3D7_10_v3 | Plasmodium falciparum 3D7 | 44 | OG6_100897 | 0 | 271 | 816 | 30596 | 5.02 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | GO:0005737;GO:0005634;GO:0005839 | cytoplasm;nucleus;proteasome core complex | GO:0004175 | endopeptidase activity | GO:0006511 | ubiquitin-dependent protein catabolic process | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1011400ORproteasome subunit beta type-5ANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1011400 OR proteasome subunit beta type-5 AND Plasmodium falciparum 3D7 |
|
PF3D7_1015300 | PF3D7_1015300.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1554 | PF3D7_1015300 | methionine aminopeptidase 1b, putative | methionine aminopeptidase 1b, putative | 810308 | Q8IJP2 | 10 | Pf3D7_10_v3:618,440..619,993(+) | Pf3D7_10_v3:618440..619993(+) | Pf3D7_10_v3 | Plasmodium falciparum 3D7 | 43 | OG6_100342 | 0 | 517 | 1554 | 59723 | 7.14 | 0 | | | | | GO:0004177;GO:0008235 | aminopeptidase activity;metalloexopeptidase activity | GO:0006508 | proteolysis | GO:0005634 | nucleus | GO:0008235 | metalloexopeptidase activity | GO:0006508 | proteolysis | 3.4.11.18 (Methionyl aminopeptidase) | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1015300ORmethionine aminopeptidase 1b, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1015300 OR methionine aminopeptidase 1b, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1017200 | PF3D7_1017200.1 | 2 | 2 | 1 | | | forward | protein coding | No | 1593 | PF3D7_1017200 | enoyl-CoA hydratase-related protein, putative | enoyl-CoA hydratase-related protein, putative | 810325 | Q8IJM7 | 10 | Pf3D7_10_v3:692,426..694,218(+) | Pf3D7_10_v3:692426..694218(+) | Pf3D7_10_v3 | Plasmodium falciparum 3D7 | 43 | OG6_134153 | 0 | 530 | 1593 | 62907 | 8.79 | 0 | | | GO:0016020 | membrane | GO:0003857;GO:0008692;GO:0003860;GO:0050662;GO:0004300 | 3-hydroxyacyl-CoA dehydrogenase activity;3-hydroxybutyryl-CoA epimerase activity;3-hydroxyisobutyryl-CoA hydrolase activity;coenzyme binding;enoyl-CoA hydratase activity | GO:0006631;GO:0016042 | fatty acid metabolic process;lipid catabolic process | | | | | | | 3.1.2.4 (3-hydroxyisobutyryl-CoA hydrolase);4.2.1.17 (Enoyl-CoA hydratase) | 3.1.2.4 (3-hydroxyisobutyryl-CoA hydrolase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1017200ORenoyl-CoA hydratase-related protein, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1017200 OR enoyl-CoA hydratase-related protein, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1018300 | PF3D7_1018300.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3048 | PF3D7_1018300 | peptidase, putative | peptidase, putative | 8444986 | C6S3D0 | 10 | Pf3D7_10_v3:729,809..732,856(-) | Pf3D7_10_v3:729809..732856(-) | Pf3D7_10_v3 | Plasmodium falciparum 3D7 | 44 | OG6_124535 | 0 | 1015 | 3048 | 118418 | 5.55 | 2 | HMM: MDVQKKKCKTYYLIAILIWFILISVVLSR, NN: MDVQKKKCKTYYLIAILIWFILISVVLSR | NN Sum: 4, NN D: .77, HMM Prob: .2 | | | | | | | | | | | | | | 3.1.3.16 (Protein-serine/threonine phosphatase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1018300ORpeptidase, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1018300 OR peptidase, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1019900 | PF3D7_1019900.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 375 | PF3D7_1019900 | autophagy-related protein 8 | autophagy-related protein 8 | 810351 | Q8IJK2 | 10 | Pf3D7_10_v3:808,618..808,992(-) | Pf3D7_10_v3:808618..808992(-) | Pf3D7_10_v3 | Plasmodium falciparum 3D7 | 45 | OG6_100707 | 0 | 124 | 375 | 14650 | 8.44 | 0 | | | | | | | | | GO:0020011;GO:0031410;GO:0005829;GO:0016020;GO:0005634 | apicoplast;cytoplasmic vesicle;cytosol;membrane;nucleus | GO:0005515 | protein binding | GO:0042493 | response to drug | | | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1019900ORautophagy-related protein 8ANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1019900 OR autophagy-related protein 8 AND Plasmodium falciparum 3D7 |
|
PF3D7_1030600 | PF3D7_1030600.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1797 | PF3D7_1030600 | tRNA N6-adenosine threonylcarbamoyltransferase | tRNA N6-adenosine threonylcarbamoyltransferase | 810456 | Q8IJ99 | 10 | Pf3D7_10_v3:1,245,880..1,247,676(-) | Pf3D7_10_v3:1245880..1247676(-) | Pf3D7_10_v3 | Plasmodium falciparum 3D7 | 87 | OG6_100288 | 2 | 598 | 1797 | 69573 | 7.68 | 0 | | | | | | | | | GO:0000408;GO:0005737 | EKC/KEOPS complex;cytoplasm | GO:0005515 | protein binding | | | 2.3.1.234 (N(6)-L-threonylcarbamoyladenine synthase) | 2.3.1.234 (N(6)-L-threonylcarbamoyladenine synthase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1030600ORtRNA N6-adenosine threonylcarbamoyltransferaseANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1030600 OR tRNA N6-adenosine threonylcarbamoyltransferase AND Plasmodium falciparum 3D7 |
|
PF3D7_1031400 | PF3D7_1031400.1 | 9 | 8 | 2 | | | forward | protein coding | No | 2817 | PF3D7_1031400 | OTU-like cysteine protease | OTU-like cysteine protease | 810465 | Q8IJ91 | 10 | Pf3D7_10_v3:1,265,079..1,268,785(+) | Pf3D7_10_v3:1265079..1268785(+) | Pf3D7_10_v3 | Plasmodium falciparum 3D7 | 44 | OG6_104209 | 0 | 938 | 2817 | 111708 | 8.62 | 0 | | | | | | | | | GO:0020011;GO:0005829;GO:0031982 | apicoplast;cytosol;vesicle | GO:0008233 | peptidase activity | GO:1903060 | negative regulation of protein lipidation | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1031400OROTU-like cysteine proteaseANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1031400 OR OTU-like cysteine protease AND Plasmodium falciparum 3D7 |
|
PF3D7_1032500 | PF3D7_1032500.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 792 | PF3D7_1032500 | DER1-like protein, putative | DER1-like protein, putative | 810474 | Q8IJ82 | 10 | Pf3D7_10_v3:1,306,241..1,307,532(-) | Pf3D7_10_v3:1306241..1307532(-) | Pf3D7_10_v3 | Plasmodium falciparum 3D7 | 44 | OG6_113960 | 0 | 263 | 792 | 30994 | 9.88 | 5 | HMM: MDISGPEVWYNNLPNVTKYVITLIFLVTLLITCNLL, NN: MDISGPEVWYNNLPNVTKYVITLIFLVTLLITCNLL | NN Sum: 3, NN D: .45, HMM Prob: .01 | | | | | | | GO:0005783;GO:0016021 | endoplasmic reticulum;integral component of membrane | GO:0016887 | ATPase activity | GO:0010564;GO:0030433 | regulation of cell cycle process;ubiquitin-dependent ERAD pathway | | | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1032500ORDER1-like protein, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1032500 OR DER1-like protein, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1033800 | PF3D7_1033800.1 | 8 | 8 | 1 | | | forward | protein coding | No | 1353 | PF3D7_1033800 | plasmepsin VII | plasmepsin VII | 810486 | Q8IJ71 | 10 | Pf3D7_10_v3:1,351,197..1,353,284(+) | Pf3D7_10_v3:1351197..1353284(+) | Pf3D7_10_v3 | Plasmodium falciparum 3D7 | 46 | OG6_139465 | 0 | 450 | 1353 | 52327 | 8.44 | 1 | NN: MNKNIIQIYLFVFILLLKQHIVILK, HMM: MNKNIIQIYLFVFILLLKQHIVILK | NN Sum: 3, NN D: .64, HMM Prob: .15 | GO:0016020 | membrane | | | | | | | GO:0004190 | aspartic-type endopeptidase activity | GO:0006508 | proteolysis | 3.4.23.- (Aspartic endopeptidases.) | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1033800ORplasmepsin VIIANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1033800 OR plasmepsin VII AND Plasmodium falciparum 3D7 |
|
PF3D7_1038900 | PF3D7_1038900.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1080 | PF3D7_1038900 | esterase, putative | esterase, putative | 810536 | Q8IJ22 | 10 | Pf3D7_10_v3:1,562,809..1,563,888(+) | Pf3D7_10_v3:1562809..1563888(+) | Pf3D7_10_v3 | Plasmodium falciparum 3D7 | 453 | OG6_100231 | 8 | 359 | 1080 | 41769 | 6.88 | 0 | | | | | | | | | | | GO:0016788 | hydrolase activity, acting on ester bonds | | | 3.1.-.- (Acting on ester bonds.);3.1.1.5 (Lysophospholipase) | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1038900OResterase, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1038900 OR esterase, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1111900 | PF3D7_1111900.1 | 3 | 3 | 1 | | | forward | protein coding | No | 711 | PF3D7_1111900 | Josephin domain-containing protein, putative | Josephin domain-containing protein, putative | 810673 | Q8IIP4 | 11 | Pf3D7_11_v3:457,936..459,197(+) | Pf3D7_11_v3:457936..459197(+) | Pf3D7_11_v3 | Plasmodium falciparum 3D7 | 43 | OG6_104335 | 0 | 236 | 711 | 28284 | 8.31 | 0 | | | | | GO:0004843 | thiol-dependent ubiquitin-specific protease activity | GO:0016579 | protein deubiquitination | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1111900ORJosephin domain-containing protein, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1111900 OR Josephin domain-containing protein, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1114100 | PF3D7_1114100.1 | 5 | 4 | 2 | | | forward | protein coding | No | 837 | PF3D7_1114100 | rhomboid protease ROM1 | rhomboid protease ROM1 | 810696 | Q8IIM2 | 11 | Pf3D7_11_v3:539,903..541,387(+) | Pf3D7_11_v3:539903..541387(+) | Pf3D7_11_v3 | Plasmodium falciparum 3D7 | 92 | OG6_100562 | 1 | 278 | 837 | 31723 | 9.38 | 7 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | GO:0020009 | microneme | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | 3.4.21.105 (Rhomboid protease) | 3.4.21.- (Serine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1114100ORrhomboid protease ROM1ANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1114100 OR rhomboid protease ROM1 AND Plasmodium falciparum 3D7 |
|
PF3D7_1115300 | PF3D7_1115300.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1449 | PF3D7_1115300 | cysteine proteinase falcipain 2b | cysteine proteinase falcipain 2b | 810708 | Q8I6U5 | 11 | Pf3D7_11_v3:581,250..582,698(-) | Pf3D7_11_v3:581250..582698(-) | Pf3D7_11_v3 | Plasmodium falciparum 3D7 | 157 | OG6_100116 | 3 | 482 | 1449 | 55802 | 8.12 | 1 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | GO:0020020 | food vacuole | GO:0004197 | cysteine-type endopeptidase activity | GO:0006508 | proteolysis | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1115300ORcysteine proteinase falcipain 2bANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1115300 OR cysteine proteinase falcipain 2b AND Plasmodium falciparum 3D7 |
|
PF3D7_1115400 | PF3D7_1115400.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1479 | PF3D7_1115400 | cysteine proteinase falcipain 3 | cysteine proteinase falcipain 3 | 810709 | Q8IIL0 | 11 | Pf3D7_11_v3:584,328..585,806(-) | Pf3D7_11_v3:584328..585806(-) | Pf3D7_11_v3 | Plasmodium falciparum 3D7 | 157 | OG6_100116 | 3 | 492 | 1479 | 56665 | 6.97 | 1 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | GO:0020020 | food vacuole | GO:0004197 | cysteine-type endopeptidase activity | GO:0042540;GO:0006508 | hemoglobin catabolic process;proteolysis | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1115400ORcysteine proteinase falcipain 3ANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1115400 OR cysteine proteinase falcipain 3 AND Plasmodium falciparum 3D7 |
|
PF3D7_1115700 | PF3D7_1115700.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1455 | PF3D7_1115700 | cysteine proteinase falcipain 2a | cysteine proteinase falcipain 2a | 810712 | Q8I6U4 | 11 | Pf3D7_11_v3:592,130..593,584(-) | Pf3D7_11_v3:592130..593584(-) | Pf3D7_11_v3 | Plasmodium falciparum 3D7 | 157 | OG6_100116 | 3 | 484 | 1455 | 55926 | 7.49 | 1 | | | GO:0016020 | membrane | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | GO:0020020 | food vacuole | GO:0004197;GO:0005515 | cysteine-type endopeptidase activity;protein binding | GO:0006508 | proteolysis | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1115700ORcysteine proteinase falcipain 2aANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1115700 OR cysteine proteinase falcipain 2a AND Plasmodium falciparum 3D7 |
|
PF3D7_1116000 | PF3D7_1116000.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 3606 | PF3D7_1116000 | rhoptry neck protein 4 | rhoptry neck protein 4 | | | 11 | Pf3D7_11_v3:602,983..606,918(-) | Pf3D7_11_v3:602983..606918(-) | Pf3D7_11_v3 | Plasmodium falciparum 3D7 | 40 | OG6_211592 | 0 | 1201 | 3606 | 135577 | 5.38 | 0 | NN: MSSVRFFLCIFLVLFTFIDIVKPF, HMM: MSSVRFFLCIFLVLFTFIDIVKPF | NN Sum: 4, NN D: .83, HMM Prob: .84 | | | | | | | GO:0020020;GO:0005634;GO:0020008;GO:1990225 | food vacuole;nucleus;rhoptry;rhoptry neck | GO:0003823;GO:0005515 | antigen binding;protein binding | GO:0044409 | entry into host | | | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1116000ORrhoptry neck protein 4ANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1116000 OR rhoptry neck protein 4 AND Plasmodium falciparum 3D7 |
|
PF3D7_1116100 | PF3D7_1116100.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 5493 | PF3D7_1116100 | serine esterase, putative | serine esterase, putative | 81,07,15,84,44,946 | C6S3F2,Q8IIK5 | 11 | Pf3D7_11_v3:607,902..613,394(-) | Pf3D7_11_v3:607902..613394(-) | Pf3D7_11_v3 | Plasmodium falciparum 3D7 | 44 | OG6_154686 | 0 | 1830 | 5493 | 217076 | 8.89 | 0 | | | | | | | | | GO:0020020 | food vacuole | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1116100ORserine esterase, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1116100 OR serine esterase, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1116200 | PF3D7_1116200.1 | 7 | 7 | 2 | | | reverse | protein coding | No | 660 | PF3D7_1116200 | pyridoxine biosynthesis protein PDX2 | pyridoxine biosynthesis protein PDX2 | 810716 | Q8IIK4 | 11 | Pf3D7_11_v3:615,744..617,186(-) | Pf3D7_11_v3:615744..617186(-) | Pf3D7_11_v3 | Plasmodium falciparum 3D7 | 48 | OG6_103407 | 0 | 219 | 660 | 24563 | 6.91 | 0 | | | | | GO:0004359 | glutaminase activity | GO:0042823;GO:0042819 | pyridoxal phosphate biosynthetic process;vitamin B6 biosynthetic process | GO:0005829 | cytosol | GO:0004359 | glutaminase activity | GO:0000304;GO:0042819 | response to singlet oxygen;vitamin B6 biosynthetic process | 1.4.3.5 (Pyridoxal 5'-phosphate synthase) | 3.5.1.2 (Glutaminase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1116200ORpyridoxine biosynthesis protein PDX2ANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1116200 OR pyridoxine biosynthesis protein PDX2 AND Plasmodium falciparum 3D7 |
|
PF3D7_1116700 | PF3D7_1116700.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2103 | PF3D7_1116700 | dipeptidyl aminopeptidase 1 | dipeptidyl aminopeptidase 1 | 810721 | Q8IIJ9 | 11 | Pf3D7_11_v3:630,779..632,881(-) | Pf3D7_11_v3:630779..632881(-) | Pf3D7_11_v3 | Plasmodium falciparum 3D7 | 90 | OG6_103622 | 1 | 700 | 2103 | 80411 | 6.11 | 1 | HMM: MAKRIFSVSFLLVLLNVLHICIKFSVAD, NN: MAKRIFSVSFLLVLLNVLHICIKFSVAD | NN Sum: 4, NN D: .83, HMM Prob: .98 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | GO:0020020;GO:0020003 | food vacuole;symbiont-containing vacuole | | | GO:0042493 | response to drug | 3.4.14.1 (Dipeptidyl-peptidase I) | 3.4.14.1 (Dipeptidyl-peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1116700ORdipeptidyl aminopeptidase 1ANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1116700 OR dipeptidyl aminopeptidase 1 AND Plasmodium falciparum 3D7 |
|
PF3D7_1116800 | PF3D7_1116800.1 | 4 | 4 | 1 | | | reverse | protein coding | No | 2721 | PF3D7_1116800 | heat shock protein 101 | heat shock protein 101 | 810722 | Q8IIJ8 | 11 | Pf3D7_11_v3:636,094..639,511(-) | Pf3D7_11_v3:636094..639511(-) | Pf3D7_11_v3 | Plasmodium falciparum 3D7 | 95 | OG6_100223 | 1 | 906 | 2721 | 102872 | 9.66 | 1 | NN: MTRRYLKYYIFVTLLFFVQVINNVLCA, HMM: MTRRYLKYYIFVTLLFFVQVINNVLCA | NN Sum: 4, NN D: .83, HMM Prob: .79 | | | GO:0005524 | ATP binding | GO:0019538 | protein metabolic process | GO:0020036;GO:0097619;GO:0020007;GO:1903561;GO:0020026;GO:0005634;GO:0020003;GO:0020005 | Maurer's cleft;PTEX complex;apical complex;extracellular vesicle;merozoite dense granule;nucleus;symbiont-containing vacuole;symbiont-containing vacuole membrane | GO:0005515 | protein binding | GO:0043335;GO:0009408;GO:0006986;GO:0044053 | protein unfolding;response to heat;response to unfolded protein;translocation of peptides or proteins into host cell cytoplasm | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1116800ORheat shock protein 101ANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1116800 OR heat shock protein 101 AND Plasmodium falciparum 3D7 |
|
PF3D7_1117100 | PF3D7_1117100.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1398 | PF3D7_1117100 | ubiquitin carboxyl-terminal hydrolase UCH54 | ubiquitin carboxyl-terminal hydrolase UCH54 | 810724 | Q8IIJ6 | 11 | Pf3D7_11_v3:652,579..653,976(+) | Pf3D7_11_v3:652579..653976(+) | Pf3D7_11_v3 | Plasmodium falciparum 3D7 | 44 | OG6_102753 | 0 | 465 | 1398 | 54459 | 5.36 | 0 | | | GO:0005622 | intracellular | GO:0004843 | thiol-dependent ubiquitin-specific protease activity | GO:0006511 | ubiquitin-dependent protein catabolic process | | | GO:0019784 | NEDD8-specific protease activity | GO:0000338;GO:0016579;GO:0006511 | protein deneddylation;protein deubiquitination;ubiquitin-dependent protein catabolic process | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1117100ORubiquitin carboxyl-terminal hydrolase UCH54ANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1117100 OR ubiquitin carboxyl-terminal hydrolase UCH54 AND Plasmodium falciparum 3D7 |
|
PF3D7_1118300 | PF3D7_1118300.1 | 1 | 1 | 1 | | | forward | protein coding | No | 4467 | PF3D7_1118300 | insulinase, putative | insulinase, putative | 810736 | Q8III5 | 11 | Pf3D7_11_v3:694,655..699,121(+) | Pf3D7_11_v3:694655..699121(+) | Pf3D7_11_v3 | Plasmodium falciparum 3D7 | 47 | OG6_105738 | 0 | 1488 | 4467 | 173623 | 5.06 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | 3.4.24.56 (Insulysin) | 3.4.24.56 (Insulysin) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1118300ORinsulinase, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1118300 OR insulinase, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1119600 | PF3D7_1119600.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3159 | PF3D7_1119600 | ATP-dependent zinc metalloprotease FTSH, putative | ATP-dependent zinc metalloprotease FTSH, putative | 810750 | Q8IIH1 | 11 | Pf3D7_11_v3:738,513..741,671(-) | Pf3D7_11_v3:738513..741671(-) | Pf3D7_11_v3 | Plasmodium falciparum 3D7 | 91 | OG6_100384 | 1 | 1052 | 3159 | 120689 | 9.84 | 1 | | | GO:0016021;GO:0016020 | integral component of membrane;membrane | GO:0005524;GO:0004222;GO:0008270 | ATP binding;metalloendopeptidase activity;zinc ion binding | GO:0006508 | proteolysis | | | | | | | 3.4.24.- (Metalloendopeptidases.) | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1119600ORATP-dependent zinc metalloprotease FTSH, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1119600 OR ATP-dependent zinc metalloprotease FTSH, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1120400 | PF3D7_1120400.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 1149 | PF3D7_1120400 | alpha/beta hydrolase fold domain containing protein, putative | alpha/beta hydrolase fold domain containing protein, putative | 810758 | Q8IIG3 | 11 | Pf3D7_11_v3:769,252..770,600(-) | Pf3D7_11_v3:769252..770600(-) | Pf3D7_11_v3 | Plasmodium falciparum 3D7 | 135 | OG6_100915 | 2 | 382 | 1149 | 44725 | 7.83 | 0 | | | | | GO:0016787 | hydrolase activity | | | | | | | | | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1120400ORalpha/beta hydrolase fold domain containing protein, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1120400 OR alpha/beta hydrolase fold domain containing protein, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1121800 | PF3D7_1121800.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 6075 | PF3D7_1121800 | peptidase M16, putative | peptidase M16, putative | 810773 | Q8IIE8 | 11 | Pf3D7_11_v3:823,239..829,313(-) | Pf3D7_11_v3:823239..829313(-) | Pf3D7_11_v3 | Plasmodium falciparum 3D7 | 43 | OG6_108964 | 0 | 2024 | 6075 | 238896 | 6.97 | 0 | NN: MKHTKITKYLTINFFILLTLVFQKYSSCQ, HMM: MKHTKITKYLTINFFILLTLVFQKYSSCQ | NN Sum: 4, NN D: .66, HMM Prob: .57 | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | 3.4.24.55 (Pitrilysin) | 3.4.24.55 (Pitrilysin) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1121800ORpeptidase M16, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1121800 OR peptidase M16, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1126600 | PF3D7_1126600.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2049 | PF3D7_1126600 | steryl ester hydrolase, putative | steryl ester hydrolase, putative | 810823 | Q8II98 | 11 | Pf3D7_11_v3:1,037,643..1,039,691(-) | Pf3D7_11_v3:1037643..1039691(-) | Pf3D7_11_v3 | Plasmodium falciparum 3D7 | 35 | OG6_100408 | 0 | 682 | 2049 | 81094 | 9.35 | 0 | | | GO:0005576 | extracellular region | GO:0016787 | hydrolase activity | GO:0016042;GO:0006629 | lipid catabolic process;lipid metabolic process | | | | | | | 3.1.1.13 (Sterol esterase) | 3.1.1.3 (Triacylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1126600ORsteryl ester hydrolase, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1126600 OR steryl ester hydrolase, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1128700 | PF3D7_1128700.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1482 | PF3D7_1128700 | GPI-anchor transamidase, putative | GPI-anchor transamidase, putative | 810845 | Q8II76 | 11 | Pf3D7_11_v3:1,113,996..1,115,477(+) | Pf3D7_11_v3:1113996..1115477(+) | Pf3D7_11_v3 | Plasmodium falciparum 3D7 | 44 | OG6_101767 | 0 | 493 | 1482 | 59688 | 9.15 | 2 | HMM: MGIKIIIYIFFLSWAKWVCGS, NN: MGIKIIIYIFFLSWAKWVCGS | NN Sum: 4, NN D: .86, HMM Prob: .91 | | | GO:0008233 | peptidase activity | GO:0006508 | proteolysis | | | GO:0003923 | GPI-anchor transamidase activity | GO:0016255 | attachment of GPI anchor to protein | 3.4.13.19 (Membrane dipeptidase) | 3.-.-.- (Hydrolases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1128700ORGPI-anchor transamidase, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1128700 OR GPI-anchor transamidase, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1130400 | PF3D7_1130400.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1320 | PF3D7_1130400 | 26S protease regulatory subunit 6A, putative | 26S protease regulatory subunit 6A, putative | 810861 | Q8II60 | 11 | Pf3D7_11_v3:1,168,879..1,170,198(+) | Pf3D7_11_v3:1168879..1170198(+) | Pf3D7_11_v3 | Plasmodium falciparum 3D7 | 44 | OG6_101915 | 0 | 439 | 1320 | 49540 | 4.82 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | GO:0005634;GO:0008540 | nucleus;proteasome regulatory particle, base subcomplex | GO:0016887;GO:0004175 | ATPase activity;endopeptidase activity | GO:0070682;GO:0006508;GO:0006511 | proteasome regulatory particle assembly;proteolysis;ubiquitin-dependent protein catabolic process | 3.6.4.8 (Transferred entry: 5.6.1.5) | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1130400OR26S protease regulatory subunit 6A, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1130400 OR 26S protease regulatory subunit 6A, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1133400 | PF3D7_1133400.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1869 | PF3D7_1133400 | apical membrane antigen 1 | apical membrane antigen 1 | 810891 | Q7KQK5 | 11 | Pf3D7_11_v3:1,293,856..1,295,724(+) | Pf3D7_11_v3:1293856..1295724(+) | Pf3D7_11_v3 | Plasmodium falciparum 3D7 | 44 | OG6_130922 | 0 | 622 | 1869 | 72041 | 5.23 | 1 | HMM: MRKLYCVLLLSAFEFTYMINFGRGQ, NN: MRKLYCVLLLSAFEFTYMINFGRGQ | NN Sum: 4, NN D: .62, HMM Prob: .9 | GO:0016020 | membrane | | | GO:0009405 | pathogenesis | GO:0020007;GO:0016021;GO:0020009;GO:0005886 | apical complex;integral component of membrane;microneme;plasma membrane | GO:0046812;GO:0005515 | host cell surface binding;protein binding | GO:0044409 | entry into host | | | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1133400ORapical membrane antigen 1ANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1133400 OR apical membrane antigen 1 AND Plasmodium falciparum 3D7 |
|
PF3D7_1136900 | PF3D7_1136900.1 | 2 | 2 | 1 | | | forward | protein coding | No | 4026 | PF3D7_1136900 | subtilisin-like protease 2 | subtilisin-like protease 2 | 810927 | Q8IHZ5 | 11 | Pf3D7_11_v3:1,456,151..1,460,319(+) | Pf3D7_11_v3:1456151..1460319(+) | Pf3D7_11_v3 | Plasmodium falciparum 3D7 | 42 | OG6_100121 | 0 | 1341 | 4026 | 154798 | 8.58 | 1 | HMM: MLNIIYVVSLILIKFIFYKECN, NN: MLNIIYVVSLILIKFIFYK | NN Sum: 4, NN D: .61, HMM Prob: 0 | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0016021;GO:0020026;GO:0020009;GO:0044310 | integral component of membrane;merozoite dense granule;microneme;osmiophilic body | GO:0008236 | serine-type peptidase activity | GO:0051604;GO:0006508 | protein maturation;proteolysis | 3.4.21.62 (Subtilisin) | 3.4.21.66 (Thermitase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1136900ORsubtilisin-like protease 2ANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1136900 OR subtilisin-like protease 2 AND Plasmodium falciparum 3D7 |
|
PF3D7_1141700 | PF3D7_1141700.1 | 5 | 5 | 1 | | | forward | protein coding | No | 942 | PF3D7_1141700 | OTU domain-containing protein, putative | OTU domain-containing protein, putative | 810974 | Q8IHU8 | 11 | Pf3D7_11_v3:1,669,951..1,671,512(+) | Pf3D7_11_v3:1669951..1671512(+) | Pf3D7_11_v3 | Plasmodium falciparum 3D7 | 43 | OG6_102788 | 0 | 313 | 942 | 37664 | 5.38 | 0 | | | | | | | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1141700OROTU domain-containing protein, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1141700 OR OTU domain-containing protein, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1143000 | PF3D7_1143000.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1149 | PF3D7_1143000 | alpha/beta hydrolase, putative | alpha/beta hydrolase, putative | 8444990 | C6S3G2 | 11 | Pf3D7_11_v3:1,717,546..1,718,694(+) | Pf3D7_11_v3:1717546..1718694(+) | Pf3D7_11_v3 | Plasmodium falciparum 3D7 | 44 | OG6_101420 | 0 | 382 | 1149 | 44753 | 9.23 | 0 | HMM: MPILFYIFYIFCFPLINLS, NN: MPILFYIFYIFCFPLINLS | NN Sum: 4, NN D: .7, HMM Prob: .68 | | | | | | | GO:0020011 | apicoplast | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1143000ORalpha/beta hydrolase, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1143000 OR alpha/beta hydrolase, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1202100 | PF3D7_1202100.1 | 8 | 7 | 2 | | | forward | protein coding | No | 1206 | PF3D7_1202100 | SRAP domain-containing protein, putative | SRAP domain-containing protein, putative | 811074 | Q8I624 | 12 | Pf3D7_12_v3:113,787..115,923(+) | Pf3D7_12_v3:113787..115923(+) | Pf3D7_12_v3 | Plasmodium falciparum 3D7 | 41 | OG6_102318 | 0 | 401 | 1206 | 46668 | 5.07 | 0 | | | | | | | | | | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1202100ORSRAP domain-containing protein, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1202100 OR SRAP domain-containing protein, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1205900 | PF3D7_1205900.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3249 | PF3D7_1205900 | conserved protein, unknown function | conserved protein, unknown function | 811112 | Q8I5Y6 | 12 | Pf3D7_12_v3:264,615..267,863(-) | Pf3D7_12_v3:264615..267863(-) | Pf3D7_12_v3 | Plasmodium falciparum 3D7 | 43 | OG6_102131 | 0 | 1082 | 3249 | 124156 | 6.07 | 5 | | | GO:0016021;GO:0016020 | integral component of membrane;membrane | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1205900ORconserved protein, unknown functionANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1205900 OR conserved protein, unknown function AND Plasmodium falciparum 3D7 |
|
PF3D7_1217900 | PF3D7_1217900.1 | 3 | 3 | 1 | | | forward | protein coding | No | 1452 | PF3D7_1217900 | PPPDE peptidase domain-containing protein, putative | PPPDE peptidase domain-containing protein, putative | 811225 | Q8I5M9 | 12 | Pf3D7_12_v3:700,531..702,211(+) | Pf3D7_12_v3:700531..702211(+) | Pf3D7_12_v3 | Plasmodium falciparum 3D7 | 44 | OG6_102579 | 0 | 483 | 1452 | 56089 | 6.24 | 0 | | | | | | | | | | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1217900ORPPPDE peptidase domain-containing protein, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1217900 OR PPPDE peptidase domain-containing protein, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1226800 | PF3D7_1226800.1 | 5 | 5 | 1 | | | forward | protein coding | No | 1146 | PF3D7_1226800 | ataxin-3, putative | ataxin-3, putative | 811311 | Q8I5F0 | 12 | Pf3D7_12_v3:1,085,387..1,087,264(+) | Pf3D7_12_v3:1085387..1087264(+) | Pf3D7_12_v3 | Plasmodium falciparum 3D7 | 44 | OG6_104644 | 0 | 381 | 1146 | 44979 | 5.67 | 0 | | | GO:0005634 | nucleus | GO:0016787;GO:0004843 | hydrolase activity;thiol-dependent ubiquitin-specific protease activity | GO:0016579 | protein deubiquitination | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1226800ORataxin-3, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1226800 OR ataxin-3, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1230400 | PF3D7_1230400.1 | 5 | 5 | 1 | | | reverse | protein coding | No | 624 | PF3D7_1230400 | ATP-dependent protease subunit ClpQ | ATP-dependent protease subunit ClpQ | 811345 | Q8I5B6 | 12 | Pf3D7_12_v3:1,251,914..1,253,067(-) | Pf3D7_12_v3:1251914..1253067(-) | Pf3D7_12_v3 | Plasmodium falciparum 3D7 | 44 | OG6_107204 | 0 | 207 | 624 | 22870 | 8.27 | 0 | | | GO:0009376;GO:0005839 | HslUV protease complex;proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0006508;GO:0051603 | proteolysis;proteolysis involved in cellular protein catabolic process | GO:0005739 | mitochondrion | GO:0004176;GO:0003729;GO:0070011;GO:0005515 | ATP-dependent peptidase activity;mRNA binding;peptidase activity, acting on L-amino acid peptides;protein binding | | | 3.4.21.92 (Endopeptidase Clp);3.4.25.2 (HslU--HslV peptidase);3.5.1.98 (Histone deacetylase) | 3.4.25.2 (HslU--HslV peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1230400ORATP-dependent protease subunit ClpQANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1230400 OR ATP-dependent protease subunit ClpQ AND Plasmodium falciparum 3D7 |
|
PF3D7_1233900 | PF3D7_1233900.1 | 3 | 3 | 1 | | | forward | protein coding | No | 3081 | PF3D7_1233900 | sentrin-specific protease 1 | sentrin-specific protease 1 | 811379 | Q8I583 | 12 | Pf3D7_12_v3:1,407,674..1,411,030(+) | Pf3D7_12_v3:1407674..1411030(+) | Pf3D7_12_v3 | Plasmodium falciparum 3D7 | 44 | OG6_101235 | 0 | 1026 | 3081 | 123224 | 7.90 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | GO:0005634 | nucleus | GO:0016929 | SUMO-specific protease activity | | | 3.4.22.68 (Ulp1 peptidase) | 3.4.22.68 (Ulp1 peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1233900ORsentrin-specific protease 1ANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1233900 OR sentrin-specific protease 1 AND Plasmodium falciparum 3D7 |
|
PF3D7_1234400 | PF3D7_1234400.1 | 6 | 6 | 1 | | | reverse | protein coding | No | 1971 | PF3D7_1234400 | microgamete surface protein MiGS, putative | microgamete surface protein MiGS, putative | 811384 | Q8I578 | 12 | Pf3D7_12_v3:1,436,790..1,439,349(-) | Pf3D7_12_v3:1436790..1439349(-) | Pf3D7_12_v3 | Plasmodium falciparum 3D7 | 44 | OG6_127652 | 0 | 656 | 1971 | 77092 | 7.85 | 2 | NN: MLFLLHIYIPQNSVAY, HMM: MLFLLHIYIPQNSVAY | NN Sum: 4, NN D: .45, HMM Prob: .03 | GO:0016020 | membrane | | | | | GO:0009986;GO:0044310 | cell surface;osmiophilic body | | | | | | 3.4.23.3 (Gastricsin) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1234400ORmicrogamete surface protein MiGS, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1234400 OR microgamete surface protein MiGS, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1239700 | PF3D7_1239700.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2643 | PF3D7_1239700 | ATP-dependent zinc metalloprotease FTSH 1 | ATP-dependent zinc metalloprotease FTSH 1 | 811437 | Q8I526 | 12 | Pf3D7_12_v3:1,655,487..1,658,129(+) | Pf3D7_12_v3:1655487..1658129(+) | Pf3D7_12_v3 | Plasmodium falciparum 3D7 | 91 | OG6_100384 | 1 | 880 | 2643 | 100956 | 9.15 | 1 | | | GO:0016020 | membrane | GO:0005524;GO:0004222 | ATP binding;metalloendopeptidase activity | GO:0006508 | proteolysis | GO:0020011;GO:0005739 | apicoplast;mitochondrion | GO:0005524;GO:0004176;GO:0004222 | ATP binding;ATP-dependent peptidase activity;metalloendopeptidase activity | GO:0009657;GO:0006508;GO:0042493 | plastid organization;proteolysis;response to drug | 3.4.24.- (Metalloendopeptidases.) | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1239700ORATP-dependent zinc metalloprotease FTSH 1ANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1239700 OR ATP-dependent zinc metalloprotease FTSH 1 AND Plasmodium falciparum 3D7 |
|
PF3D7_1240000 | PF3D7_1240000.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1626 | PF3D7_1240000 | 3-hydroxyisobutyryl-CoA hydrolase, putative | 3-hydroxyisobutyryl-CoA hydrolase, putative | 811440 | Q8I523 | 12 | Pf3D7_12_v3:1,682,835..1,684,460(+) | Pf3D7_12_v3:1682835..1684460(+) | Pf3D7_12_v3 | Plasmodium falciparum 3D7 | 49 | OG6_102025 | 0 | 541 | 1626 | 63855 | 9.10 | 0 | | | | | GO:0003860 | 3-hydroxyisobutyryl-CoA hydrolase activity | | | | | GO:0003860 | 3-hydroxyisobutyryl-CoA hydrolase activity | | | 3.1.2.4 (3-hydroxyisobutyryl-CoA hydrolase) | 3.1.2.4 (3-hydroxyisobutyryl-CoA hydrolase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1240000OR3-hydroxyisobutyryl-CoA hydrolase, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1240000 OR 3-hydroxyisobutyryl-CoA hydrolase, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1247800 | PF3D7_1247800.1 | 8 | 8 | 1 | | | forward | protein coding | No | 1773 | PF3D7_1247800 | dipeptidyl aminopeptidase 2 | dipeptidyl aminopeptidase 2 | 811510 | Q8I0V1 | 12 | Pf3D7_12_v3:1,968,163..1,971,074(+) | Pf3D7_12_v3:1968163..1971074(+) | Pf3D7_12_v3 | Plasmodium falciparum 3D7 | 90 | OG6_103622 | 1 | 590 | 1773 | 69641 | 8.27 | 0 | HMM: MNTFYIFFLFVLTTCFVKGD, NN: MNTFYIFFLFVLTTCFVKGD | NN Sum: 4, NN D: .76, HMM Prob: .96 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | GO:0071944;GO:0005737;GO:0044310 | cell periphery;cytoplasm;osmiophilic body | GO:0008239 | dipeptidyl-peptidase activity | GO:0035891;GO:0006508 | exit from host cell;proteolysis | 3.4.14.1 (Dipeptidyl-peptidase I) | 3.4.14.1 (Dipeptidyl-peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1247800ORdipeptidyl aminopeptidase 2ANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1247800 OR dipeptidyl aminopeptidase 2 AND Plasmodium falciparum 3D7 |
|
PF3D7_1248900 | PF3D7_1248900.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1308 | PF3D7_1248900 | 26S protease regulatory subunit 8, putative | 26S protease regulatory subunit 8, putative | 811521 | Q8I4U5 | 12 | Pf3D7_12_v3:2,002,723..2,004,030(-) | Pf3D7_12_v3:2002723..2004030(-) | Pf3D7_12_v3 | Plasmodium falciparum 3D7 | 44 | OG6_101513 | 0 | 435 | 1308 | 49544 | 7.05 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | GO:0005634;GO:0008540 | nucleus;proteasome regulatory particle, base subcomplex | | | GO:0070682;GO:0043161 | proteasome regulatory particle assembly;proteasome-mediated ubiquitin-dependent protein catabolic process | 3.6.4.8 (Transferred entry: 5.6.1.5) | 3.6.4.3 (Transferred entry: 5.6.1.1) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1248900OR26S protease regulatory subunit 8, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1248900 OR 26S protease regulatory subunit 8, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1252600 | PF3D7_1252600.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1362 | PF3D7_1252600 | esterase, putative | esterase, putative | 811556 | Q8I4R0 | 12 | Pf3D7_12_v3:2,150,554..2,151,915(+) | Pf3D7_12_v3:2150554..2151915(+) | Pf3D7_12_v3 | Plasmodium falciparum 3D7 | 453 | OG6_100231 | 8 | 453 | 1362 | 52891 | 5.16 | 0 | | | | | | | | | GO:0020036 | Maurer's cleft | GO:0016788;GO:0016298 | hydrolase activity, acting on ester bonds;lipase activity | GO:0006629 | lipid metabolic process | 3.1.-.- (Acting on ester bonds.);3.1.1.5 (Lysophospholipase) | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1252600OResterase, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1252600 OR esterase, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1305600 | PF3D7_1305600.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 993 | PF3D7_1305600 | site-2 protease S2P, putative | site-2 protease S2P, putative | 814007 | Q8IEQ9 | 13 | Pf3D7_13_v3:274,073..275,200(-) | Pf3D7_13_v3:274073..275200(-) | Pf3D7_13_v3 | Plasmodium falciparum 3D7 | 43 | OG6_107106 | 0 | 330 | 993 | 38978 | 8.46 | 7 | | | | | | | | | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1305600ORsite-2 protease S2P, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1305600 OR site-2 protease S2P, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1306400 | PF3D7_1306400.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1182 | PF3D7_1306400 | 26S protease regulatory subunit 10B, putative | 26S protease regulatory subunit 10B, putative | 814012 | Q8IEQ1 | 13 | Pf3D7_13_v3:297,178..298,359(-) | Pf3D7_13_v3:297178..298359(-) | Pf3D7_13_v3 | Plasmodium falciparum 3D7 | 44 | OG6_101751 | 0 | 393 | 1182 | 44676 | 9.32 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | GO:1903561;GO:0020020;GO:0005634;GO:0008540 | extracellular vesicle;food vacuole;nucleus;proteasome regulatory particle, base subcomplex | | | GO:0070682;GO:0006511 | proteasome regulatory particle assembly;ubiquitin-dependent protein catabolic process | 3.6.4.8 (Transferred entry: 5.6.1.5) | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1306400OR26S protease regulatory subunit 10B, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1306400 OR 26S protease regulatory subunit 10B, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1311500 | PF3D7_1311500.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 1263 | PF3D7_1311500 | 26S protease regulatory subunit 7, putative | 26S protease regulatory subunit 7, putative | 814041 | Q8IEK3 | 13 | Pf3D7_13_v3:489,927..491,609(-) | Pf3D7_13_v3:489927..491609(-) | Pf3D7_13_v3 | Plasmodium falciparum 3D7 | 44 | OG6_101899 | 0 | 420 | 1263 | 46834 | 6.67 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | GO:0005634;GO:0005838 | nucleus;proteasome regulatory particle | GO:0005515 | protein binding | GO:0006511 | ubiquitin-dependent protein catabolic process | 3.6.4.8 (Transferred entry: 5.6.1.5) | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1311500OR26S protease regulatory subunit 7, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1311500 OR 26S protease regulatory subunit 7, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1311800 | PF3D7_1311800.1 | 1 | 1 | 1 | | | forward | protein coding | No | 3258 | PF3D7_1311800 | M1-family alanyl aminopeptidase | M1-family alanyl aminopeptidase | 813945 | Q8IEK1 | 13 | Pf3D7_13_v3:501,790..505,047(+) | Pf3D7_13_v3:501790..505047(+) | Pf3D7_13_v3 | Plasmodium falciparum 3D7 | 44 | OG6_106799 | 0 | 1085 | 3258 | 126061 | 7.64 | 1 | | | | | GO:0008237;GO:0008270 | metallopeptidase activity;zinc ion binding | | | GO:0009986;GO:0005737;GO:0020020;GO:0020009;GO:0005634 | cell surface;cytoplasm;food vacuole;microneme;nucleus | GO:0004177;GO:0004222 | aminopeptidase activity;metalloendopeptidase activity | GO:0006508;GO:0042493 | proteolysis;response to drug | 3.4.11.2 (Membrane alanyl aminopeptidase) | 3.4.11.2 (Membrane alanyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1311800ORM1-family alanyl aminopeptidaseANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1311800 OR M1-family alanyl aminopeptidase AND Plasmodium falciparum 3D7 |
|
PF3D7_1317000 | PF3D7_1317000.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1923 | PF3D7_1317000 | U4/U6.U5 tri-snRNP-associated protein 2, putative | U4/U6.U5 tri-snRNP-associated protein 2, putative | 814072 | Q8I6Z8 | 13 | Pf3D7_13_v3:708,346..710,268(+) | Pf3D7_13_v3:708346..710268(+) | Pf3D7_13_v3 | Plasmodium falciparum 3D7 | 45 | OG6_102786 | 0 | 640 | 1923 | 74635 | 7.96 | 0 | | | | | GO:0036459;GO:0008270 | thiol-dependent ubiquitinyl hydrolase activity;zinc ion binding | GO:0016579 | protein deubiquitination | | | | | GO:0000398;GO:0000245 | mRNA splicing, via spliceosome;spliceosomal complex assembly | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1317000ORU4/U6.U5 tri-snRNP-associated protein 2, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1317000 OR U4/U6.U5 tri-snRNP-associated protein 2, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1319100 | PF3D7_1319100.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2412 | PF3D7_1319100 | ubiquitin carboxyl-terminal hydrolase MINDY, putative | ubiquitin carboxyl-terminal hydrolase MINDY, putative | 814081 | Q8IEC5 | 13 | Pf3D7_13_v3:789,437..791,848(+) | Pf3D7_13_v3:789437..791848(+) | Pf3D7_13_v3 | Plasmodium falciparum 3D7 | 44 | OG6_102202 | 0 | 803 | 2412 | 94812 | 8.27 | 0 | | | | | GO:1990380;GO:0004843 | Lys48-specific deubiquitinase activity;thiol-dependent ubiquitin-specific protease activity | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1319100ORubiquitin carboxyl-terminal hydrolase MINDY, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1319100 OR ubiquitin carboxyl-terminal hydrolase MINDY, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1320400 | PF3D7_1320400.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1080 | PF3D7_1320400 | type I signal peptidase | type I signal peptidase | 814089 | Q8IEA9 | 13 | Pf3D7_13_v3:841,671..842,750(-) | Pf3D7_13_v3:841671..842750(-) | Pf3D7_13_v3 | Plasmodium falciparum 3D7 | 44 | OG6_100609 | 0 | 359 | 1080 | 43386 | 10.23 | 0 | | | GO:0016021;GO:0016020 | integral component of membrane;membrane | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | GO:0016234 | inclusion body | | | GO:0009056;GO:0006465 | catabolic process;signal peptide processing | 3.4.21.89 (Signal peptidase I) | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1320400ORtype I signal peptidaseANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1320400 OR type I signal peptidase AND Plasmodium falciparum 3D7 |
|
PF3D7_1323500 | PF3D7_1323500.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1773 | PF3D7_1323500 | plasmepsin V | plasmepsin V | 814104 | Q8I6Z5 | 13 | Pf3D7_13_v3:975,403..977,175(+) | Pf3D7_13_v3:975403..977175(+) | Pf3D7_13_v3 | Plasmodium falciparum 3D7 | 44 | OG6_107443 | 0 | 590 | 1773 | 68479 | 7.66 | 2 | HMM: MNNYFLRKENFFILFCFVFVSIFFVSNVTIIKCN, NN: MNNYFLRKENFFILFCFVFVSIFFVSNVTIIKCN | NN Sum: 3, NN D: .52, HMM Prob: 0 | | | | | | | GO:0005783;GO:0016021;GO:0097038 | endoplasmic reticulum;integral component of membrane;perinuclear endoplasmic reticulum | GO:0004190;GO:0005515 | aspartic-type endopeptidase activity;protein binding | GO:0006508;GO:0042493 | proteolysis;response to drug | 3.4.23.- (Aspartic endopeptidases.) | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1323500ORplasmepsin VANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1323500 OR plasmepsin V AND Plasmodium falciparum 3D7 |
|
PF3D7_1328100 | PF3D7_1328100.1 | 1 | 1 | 1 | | | forward | protein coding | No | 813 | PF3D7_1328100 | proteasome subunit beta type-7, putative | proteasome subunit beta type-7, putative | 814126 | Q8I6T3 | 13 | Pf3D7_13_v3:1,184,208..1,185,020(+) | Pf3D7_13_v3:1184208..1185020(+) | Pf3D7_13_v3 | Plasmodium falciparum 3D7 | 43 | OG6_101382 | 0 | 270 | 813 | 29961 | 7.92 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | GO:0044310;GO:0005839 | osmiophilic body;proteasome core complex | GO:0004175 | endopeptidase activity | GO:0006511 | ubiquitin-dependent protein catabolic process | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1328100ORproteasome subunit beta type-7, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1328100 OR proteasome subunit beta type-7, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1328500 | PF3D7_1328500.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3015 | PF3D7_1328500 | alpha/beta-hydrolase, putative | alpha/beta-hydrolase, putative | 814123 | Q8IE45 | 13 | Pf3D7_13_v3:1,204,186..1,207,200(-) | Pf3D7_13_v3:1204186..1207200(-) | Pf3D7_13_v3 | Plasmodium falciparum 3D7 | 117 | OG6_157547 | 3 | 1004 | 3015 | 115888 | 5.63 | 0 | | | | | | | | | GO:0005737 | cytoplasm | GO:0016787 | hydrolase activity | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1328500ORalpha/beta-hydrolase, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1328500 OR alpha/beta-hydrolase, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1331300 | PF3D7_1331300.1 | 2 | 2 | 1 | | | forward | protein coding | No | 555 | PF3D7_1331300 | signal peptidase complex catalytic subunit SEC11 | signal peptidase complex catalytic subunit SEC11 | 813720 | Q8IE14 | 13 | Pf3D7_13_v3:1,309,177..1,310,006(+) | Pf3D7_13_v3:1309177..1310006(+) | Pf3D7_13_v3 | Plasmodium falciparum 3D7 | 44 | OG6_100807 | 0 | 184 | 555 | 21124 | 6.96 | 3 | | | GO:0016021;GO:0016020 | integral component of membrane;membrane | GO:0008233;GO:0008236 | peptidase activity;serine-type peptidase activity | GO:0006465 | signal peptide processing | GO:0005783;GO:0005787 | endoplasmic reticulum;signal peptidase complex | GO:0008233;GO:0005515 | peptidase activity;protein binding | GO:0006465 | signal peptide processing | 3.4.21.89 (Signal peptidase I) | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1331300ORsignal peptidase complex catalytic subunit SEC11ANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1331300 OR signal peptidase complex catalytic subunit SEC11 AND Plasmodium falciparum 3D7 |
|
PF3D7_1337000 | PF3D7_1337000.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 2898 | PF3D7_1337000 | mitochondrial intermediate peptidase, putative | mitochondrial intermediate peptidase, putative | 813739 | Q8IDW2 | 13 | Pf3D7_13_v3:1,491,265..1,494,308(-) | Pf3D7_13_v3:1491265..1494308(-) | Pf3D7_13_v3 | Plasmodium falciparum 3D7 | 44 | OG6_102110 | 0 | 965 | 2898 | 115534 | 8.63 | 0 | | | | | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | GO:0005739 | mitochondrion | | | | | 3.4.24.59 (Mitochondrial intermediate peptidase) | 3.4.24.59 (Mitochondrial intermediate peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1337000ORmitochondrial intermediate peptidase, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1337000 OR mitochondrial intermediate peptidase, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1338400 | PF3D7_1338400.1 | 8 | 8 | 1 | | | reverse | protein coding | No | 1332 | PF3D7_1338400 | SprT-like domain-containing protein, putative | SprT-like domain-containing protein, putative | 813746 | Q8IDU9 | 13 | Pf3D7_13_v3:1,550,949..1,553,103(-) | Pf3D7_13_v3:1550949..1553103(-) | Pf3D7_13_v3 | Plasmodium falciparum 3D7 | 45 | OG6_104384 | 0 | 443 | 1332 | 52812 | 8.10 | 0 | | | | | GO:0003677;GO:0008270 | DNA binding;zinc ion binding | GO:0006281 | DNA repair | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1338400ORSprT-like domain-containing protein, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1338400 OR SprT-like domain-containing protein, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1345200 | PF3D7_1345200.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1710 | PF3D7_1345200 | rhomboid protease ROM6, putative | rhomboid protease ROM6, putative | 814207 | Q8IDP3 | 13 | Pf3D7_13_v3:1,812,220..1,813,929(-) | Pf3D7_13_v3:1812220..1813929(-) | Pf3D7_13_v3 | Plasmodium falciparum 3D7 | 44 | OG6_124366 | 0 | 569 | 1710 | 67865 | 10.24 | 2 | | | GO:0016021;GO:0005743;GO:0005739 | integral component of membrane;mitochondrial inner membrane;mitochondrion | GO:0008233;GO:0004252 | peptidase activity;serine-type endopeptidase activity | | | | | | | | | 3.4.21.105 (Rhomboid protease) | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1345200ORrhomboid protease ROM6, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1345200 OR rhomboid protease ROM6, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1349700 | PF3D7_1349700.1 | 2 | 2 | 1 | | | forward | protein coding | No | 768 | PF3D7_1349700 | peptidase, putative | peptidase, putative | 814225 | Q8IDK2 | 13 | Pf3D7_13_v3:1,998,815..1,999,771(+) | Pf3D7_13_v3:1998815..1999771(+) | Pf3D7_13_v3 | Plasmodium falciparum 3D7 | 44 | OG6_110253 | 0 | 255 | 768 | 29566 | 8.46 | 6 | | | GO:0016021;GO:0016020 | integral component of membrane;membrane | | | GO:0006810 | transport | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1349700ORpeptidase, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1349700 OR peptidase, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1353800 | PF3D7_1353800.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 741 | PF3D7_1353800 | proteasome subunit alpha type-4, putative | proteasome subunit alpha type-4, putative | 814246 | Q8IDG3 | 13 | Pf3D7_13_v3:2,151,402..2,152,373(-) | Pf3D7_13_v3:2151402..2152373(-) | Pf3D7_13_v3 | Plasmodium falciparum 3D7 | 45 | OG6_101968 | 0 | 246 | 741 | 27947 | 5.89 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | GO:0005839 | proteasome core complex | GO:0004175 | endopeptidase activity | GO:0006511 | ubiquitin-dependent protein catabolic process | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1353800ORproteasome subunit alpha type-4, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1353800 OR proteasome subunit alpha type-4, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1353900 | PF3D7_1353900.1 | 4 | 4 | 1 | | | forward | protein coding | No | 726 | PF3D7_1353900 | proteasome subunit alpha type-7, putative | proteasome subunit alpha type-7, putative | 813832 | Q8IDG2 | 13 | Pf3D7_13_v3:2,154,162..2,155,217(+) | Pf3D7_13_v3:2154162..2155217(+) | Pf3D7_13_v3 | Plasmodium falciparum 3D7 | 45 | OG6_101207 | 0 | 241 | 726 | 27228 | 6.52 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | GO:0005634;GO:0005839 | nucleus;proteasome core complex | GO:0004175 | endopeptidase activity | GO:0006511 | ubiquitin-dependent protein catabolic process | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1353900ORproteasome subunit alpha type-7, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1353900 OR proteasome subunit alpha type-7, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1354800 | PF3D7_1354800.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1842 | PF3D7_1354800 | metacaspase-1 | metacaspase-1 | 814253 | Q8IDF3 | 13 | Pf3D7_13_v3:2,180,958..2,182,799(-) | Pf3D7_13_v3:2180958..2182799(-) | Pf3D7_13_v3 | Plasmodium falciparum 3D7 | 84 | OG6_101407 | 0 | 613 | 1842 | 71689 | 8.70 | 0 | | | | | | | | | | | GO:0008233 | peptidase activity | GO:0006915;GO:0006508 | apoptotic process;proteolysis | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1354800ORmetacaspase-1ANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1354800 OR metacaspase-1 AND Plasmodium falciparum 3D7 |
|
PF3D7_1356300 | PF3D7_1356300.1 | 7 | 7 | 1 | | | forward | protein coding | No | 609 | PF3D7_1356300 | ubiquitin-conjugating enzyme E2, putative | ubiquitin-conjugating enzyme E2, putative | 814264 | Q8IDD9 | 13 | Pf3D7_13_v3:2,231,883..2,233,248(+) | Pf3D7_13_v3:2231883..2233248(+) | Pf3D7_13_v3 | Plasmodium falciparum 3D7 | 44 | OG6_103192 | 0 | 202 | 609 | 22882 | 5.13 | 0 | | | | | GO:0005515 | protein binding | | | | | GO:0004842 | ubiquitin-protein transferase activity | GO:0006511 | ubiquitin-dependent protein catabolic process | 2.3.2.23 (E2 ubiquitin-conjugating enzyme) | 6.3.2.19 (Transferred entry: 2.3.2.23, 2.3.2.27 and 6.2.1.45) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1356300ORubiquitin-conjugating enzyme E2, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1356300 OR ubiquitin-conjugating enzyme E2, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1358300 | PF3D7_1358300.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1023 | PF3D7_1358300 | rhomboid protease ROM7, putative | rhomboid protease ROM7, putative | 814274 | Q8IDC2 | 13 | Pf3D7_13_v3:2,314,457..2,315,479(-) | Pf3D7_13_v3:2314457..2315479(-) | Pf3D7_13_v3 | Plasmodium falciparum 3D7 | 44 | OG6_533468 | 0 | 340 | 1023 | 41011 | 10.08 | 6 | HMM: MNIIVNFIYIYILFLSYYKKGNCF, NN: MNIIVNFIYIYILFLSYYKKGNCF | NN Sum: 4, NN D: .58, HMM Prob: 0 | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | GO:0020011 | apicoplast | | | | | 3.4.21.105 (Rhomboid protease) | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1358300ORrhomboid protease ROM7, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1358300 OR rhomboid protease ROM7, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1359900 | PF3D7_1359900.1 | 1 | 1 | 1 | | | forward | protein coding | No | 6381 | PF3D7_1359900 | conserved Plasmodium membrane protein, unknown function | conserved Plasmodium membrane protein, unknown function | 813861 | Q8IDA6 | 13 | Pf3D7_13_v3:2,395,974..2,402,354(+) | Pf3D7_13_v3:2395974..2402354(+) | Pf3D7_13_v3 | Plasmodium falciparum 3D7 | 46 | OG6_156430 | 0 | 2126 | 6381 | 249758 | 9.77 | 4 | | | GO:0005737 | cytoplasm | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1359900ORconserved Plasmodium membrane protein, unknown functionANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1359900 OR conserved Plasmodium membrane protein, unknown function AND Plasmodium falciparum 3D7 |
|
PF3D7_1360800 | PF3D7_1360800.1 | 1 | 1 | 1 | | | forward | protein coding | No | 3582 | PF3D7_1360800 | falcilysin | falcilysin | 814283 | Q76NL8 | 13 | Pf3D7_13_v3:2,435,343..2,438,924(+) | Pf3D7_13_v3:2435343..2438924(+) | Pf3D7_13_v3 | Plasmodium falciparum 3D7 | 44 | OG6_101809 | 0 | 1193 | 3582 | 138861 | 7.00 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | GO:0006508 | proteolysis | GO:0020011;GO:0005737;GO:0020020 | apicoplast;cytoplasm;food vacuole | GO:0004222 | metalloendopeptidase activity | GO:0042540 | hemoglobin catabolic process | 3.4.24.- (Metalloendopeptidases.);3.4.24.55 (Pitrilysin) | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1360800ORfalcilysinANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1360800 OR falcilysin AND Plasmodium falciparum 3D7 |
|
PF3D7_1361500 | PF3D7_1361500.2 | 13 | 4 | 2 | | | reverse | protein coding | No | 336 | PF3D7_1361500 | PH domain-containing protein, putative | PH domain-containing protein, putative | 813870 | C0H5J8 | 13 | Pf3D7_13_v3:2,465,491..2,467,982(-) | Pf3D7_13_v3:2467128..2467982(-) | Pf3D7_13_v3 | Plasmodium falciparum 3D7 | 40 | OG6_129725 | 0 | 111 | 336 | 13383 | 8.47 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1361500ORPH domain-containing protein, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1361500 OR PH domain-containing protein, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1362400 | PF3D7_1362400.1 | 1 | 1 | 1 | | | forward | protein coding | No | 6147 | PF3D7_1362400 | calpain | calpain | 813875 | C0H5K1 | 13 | Pf3D7_13_v3:2,495,924..2,502,070(+) | Pf3D7_13_v3:2495924..2502070(+) | Pf3D7_13_v3 | Plasmodium falciparum 3D7 | 44 | OG6_103851 | 0 | 2048 | 6147 | 242550 | 9.08 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0005737;GO:0005730 | cytoplasm;nucleolus | | | | | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1362400ORcalpainANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1362400 OR calpain AND Plasmodium falciparum 3D7 |
|
PF3D7_1368100 | PF3D7_1368100.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 936 | PF3D7_1368100 | 26S proteasome regulatory subunit RPN11, putative | 26S proteasome regulatory subunit RPN11, putative | 813911 | Q8ID28 | 13 | Pf3D7_13_v3:2,710,406..2,711,718(-) | Pf3D7_13_v3:2710406..2711718(-) | Pf3D7_13_v3 | Plasmodium falciparum 3D7 | 43 | OG6_101835 | 0 | 311 | 936 | 35211 | 6.72 | 0 | | | | | GO:0005515 | protein binding | | | GO:0005634;GO:0005838 | nucleus;proteasome regulatory particle | | | GO:0006511 | ubiquitin-dependent protein catabolic process | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1368100OR26S proteasome regulatory subunit RPN11, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1368100 OR 26S proteasome regulatory subunit RPN11, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1401300 | PF3D7_1401300.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 1422 | PF3D7_1401300 | epoxide hydrolase 2 | epoxide hydrolase 2 | 811597 | Q8IM75 | 14 | Pf3D7_14_v3:48,912..50,415(-) | Pf3D7_14_v3:48912..50415(-) | Pf3D7_14_v3 | Plasmodium falciparum 3D7 | 66 | OG6_129556 | 1 | 473 | 1422 | 55197 | 7.03 | 1 | | | | | | | | | GO:0030430;GO:0044538 | host cell cytoplasm;host cell periphery | GO:0004177;GO:0004301;GO:0030507 | aminopeptidase activity;epoxide hydrolase activity;spectrin binding | GO:0020035 | cytoadherence to microvasculature, mediated by symbiont protein | 3.4.11.- (Aminopeptidases.);3.4.11.5 (Prolyl aminopeptidase) | 3.4.11.- (Aminopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1401300ORepoxide hydrolase 2ANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1401300 OR epoxide hydrolase 2 AND Plasmodium falciparum 3D7 |
|
PF3D7_1401500 | PF3D7_1401500.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1122 | PF3D7_1401500 | esterase, putative | esterase, putative | 811594 | Q8IM74 | 14 | Pf3D7_14_v3:57,172..58,293(-) | Pf3D7_14_v3:57172..58293(-) | Pf3D7_14_v3 | Plasmodium falciparum 3D7 | 453 | OG6_100231 | 8 | 373 | 1122 | 43737 | 8.94 | 0 | | | | | | | | | | | GO:0016788 | hydrolase activity, acting on ester bonds | | | 3.1.-.- (Acting on ester bonds.);3.1.1.5 (Lysophospholipase) | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1401500OResterase, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1401500 OR esterase, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1406500 | PF3D7_1406500.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 4584 | PF3D7_1406500 | WD repeat-containing protein 65, putative | WD repeat-containing protein 65, putative | 811644 | Q8IM29 | 14 | Pf3D7_14_v3:233,001..237,744(-) | Pf3D7_14_v3:233001..237744(-) | Pf3D7_14_v3 | Plasmodium falciparum 3D7 | 50 | OG6_102663 | 0 | 1527 | 4584 | 181532 | 8.04 | 0 | | | GO:0005737;GO:0016459 | cytoplasm;myosin complex | GO:0005524;GO:0003779;GO:0005516;GO:0003774;GO:0005515 | ATP binding;actin binding;calmodulin binding;motor activity;protein binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1406500ORWD repeat-containing protein 65, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1406500 OR WD repeat-containing protein 65, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1406600 | PF3D7_1406600.1 | 1 | 1 | 1 | | | forward | protein coding | No | 4026 | PF3D7_1406600 | ATP-dependent Clp protease regulatory subunit ClpC | ATP-dependent Clp protease regulatory subunit ClpC | 811645 | Q8IM28 | 14 | Pf3D7_14_v3:239,747..243,772(+) | Pf3D7_14_v3:239747..243772(+) | Pf3D7_14_v3 | Plasmodium falciparum 3D7 | 42 | OG6_532618 | 0 | 1341 | 4026 | 156020 | 7.86 | 1 | NN: MNVLYIFIAVLILNGILNIHVSK, HMM: MNVLYIFIAVLILNGI | NN Sum: 2, NN D: .51, HMM Prob: .3 | | | GO:0005524 | ATP binding | GO:0019538 | protein metabolic process | GO:0020011 | apicoplast | | | GO:0051301;GO:0009657 | cell division;plastid organization | 3.4.21.92 (Endopeptidase Clp) | 3.4.21.92 (Endopeptidase Clp) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1406600ORATP-dependent Clp protease regulatory subunit ClpCANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1406600 OR ATP-dependent Clp protease regulatory subunit ClpC AND Plasmodium falciparum 3D7 |
|
PF3D7_1407800 | PF3D7_1407800.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1350 | PF3D7_1407800 | plasmepsin IV | plasmepsin IV | 811657 | Q8IM16 | 14 | Pf3D7_14_v3:283,086..284,435(+) | Pf3D7_14_v3:283086..284435(+) | Pf3D7_14_v3 | Plasmodium falciparum 3D7 | 155 | OG6_100536 | 4 | 449 | 1350 | 51045 | 5.19 | 1 | | | GO:0016020 | membrane | | | GO:0006508 | proteolysis | GO:0020020;GO:0005634 | food vacuole;nucleus | GO:0004190 | aspartic-type endopeptidase activity | GO:0042540 | hemoglobin catabolic process | 3.4.23.- (Aspartic endopeptidases.) | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1407800ORplasmepsin IVANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1407800 OR plasmepsin IV AND Plasmodium falciparum 3D7 |
|
PF3D7_1407900 | PF3D7_1407900.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1359 | PF3D7_1407900 | plasmepsin I | plasmepsin I | 811658 | Q7KQM4 | 14 | Pf3D7_14_v3:288,297..289,655(+) | Pf3D7_14_v3:288297..289655(+) | Pf3D7_14_v3 | Plasmodium falciparum 3D7 | 155 | OG6_100536 | 4 | 452 | 1359 | 51460 | 7.23 | 1 | | | GO:0016020 | membrane | | | GO:0006508 | proteolysis | GO:0020020 | food vacuole | GO:0004190 | aspartic-type endopeptidase activity | GO:0042540 | hemoglobin catabolic process | 3.4.23.38 (Plasmepsin I) | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1407900ORplasmepsin IANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1407900 OR plasmepsin I AND Plasmodium falciparum 3D7 |
|
PF3D7_1408000 | PF3D7_1408000.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1362 | PF3D7_1408000 | plasmepsin II | plasmepsin II | 811659 | Q8I6V3 | 14 | Pf3D7_14_v3:293,471..294,832(+) | Pf3D7_14_v3:293471..294832(+) | Pf3D7_14_v3 | Plasmodium falciparum 3D7 | 155 | OG6_100536 | 4 | 453 | 1362 | 51480 | 5.29 | 1 | | | GO:0016020 | membrane | | | GO:0006508 | proteolysis | GO:0020020;GO:0005634 | food vacuole;nucleus | GO:0004190 | aspartic-type endopeptidase activity | GO:0042540;GO:0042493 | hemoglobin catabolic process;response to drug | 3.4.23.39 (Plasmepsin II) | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1408000ORplasmepsin IIANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1408000 OR plasmepsin II AND Plasmodium falciparum 3D7 |
|
PF3D7_1408100 | PF3D7_1408100.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1356 | PF3D7_1408100 | plasmepsin III | plasmepsin III | 811660 | Q8IM15 | 14 | Pf3D7_14_v3:297,468..298,823(+) | Pf3D7_14_v3:297468..298823(+) | Pf3D7_14_v3 | Plasmodium falciparum 3D7 | 155 | OG6_100536 | 4 | 451 | 1356 | 51692 | 8.23 | 1 | | | GO:0016020 | membrane | | | GO:0006508 | proteolysis | GO:0020020 | food vacuole | GO:0004190 | aspartic-type endopeptidase activity | GO:0042493 | response to drug | 3.4.23.- (Aspartic endopeptidases.) | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1408100ORplasmepsin IIIANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1408100 OR plasmepsin III AND Plasmodium falciparum 3D7 |
|
PF3D7_1409300 | PF3D7_1409300.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1149 | PF3D7_1409300 | DNA damage-inducible protein 1, putative | DNA damage-inducible protein 1, putative | 811671 | Q8IM03 | 14 | Pf3D7_14_v3:363,092..364,240(+) | Pf3D7_14_v3:363092..364240(+) | Pf3D7_14_v3 | Plasmodium falciparum 3D7 | 45 | OG6_101685 | 0 | 382 | 1149 | 43838 | 4.68 | 0 | | | | | GO:0004190 | aspartic-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.23.- (Aspartic endopeptidases.) | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1409300ORDNA damage-inducible protein 1, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1409300 OR DNA damage-inducible protein 1, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1410100 | PF3D7_1410100.1 | 7 | 7 | 1 | | | forward | protein coding | No | 1050 | PF3D7_1410100 | alpha/beta hydrolase, putative | alpha/beta hydrolase, putative | 811680 | Q8ILZ4 | 14 | Pf3D7_14_v3:396,010..397,967(+) | Pf3D7_14_v3:396010..397967(+) | Pf3D7_14_v3 | Plasmodium falciparum 3D7 | 43 | OG6_112275 | 0 | 349 | 1050 | 41483 | 6.99 | 1 | | | | | | | | | GO:0005737 | cytoplasm | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1410100ORalpha/beta hydrolase, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1410100 OR alpha/beta hydrolase, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1411200 | PF3D7_1411200.1 | 4 | 4 | 1 | | | reverse | protein coding | No | 2217 | PF3D7_1411200 | rhomboid protease ROM8 | rhomboid protease ROM8 | 811691 | Q8ILY3 | 14 | Pf3D7_14_v3:452,175..454,879(-) | Pf3D7_14_v3:452175..454879(-) | Pf3D7_14_v3 | Plasmodium falciparum 3D7 | 44 | OG6_533440 | 0 | 738 | 2217 | 86780 | 9.76 | 5 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | 3.4.21.105 (Rhomboid protease) | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1411200ORrhomboid protease ROM8ANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1411200 OR rhomboid protease ROM8 AND Plasmodium falciparum 3D7 |
|
PF3D7_1414500 | PF3D7_1414500.1 | 6 | 6 | 1 | | | reverse | protein coding | No | 8277 | PF3D7_1414500 | atypical protein kinase, ABC-1 family, putative | atypical protein kinase, ABC-1 family, putative | 811724 | Q8ILV0 | 14 | Pf3D7_14_v3:578,369..587,529(-) | Pf3D7_14_v3:578369..587529(-) | Pf3D7_14_v3 | Plasmodium falciparum 3D7 | 48 | OG6_112296 | 0 | 2758 | 8277 | 326039 | 9.40 | 0 | | | | | | | | | | | | | | | 1.14.13.- (With NADH or NADPH as one donor, and incorporation of one atom of oxygen.) | 1.14.13.- (With NADH or NADPH as one donor, and incorporation of one atom of oxygen.) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1414500ORatypical protein kinase, ABC-1 family, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1414500 OR atypical protein kinase, ABC-1 family, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1414700 | PF3D7_1414700.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 4155 | PF3D7_1414700 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | 811726 | Q8ILU9 | 14 | Pf3D7_14_v3:592,992..597,146(-) | Pf3D7_14_v3:592992..597146(-) | Pf3D7_14_v3 | Plasmodium falciparum 3D7 | 47 | OG6_101457 | 1 | 1384 | 4155 | 164384 | 10.05 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1414700ORubiquitin carboxyl-terminal hydrolase, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1414700 OR ubiquitin carboxyl-terminal hydrolase, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1414900 | PF3D7_1414900.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3579 | PF3D7_1414900 | ATP-dependent protease, putative | ATP-dependent protease, putative | 811728 | Q8ILU7 | 14 | Pf3D7_14_v3:601,981..605,559(-) | Pf3D7_14_v3:601981..605559(-) | Pf3D7_14_v3 | Plasmodium falciparum 3D7 | 47 | OG6_100411 | 0 | 1192 | 3579 | 141700 | 8.76 | 0 | | | GO:0005739 | mitochondrion | GO:0005524;GO:0004176;GO:0004252 | ATP binding;ATP-dependent peptidase activity;serine-type endopeptidase activity | GO:0006508 | proteolysis | | | GO:0004176;GO:0004252 | ATP-dependent peptidase activity;serine-type endopeptidase activity | | | 3.4.21.53 (Endopeptidase La) | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1414900ORATP-dependent protease, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1414900 OR ATP-dependent protease, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1416200 | PF3D7_1416200.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 6843 | PF3D7_1416200 | metacaspase-3 | metacaspase-3 | 811741 | Q8ILT4 | 14 | Pf3D7_14_v3:650,503..657,345(-) | Pf3D7_14_v3:650503..657345(-) | Pf3D7_14_v3 | Plasmodium falciparum 3D7 | 46 | OG6_119794 | 0 | 2280 | 6843 | 264922 | 9.73 | 0 | | | | | | | | | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1416200ORmetacaspase-3ANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1416200 OR metacaspase-3 AND Plasmodium falciparum 3D7 |
|
PF3D7_1417300 | PF3D7_1417300.1 | 3 | 3 | 1 | | | forward | protein coding | No | 3375 | PF3D7_1417300 | cysteine protease ATG4, putative | cysteine protease ATG4, putative | 811752 | Q8ILS3 | 14 | Pf3D7_14_v3:709,670..713,309(+) | Pf3D7_14_v3:709670..713309(+) | Pf3D7_14_v3 | Plasmodium falciparum 3D7 | 41 | OG6_100501 | 0 | 1124 | 3375 | 132714 | 9.77 | 0 | | | | | | | | | GO:0005737 | cytoplasm | GO:0004197 | cysteine-type endopeptidase activity | GO:0006914 | autophagy | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1417300ORcysteine protease ATG4, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1417300 OR cysteine protease ATG4, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1425200 | PF3D7_1425200.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1221 | PF3D7_1425200 | enoyl-CoA hydratase, putative | enoyl-CoA hydratase, putative | 811814 | Q8ILL1 | 14 | Pf3D7_14_v3:983,341..984,561(-) | Pf3D7_14_v3:983341..984561(-) | Pf3D7_14_v3 | Plasmodium falciparum 3D7 | 44 | OG6_102410 | 0 | 406 | 1221 | 48258 | 7.95 | 0 | | | GO:0005737;GO:0016507;GO:0005739 | cytoplasm;mitochondrial fatty acid beta-oxidation multienzyme complex;mitochondrion | GO:0003857;GO:0008692;GO:0051287;GO:0003824;GO:0004165;GO:0004300 | 3-hydroxyacyl-CoA dehydrogenase activity;3-hydroxybutyryl-CoA epimerase activity;NAD binding;catalytic activity;dodecenoyl-CoA delta-isomerase activity;enoyl-CoA hydratase activity | GO:0006635;GO:0009062;GO:0008152 | fatty acid beta-oxidation;fatty acid catabolic process;metabolic process | | | | | | | 4.2.1.17 (Enoyl-CoA hydratase) | 4.2.1.17 (Enoyl-CoA hydratase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1425200ORenoyl-CoA hydratase, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1425200 OR enoyl-CoA hydratase, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1427100 | PF3D7_1427100.1 | 1 | 1 | 1 | | | forward | protein coding | No | 3963 | PF3D7_1427100 | lipase, putative | lipase, putative | 811832 | Q8ILJ3 | 14 | Pf3D7_14_v3:1,056,162..1,060,124(+) | Pf3D7_14_v3:1056162..1060124(+) | Pf3D7_14_v3 | Plasmodium falciparum 3D7 | 43 | OG6_145929 | 0 | 1320 | 3963 | 155666 | 4.74 | 1 | HMM: MLPCVIISFLYLFYLTYIFKVVIIYCD, NN: MLPCVIISFLYLFYLTYIFKVVIIYCDSS | NN Sum: 3, NN D: .55, HMM Prob: .05 | | | | | GO:0006629 | lipid metabolic process | | | | | | | 3.1.1.3 (Triacylglycerol lipase);3.1.1.32 (Phospholipase A(1)) | 3.1.1.3 (Triacylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1427100ORlipase, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1427100 OR lipase, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1428300 | PF3D7_1428300.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 1134 | PF3D7_1428300 | proliferation-associated protein 2g4, putative | proliferation-associated protein 2g4, putative | 811843 | Q8ILI2 | 14 | Pf3D7_14_v3:1,105,200..1,106,514(-) | Pf3D7_14_v3:1105200..1106514(-) | Pf3D7_14_v3 | Plasmodium falciparum 3D7 | 42 | OG6_101895 | 0 | 377 | 1134 | 42640 | 7.95 | 0 | | | | | | | | | GO:0005634 | nucleus | GO:0008235 | metalloexopeptidase activity | GO:0007050 | cell cycle arrest | | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1428300ORproliferation-associated protein 2g4, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1428300 OR proliferation-associated protein 2g4, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1430200 | PF3D7_1430200.1 | 8 | 8 | 1 | | | forward | protein coding | No | 1884 | PF3D7_1430200 | plasmepsin IX | plasmepsin IX | 811863 | Q8ILG2 | 14 | Pf3D7_14_v3:1,188,349..1,191,466(+) | Pf3D7_14_v3:1188349..1191466(+) | Pf3D7_14_v3 | Plasmodium falciparum 3D7 | 91 | OG6_119797 | 1 | 627 | 1884 | 74182 | 9.63 | 0 | HMM: MFFINFKKIKKKQFPIYLTQHRIITVFLIFIYFINLKDCF, NN: MFFINFKKIKKKQFPIYLTQHRIITVFLIFIYFINLKDCF | NN Sum: 3, NN D: .52, HMM Prob: 0 | | | | | | | GO:0020008 | rhoptry | GO:0004190 | aspartic-type endopeptidase activity | GO:0044409;GO:0006508;GO:0042493 | entry into host;proteolysis;response to drug | 3.4.23.- (Aspartic endopeptidases.) | 3.4.23.1 (Pepsin A) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1430200ORplasmepsin IXANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1430200 OR plasmepsin IX AND Plasmodium falciparum 3D7 |
|
PF3D7_1432600 | PF3D7_1432600.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3588 | PF3D7_1432600 | conserved Plasmodium protein, unknown function | conserved Plasmodium protein, unknown function | 811890 | Q8ILD6 | 14 | Pf3D7_14_v3:1,285,667..1,289,254(-) | Pf3D7_14_v3:1285667..1289254(-) | Pf3D7_14_v3 | Plasmodium falciparum 3D7 | 42 | OG6_532401 | 0 | 1195 | 3588 | 143994 | 9.21 | 0 | | | | | GO:0003677 | DNA binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1432600ORconserved Plasmodium protein, unknown functionANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1432600 OR conserved Plasmodium protein, unknown function AND Plasmodium falciparum 3D7 |
|
PF3D7_1433600 | PF3D7_1433600.1 | 3 | 3 | 1 | | | forward | protein coding | No | 306 | PF3D7_1433600 | signal peptidase complex subunit SPC1, putative | signal peptidase complex subunit SPC1, putative | 811899 | Q8ILC7 | 14 | Pf3D7_14_v3:1,341,689..1,342,289(+) | Pf3D7_14_v3:1341689..1342289(+) | Pf3D7_14_v3 | Plasmodium falciparum 3D7 | 44 | OG6_103297 | 0 | 101 | 306 | 11572 | 9.35 | 2 | | | GO:0016021;GO:0005787 | integral component of membrane;signal peptidase complex | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | GO:0005787 | signal peptidase complex | | | | | 3.4.21.89 (Signal peptidase I) | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1433600ORsignal peptidase complex subunit SPC1, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1433600 OR signal peptidase complex subunit SPC1, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1434600 | PF3D7_1434600.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1887 | PF3D7_1434600 | methionine aminopeptidase 2 | methionine aminopeptidase 2 | 811909 | Q8ILB8 | 14 | Pf3D7_14_v3:1,404,312..1,406,198(+) | Pf3D7_14_v3:1404312..1406198(+) | Pf3D7_14_v3 | Plasmodium falciparum 3D7 | 45 | OG6_100815 | 0 | 628 | 1887 | 71743 | 8.54 | 0 | | | | | GO:0004177;GO:0008235 | aminopeptidase activity;metalloexopeptidase activity | GO:0006508 | proteolysis | GO:0005634 | nucleus | GO:0008235 | metalloexopeptidase activity | GO:0006464;GO:0006417;GO:0006412 | cellular protein modification process;regulation of translation;translation | 3.4.11.18 (Methionyl aminopeptidase) | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1434600ORmethionine aminopeptidase 2ANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1434600 OR methionine aminopeptidase 2 AND Plasmodium falciparum 3D7 |
|
PF3D7_1436700 | PF3D7_1436700.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 2595 | PF3D7_1436700 | conserved protein, unknown function | conserved protein, unknown function | 811929 | Q8IL99 | 14 | Pf3D7_14_v3:1,495,799..1,498,533(-) | Pf3D7_14_v3:1495799..1498533(-) | Pf3D7_14_v3 | Plasmodium falciparum 3D7 | 45 | OG6_146174 | 0 | 864 | 2595 | 104345 | 9.03 | 0 | | | | | | | | | | | | | | | | 3.4.21.92 (Endopeptidase Clp) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1436700ORconserved protein, unknown functionANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1436700 OR conserved protein, unknown function AND Plasmodium falciparum 3D7 |
|
PF3D7_1436800 | PF3D7_1436800.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 735 | PF3D7_1436800 | ATP-dependent Clp protease proteolytic subunit | ATP-dependent Clp protease proteolytic subunit | 811930 | Q8IL98 | 14 | Pf3D7_14_v3:1,498,758..1,499,492(-) | Pf3D7_14_v3:1498758..1499492(-) | Pf3D7_14_v3 | Plasmodium falciparum 3D7 | 42 | OG6_113660 | 0 | 244 | 735 | 28324 | 9.40 | 0 | NN: MQGLLLFMLICINFCKCT, HMM: MQGLLLFMLICINFCKCT | NN Sum: 4, NN D: .8, HMM Prob: .98 | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0020011 | apicoplast | | | | | 3.4.21.92 (Endopeptidase Clp) | 3.4.21.92 (Endopeptidase Clp) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1436800ORATP-dependent Clp protease proteolytic subunitANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1436800 OR ATP-dependent Clp protease proteolytic subunit AND Plasmodium falciparum 3D7 |
|
PF3D7_1438400 | PF3D7_1438400.1 | 7 | 7 | 1 | | | forward | protein coding | No | 6063 | PF3D7_1438400 | metacaspase-2 | metacaspase-2 | 811945 | Q8IL84 | 14 | Pf3D7_14_v3:1,548,918..1,556,721(+) | Pf3D7_14_v3:1548918..1556721(+) | Pf3D7_14_v3 | Plasmodium falciparum 3D7 | 3 | OG6_532968 | 0 | 2020 | 6063 | 237829 | 9.65 | 0 | | | | | | | | | GO:0005737 | cytoplasm | GO:0008234 | cysteine-type peptidase activity | GO:0006915;GO:0042493 | apoptotic process;response to drug | | | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1438400ORmetacaspase-2ANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1438400 OR metacaspase-2 AND Plasmodium falciparum 3D7 |
|
PF3D7_1440200 | PF3D7_1440200.1 | 6 | 6 | 1 | | | forward | protein coding | No | 4683 | PF3D7_1440200 | stromal-processing peptidase, putative | stromal-processing peptidase, putative | 811964 | Q8IL67 | 14 | Pf3D7_14_v3:1,639,477..1,647,167(+) | Pf3D7_14_v3:1639477..1647167(+) | Pf3D7_14_v3 | Plasmodium falciparum 3D7 | 43 | OG6_110270 | 0 | 1560 | 4683 | 185588 | 6.96 | 0 | HMM: MLKSDVVLLLYILIINLICCL, NN: MLKSDVVLLLYILIINLICCL | NN Sum: 4, NN D: .75, HMM Prob: .88 | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | GO:0020011 | apicoplast | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | 3.4.24.55 (Pitrilysin);3.4.24.56 (Insulysin) | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1440200ORstromal-processing peptidase, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1440200 OR stromal-processing peptidase, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1441700 | PF3D7_1441700.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1377 | PF3D7_1441700 | mitochondrial inner membrane protease ATP23, putative | mitochondrial inner membrane protease ATP23, putative | 811978 | Q8IL53 | 14 | Pf3D7_14_v3:1,700,674..1,702,050(+) | Pf3D7_14_v3:1700674..1702050(+) | Pf3D7_14_v3 | Plasmodium falciparum 3D7 | 44 | OG6_102968 | 0 | 458 | 1377 | 54966 | 9.32 | 0 | | | GO:0005743;GO:0005739 | mitochondrial inner membrane;mitochondrion | GO:0004222;GO:0008233 | metalloendopeptidase activity;peptidase activity | | | GO:0005758 | mitochondrial intermembrane space | | | GO:0034982;GO:0033615 | mitochondrial protein processing;mitochondrial proton-transporting ATP synthase complex assembly | 3.4.24.- (Metalloendopeptidases.) | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1441700ORmitochondrial inner membrane protease ATP23, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1441700 OR mitochondrial inner membrane protease ATP23, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1446200 | PF3D7_1446200.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1818 | PF3D7_1446200 | M17 leucyl aminopeptidase | M17 leucyl aminopeptidase | 812021 | Q8IL11 | 14 | Pf3D7_14_v3:1,893,200..1,895,017(-) | Pf3D7_14_v3:1893200..1895017(-) | Pf3D7_14_v3 | Plasmodium falciparum 3D7 | 47 | OG6_100682 | 0 | 605 | 1818 | 67820 | 8.86 | 0 | | | GO:0005737;GO:0005622 | cytoplasm;intracellular | GO:0004177;GO:0030145 | aminopeptidase activity;manganese ion binding | GO:0019538;GO:0006508 | protein metabolic process;proteolysis | GO:0020011;GO:0005829;GO:0020020 | apicoplast;cytosol;food vacuole | GO:0008235 | metalloexopeptidase activity | GO:0006508 | proteolysis | 3.4.11.1 (Leucyl aminopeptidase) | 3.4.11.1 (Leucyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1446200ORM17 leucyl aminopeptidaseANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1446200 OR M17 leucyl aminopeptidase AND Plasmodium falciparum 3D7 |
|
PF3D7_1452300 | PF3D7_1452300.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1065 | PF3D7_1452300 | DER1-like protein | DER1-like protein | 812080 | Q8IKV3 | 14 | Pf3D7_14_v3:2,145,166..2,146,230(-) | Pf3D7_14_v3:2145166..2146230(-) | Pf3D7_14_v3 | Plasmodium falciparum 3D7 | 44 | OG6_160757 | 0 | 354 | 1065 | 41702 | 10.21 | 5 | HMM: MNFILYIAVIIIYLTNIHCK, NN: MNFILYIAVIIIYLTNIHCK | NN Sum: 4, NN D: .78, HMM Prob: .8 | | | | | | | GO:0020011;GO:0016021 | apicoplast;integral component of membrane | | | GO:0030433 | ubiquitin-dependent ERAD pathway | | | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1452300ORDER1-like proteinANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1452300 OR DER1-like protein AND Plasmodium falciparum 3D7 |
|
PF3D7_1454400 | PF3D7_1454400.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2334 | PF3D7_1454400 | aminopeptidase P | aminopeptidase P | 812099 | Q8IKT5 | 14 | Pf3D7_14_v3:2,234,143..2,236,476(+) | Pf3D7_14_v3:2234143..2236476(+) | Pf3D7_14_v3 | Plasmodium falciparum 3D7 | 44 | OG6_100896 | 0 | 777 | 2334 | 90129 | 6.80 | 1 | NN: MQLNFLLFVFIFLMVFHLNIFN, HMM: MQLNFLLFVFIFLMVFHLN | NN Sum: 2, NN D: .62, HMM Prob: .45 | | | GO:0016787 | hydrolase activity | | | GO:0005829;GO:0020020 | cytosol;food vacuole | GO:0004177;GO:0070006;GO:0042803 | aminopeptidase activity;metalloaminopeptidase activity;protein homodimerization activity | GO:0042540;GO:0006508 | hemoglobin catabolic process;proteolysis | 3.4.11.9 (Xaa-Pro aminopeptidase) | 3.4.11.9 (Xaa-Pro aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1454400ORaminopeptidase PANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1454400 OR aminopeptidase P AND Plasmodium falciparum 3D7 |
|
PF3D7_1457000 | PF3D7_1457000.1 | 9 | 9 | 1 | | | reverse | protein coding | No | 1239 | PF3D7_1457000 | signal peptide peptidase | signal peptide peptidase | 812125 | Q8IKQ9 | 14 | Pf3D7_14_v3:2,336,649..2,339,153(-) | Pf3D7_14_v3:2336649..2339153(-) | Pf3D7_14_v3 | Plasmodium falciparum 3D7 | 44 | OG6_102328 | 0 | 412 | 1239 | 47578 | 9.08 | 8 | | | GO:0016021 | integral component of membrane | GO:0004190 | aspartic-type endopeptidase activity | | | GO:0009986;GO:0005783;GO:0020009 | cell surface;endoplasmic reticulum;microneme | GO:0008233;GO:0042803 | peptidase activity;protein homodimerization activity | GO:0042493;GO:0006465 | response to drug;signal peptide processing | 3.4.21.89 (Signal peptidase I) | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1457000ORsignal peptide peptidaseANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1457000 OR signal peptide peptidase AND Plasmodium falciparum 3D7 |
|
PF3D7_1458000 | PF3D7_1458000.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1710 | PF3D7_1458000 | cysteine proteinase falcipain 1 | cysteine proteinase falcipain 1 | 812135 | Q8I6V0 | 14 | Pf3D7_14_v3:2,387,786..2,389,495(+) | Pf3D7_14_v3:2387786..2389495(+) | Pf3D7_14_v3 | Plasmodium falciparum 3D7 | 157 | OG6_100116 | 3 | 569 | 1710 | 66913 | 8.65 | 1 | | | GO:0016020 | membrane | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | GO:0008234 | cysteine-type peptidase activity | GO:0044409;GO:0042540;GO:0006508 | entry into host;hemoglobin catabolic process;proteolysis | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1458000ORcysteine proteinase falcipain 1ANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1458000 OR cysteine proteinase falcipain 1 AND Plasmodium falciparum 3D7 |
|
PF3D7_1460400 | PF3D7_1460400.1 | 9 | 9 | 1 | | | forward | protein coding | No | 699 | PF3D7_1460400 | ubiquitin carboxyl-terminal hydrolase isozyme L3 | ubiquitin carboxyl-terminal hydrolase isozyme L3 | 812158 | Q8IKM8 | 14 | Pf3D7_14_v3:2,461,321..2,463,104(+) | Pf3D7_14_v3:2461321..2463104(+) | Pf3D7_14_v3 | Plasmodium falciparum 3D7 | 44 | OG6_101218 | 0 | 232 | 699 | 26899 | 4.62 | 0 | | | GO:0005622 | intracellular | GO:0004843 | thiol-dependent ubiquitin-specific protease activity | GO:0006511 | ubiquitin-dependent protein catabolic process | GO:0000151 | ubiquitin ligase complex | GO:0019784;GO:0043130 | NEDD8-specific protease activity;ubiquitin binding | GO:0000338;GO:0016579 | protein deneddylation;protein deubiquitination | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1460400ORubiquitin carboxyl-terminal hydrolase isozyme L3ANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1460400 OR ubiquitin carboxyl-terminal hydrolase isozyme L3 AND Plasmodium falciparum 3D7 |
|
PF3D7_1464900 | PF3D7_1464900.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2121 | PF3D7_1464900 | ATP-dependent zinc metalloprotease FTSH, putative | ATP-dependent zinc metalloprotease FTSH, putative | 812198 | Q8IKI9 | 14 | Pf3D7_14_v3:2,630,558..2,632,678(-) | Pf3D7_14_v3:2630558..2632678(-) | Pf3D7_14_v3 | Plasmodium falciparum 3D7 | 44 | OG6_101196 | 0 | 706 | 2121 | 79814 | 9.29 | 0 | | | GO:0016020 | membrane | GO:0005524;GO:0004222 | ATP binding;metalloendopeptidase activity | GO:0006508 | proteolysis | GO:0005634 | nucleus | GO:0004176 | ATP-dependent peptidase activity | | | 3.4.24.- (Metalloendopeptidases.) | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1464900ORATP-dependent zinc metalloprotease FTSH, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1464900 OR ATP-dependent zinc metalloprotease FTSH, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1465700 | PF3D7_1465700.1 | 13 | 13 | 1 | | | reverse | protein coding | No | 1158 | PF3D7_1465700 | plasmepsin VIII, putative | plasmepsin VIII, putative | 812207 | Q8IKI0 | 14 | Pf3D7_14_v3:2,658,255..2,660,911(-) | Pf3D7_14_v3:2658255..2660911(-) | Pf3D7_14_v3 | Plasmodium falciparum 3D7 | 44 | OG6_124673 | 0 | 385 | 1158 | 44253 | 9.38 | 0 | HMM: MNILFCLFVITNLYNIIAVKAF, NN: MNILFCLFVITNLYNIIAVKAF | NN Sum: 4, NN D: .63, HMM Prob: .56 | | | GO:0004190 | aspartic-type endopeptidase activity | GO:0006508 | proteolysis | GO:0005737 | cytoplasm | | | GO:0071976;GO:0035891 | cell gliding;exit from host cell | 3.4.17.4 (Gly-Xaa carboxypeptidase) | 3.4.17.4 (Gly-Xaa carboxypeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1465700ORplasmepsin VIII, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1465700 OR plasmepsin VIII, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1468500 | PF3D7_1468500.1 | 6 | 6 | 1 | | | reverse | protein coding | No | 645 | PF3D7_1468500 | derlin-1 | derlin-1 | 812235 | Q8IKF2 | 14 | Pf3D7_14_v3:2,812,941..2,814,385(-) | Pf3D7_14_v3:2812941..2814385(-) | Pf3D7_14_v3 | Plasmodium falciparum 3D7 | 44 | OG6_101672 | 0 | 214 | 645 | 25101 | 7.79 | 5 | NN: MVQLSDVLGNVPLITRLYLILSFALMVLCS, HMM: MVQLSDVLGNVPLITRLYLILSFALMVLCSLD | NN Sum: 3, NN D: .56, HMM Prob: .33 | | | | | | | GO:0005783;GO:0005789 | endoplasmic reticulum;endoplasmic reticulum membrane | | | GO:0030970;GO:0030433 | retrograde protein transport, ER to cytosol;ubiquitin-dependent ERAD pathway | | | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1468500ORderlin-1ANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1468500 OR derlin-1 AND Plasmodium falciparum 3D7 |
|
PF3D7_1469600 | PF3D7_1469600.1 | 3 | 3 | 1 | | | forward | protein coding | No | 10104 | PF3D7_1469600 | acetyl-CoA carboxylase | acetyl-CoA carboxylase | 812246 | Q8IKE1 | 14 | Pf3D7_14_v3:2,852,150..2,862,568(+) | Pf3D7_14_v3:2852150..2862568(+) | Pf3D7_14_v3 | Plasmodium falciparum 3D7 | 41 | OG6_101052 | 0 | 3367 | 10104 | 394877 | 7.76 | 0 | HMM: MINFFLSLLLFVLFFENLVVSI, NN: MINFFLSLLLFVLFFENLVVSI | NN Sum: 4, NN D: .82, HMM Prob: 1 | | | GO:0005524;GO:0016874;GO:0046872 | ATP binding;ligase activity;metal ion binding | | | GO:0009317;GO:0020011;GO:0009343 | acetyl-CoA carboxylase complex;apicoplast;biotin carboxylase complex | GO:0003989;GO:0009374;GO:0004075 | acetyl-CoA carboxylase activity;biotin binding;biotin carboxylase activity | GO:0006633 | fatty acid biosynthetic process | 6.3.4.14 (Biotin carboxylase);6.4.1.2 (Acetyl-CoA carboxylase) | 6.4.1.2 (Acetyl-CoA carboxylase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1469600ORacetyl-CoA carboxylaseANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1469600 OR acetyl-CoA carboxylase AND Plasmodium falciparum 3D7 |
|
PF3D7_1470900 | PF3D7_1470900.1 | 2 | 2 | 1 | | | forward | protein coding | No | 588 | PF3D7_1470900 | proteasome subunit beta type-2, putative | proteasome subunit beta type-2, putative | 812258 | Q8IKC9 | 14 | Pf3D7_14_v3:2,897,916..2,898,657(+) | Pf3D7_14_v3:2897916..2898657(+) | Pf3D7_14_v3 | Plasmodium falciparum 3D7 | 44 | OG6_102061 | 0 | 195 | 588 | 22861 | 7.44 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | GO:0004175 | endopeptidase activity | GO:0006511 | ubiquitin-dependent protein catabolic process | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1470900ORproteasome subunit beta type-2, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1470900 OR proteasome subunit beta type-2, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1471900 | PF3D7_1471900.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 6387 | PF3D7_1471900 | conserved Plasmodium protein, unknown function | conserved Plasmodium protein, unknown function | 812268 | Q8IKC0 | 14 | Pf3D7_14_v3:2,933,162..2,939,779(-) | Pf3D7_14_v3:2933162..2939779(-) | Pf3D7_14_v3 | Plasmodium falciparum 3D7 | 32 | OG6_532336 | 0 | 2128 | 6387 | 256340 | 9.73 | 0 | | | GO:0005737;GO:0016021;GO:0016020 | cytoplasm;integral component of membrane;membrane | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1471900ORconserved Plasmodium protein, unknown functionANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1471900 OR conserved Plasmodium protein, unknown function AND Plasmodium falciparum 3D7 |
|
PF3D7_1472400 | PF3D7_1472400.1 | 3 | 3 | 1 | | | forward | protein coding | No | 3846 | PF3D7_1472400 | M1-family alanyl aminopeptidase, putative | M1-family alanyl aminopeptidase, putative | 812274 | Q8IKB4 | 14 | Pf3D7_14_v3:2,957,474..2,961,618(+) | Pf3D7_14_v3:2957474..2961618(+) | Pf3D7_14_v3 | Plasmodium falciparum 3D7 | 37 | OG6_532703 | 0 | 1281 | 3846 | 156156 | 10.39 | 5 | | | | | GO:0008237;GO:0008270 | metallopeptidase activity;zinc ion binding | | | | | | | | | 3.4.11.2 (Membrane alanyl aminopeptidase) | 3.4.11.2 (Membrane alanyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1472400ORM1-family alanyl aminopeptidase, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1472400 OR M1-family alanyl aminopeptidase, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1474800 | PF3D7_1474800.1 | 3 | 3 | 1 | | | forward | protein coding | No | 765 | PF3D7_1474800 | proteasome subunit alpha type-1, putative | proteasome subunit alpha type-1, putative | 812298 | Q8IK90 | 14 | Pf3D7_14_v3:3,067,562..3,068,692(+) | Pf3D7_14_v3:3067562..3068692(+) | Pf3D7_14_v3 | Plasmodium falciparum 3D7 | 44 | OG6_102143 | 0 | 254 | 765 | 28837 | 5.42 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | GO:0005634;GO:0005839 | nucleus;proteasome core complex | GO:0004175 | endopeptidase activity | GO:0006511 | ubiquitin-dependent protein catabolic process | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1474800ORproteasome subunit alpha type-1, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1474800 OR proteasome subunit alpha type-1, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1476700 | PF3D7_1476700.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1062 | PF3D7_1476700 | lysophospholipase, putative | lysophospholipase, putative | 812319 | Q8IK69 | 14 | Pf3D7_14_v3:3,156,976..3,158,037(+) | Pf3D7_14_v3:3156976..3158037(+) | Pf3D7_14_v3 | Plasmodium falciparum 3D7 | 453 | OG6_100231 | 8 | 353 | 1062 | 41349 | 9.04 | 0 | | | | | | | | | | | GO:0016787 | hydrolase activity | | | 3.1.1.5 (Lysophospholipase) | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1476700ORlysophospholipase, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1476700 OR lysophospholipase, putative AND Plasmodium falciparum 3D7 |
|
PF3D7_1476800 | PF3D7_1476800.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1116 | PF3D7_1476800 | lysophospholipase, putative | lysophospholipase, putative | 812320 | Q8IK68 | 14 | Pf3D7_14_v3:3,159,487..3,160,602(+) | Pf3D7_14_v3:3159487..3160602(+) | Pf3D7_14_v3 | Plasmodium falciparum 3D7 | 453 | OG6_100231 | 8 | 371 | 1116 | 42713 | 8.98 | 0 | | | | | | | | | | | GO:0016787 | hydrolase activity | | | 3.1.1.5 (Lysophospholipase) | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PF3D7_1476800ORlysophospholipase, putativeANDPlasmodium falciparum 3D7 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PF3D7_1476800 OR lysophospholipase, putative AND Plasmodium falciparum 3D7 |