|
PKNH_0104300 | PKNH_0104300.1 | 8 | 8 | 1 | | | reverse | protein coding | No | 624 | PKNH_0104300 | cysteine-rich secretory protein, putative | cysteine-rich secretory protein, putative | 7318543 | B3KZ05 | 1 | PKNH_01_v2:256,223..258,140(-) | PKNH_01_v2:256223..258140(-) | PKNH_01_v2 | Plasmodium knowlesi strain H | 37 | OG6_101367 | 0 | 207 | 624 | 23500 | 5.87 | 0 | NN: MVDRRLHYLFALFCFLYLSRISSCKAV, HMM: MVDRRLHYLFALFCFLYLSRISSCK | NN Sum: 4, NN D: .66, HMM Prob: .98 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0104300ORcysteine-rich secretory protein, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0104300 OR cysteine-rich secretory protein, putative AND Plasmodium knowlesi strain H |
|
PKNH_0108300 | PKNH_0108300.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1542 | PKNH_0108300 | lysophospholipase, putative | lysophospholipase, putative | 7318432 | B3KZ42 | 1 | PKNH_01_v2:408,083..409,624(-) | PKNH_01_v2:408083..409624(-) | PKNH_01_v2 | Plasmodium knowlesi strain H | 455 | OG6_100231 | 6 | 513 | 1542 | 57401 | 9.38 | 0 | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0108300ORlysophospholipase, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0108300 OR lysophospholipase, putative AND Plasmodium knowlesi strain H |
|
PKNH_0108400 | PKNH_0108400.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1254 | PKNH_0108400 | prodrug activation and resistance esterase, putative | prodrug activation and resistance esterase, putative | 7318433 | B3KZ43 | 1 | PKNH_01_v2:411,241..412,494(-) | PKNH_01_v2:411241..412494(-) | PKNH_01_v2 | Plasmodium knowlesi strain H | 455 | OG6_100231 | 6 | 417 | 1254 | 46852 | 9.60 | 0 | | | | | | | | | GO:0005737 | cytoplasm | GO:0047372;GO:0016788 | acylglycerol lipase activity;hydrolase activity, acting on ester bonds | GO:0052651;GO:0042493 | monoacylglycerol catabolic process;response to drug | 3.1.1.23 (Acylglycerol lipase) | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0108400ORprodrug activation and resistance esterase, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0108400 OR prodrug activation and resistance esterase, putative AND Plasmodium knowlesi strain H |
|
PKNH_0108600 | PKNH_0108600.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 6876 | PKNH_0108600 | conserved protein, unknown function | conserved protein, unknown function | 7318435 | B3KZ45 | 1 | PKNH_01_v2:415,387..422,613(-) | PKNH_01_v2:415387..422613(-) | PKNH_01_v2 | Plasmodium knowlesi strain H | 43 | OG6_113142 | 0 | 2291 | 6876 | 264557 | 9.89 | 4 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0108600ORconserved protein, unknown functionANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0108600 OR conserved protein, unknown function AND Plasmodium knowlesi strain H |
|
PKNH_0110500 | PKNH_0110500.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1665 | PKNH_0110500 | plasmepsin X, putative | plasmepsin X, putative | 7318454 | B3KZ64 | 1 | PKNH_01_v2:491,558..493,222(+) | PKNH_01_v2:491558..493222(+) | PKNH_01_v2 | Plasmodium knowlesi strain H | 91 | OG6_119797 | 1 | 554 | 1665 | 62157 | 6.21 | 0 | HMM: MKDTKVLRTLLCGALFLLHLCQDARCH, NN: MKDTKVLRTLLCGALFLLHLCQDARCH | NN Sum: 4, NN D: .75, HMM Prob: .99 | | | | | | | GO:0044311 | exoneme | GO:0004190 | aspartic-type endopeptidase activity | GO:0030260;GO:0035891;GO:0006508 | entry into host cell;exit from host cell;proteolysis | 3.4.23.1 (Pepsin A) | 3.4.23.1 (Pepsin A) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0110500ORplasmepsin X, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0110500 OR plasmepsin X, putative AND Plasmodium knowlesi strain H |
|
PKNH_0110700 | PKNH_0110700.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3270 | PKNH_0110700 | conserved Plasmodium protein, unknown function | conserved Plasmodium protein, unknown function | 7318456 | B3KZ66 | 1 | PKNH_01_v2:499,929..503,198(-) | PKNH_01_v2:499929..503198(-) | PKNH_01_v2 | Plasmodium knowlesi strain H | 44 | OG6_128391 | 0 | 1089 | 3270 | 126458 | 10.06 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0110700ORconserved Plasmodium protein, unknown functionANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0110700 OR conserved Plasmodium protein, unknown function AND Plasmodium knowlesi strain H |
|
PKNH_0110900 | PKNH_0110900.1 | 2 | 2 | 1 | | | forward | protein coding | No | 1434 | PKNH_0110900 | 26S proteasome regulatory subunit RPN10, putative | 26S proteasome regulatory subunit RPN10, putative | 7318458 | B3KZ68 | 1 | PKNH_01_v2:507,206..509,012(+) | PKNH_01_v2:507206..509012(+) | PKNH_01_v2 | Plasmodium knowlesi strain H | 44 | OG6_102002 | 0 | 477 | 1434 | 53089 | 4.14 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0110900OR26S proteasome regulatory subunit RPN10, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0110900 OR 26S proteasome regulatory subunit RPN10, putative AND Plasmodium knowlesi strain H |
|
PKNH_0111000 | PKNH_0111000.1 | 2 | 2 | 1 | | | forward | protein coding | No | 1056 | PKNH_0111000 | serine protease DegP, putative | serine protease DegP, putative | 7318459 | B3KZ69 | 1 | PKNH_01_v2:509,551..510,780(+) | PKNH_01_v2:509551..510780(+) | PKNH_01_v2 | Plasmodium knowlesi strain H | 3 | OG6r1_118945 | 0 | 351 | 1056 | 39967 | 9.02 | 0 | HMM: MKLSLLSYSFCASVAAL, NN: MKLSLLSYSFCASVAAL | NN Sum: 3, NN D: .63, HMM Prob: .93 | | | | | | | | | | | | | 3.4.21.- (Serine endopeptidases.) | 3.4.21.- (Serine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0111000ORserine protease DegP, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0111000 OR serine protease DegP, putative AND Plasmodium knowlesi strain H |
|
PKNH_0111300 | PKNH_0111300.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 783 | PKNH_0111300 | proteasome subunit alpha type-6, putative | proteasome subunit alpha type-6, putative | 7318462 | B3KZ72 | 1 | PKNH_01_v2:519,488..520,765(-) | PKNH_01_v2:519488..520765(-) | PKNH_01_v2 | Plasmodium knowlesi strain H | 44 | OG6_102240 | 0 | 260 | 783 | 29455 | 5.18 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0111300ORproteasome subunit alpha type-6, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0111300 OR proteasome subunit alpha type-6, putative AND Plasmodium knowlesi strain H |
|
PKNH_0114200 | PKNH_0114200.1 | 7 | 7 | 1 | | | forward | protein coding | No | 735 | PKNH_0114200 | alpha/beta hydrolase, putative | alpha/beta hydrolase, putative | 7318490 | B3KZA0 | 1 | PKNH_01_v2:654,095..655,905(+) | PKNH_01_v2:654095..655905(+) | PKNH_01_v2 | Plasmodium knowlesi strain H | 134 | OG6_100915 | 3 | 244 | 735 | 27995 | 8.45 | 0 | | | | | | | | | | | | | | | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0114200ORalpha/beta hydrolase, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0114200 OR alpha/beta hydrolase, putative AND Plasmodium knowlesi strain H |
|
PKNH_0114800 | PKNH_0114800.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2022 | PKNH_0114800 | methionine aminopeptidase 1c, putative | methionine aminopeptidase 1c, putative | 7318496 | B3KZA6 | 1 | PKNH_01_v2:690,122..692,143(-) | PKNH_01_v2:690122..692143(-) | PKNH_01_v2 | Plasmodium knowlesi strain H | 44 | OG6_171502 | 0 | 673 | 2022 | 78790 | 8.91 | 0 | HMM: MKEYTLVLLTWALLWLFRGGESI, NN: MKEYTLVLLTWALLWLFRGGESI | NN Sum: 4, NN D: .88, HMM Prob: 1 | | | | | | | | | GO:0003729;GO:0070006;GO:0008235 | mRNA binding;metalloaminopeptidase activity;metalloexopeptidase activity | | | 3.4.11.18 (Methionyl aminopeptidase) | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0114800ORmethionine aminopeptidase 1c, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0114800 OR methionine aminopeptidase 1c, putative AND Plasmodium knowlesi strain H |
|
PKNH_0115100 | PKNH_0115100.1 | 2 | 2 | 1 | | | forward | protein coding | No | 771 | PKNH_0115100 | proteasome subunit beta type-4, putative | proteasome subunit beta type-4, putative | 7318499 | B3KZA9 | 1 | PKNH_01_v2:702,659..703,598(+) | PKNH_01_v2:702659..703598(+) | PKNH_01_v2 | Plasmodium knowlesi strain H | 44 | OG6_101718 | 0 | 256 | 771 | 29632 | 7.19 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0115100ORproteasome subunit beta type-4, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0115100 OR proteasome subunit beta type-4, putative AND Plasmodium knowlesi strain H |
|
PKNH_0117200 | PKNH_0117200.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 4848 | PKNH_0117200 | sentrin-specific protease 2, putative | sentrin-specific protease 2, putative | 7318400 | B3KZD0 | 1 | PKNH_01_v2:804,012..809,198(-) | PKNH_01_v2:804012..809198(-) | PKNH_01_v2 | Plasmodium knowlesi strain H | 34 | OG6_113308 | 0 | 1615 | 4848 | 182944 | 7.59 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.68 (Ulp1 peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0117200ORsentrin-specific protease 2, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0117200 OR sentrin-specific protease 2, putative AND Plasmodium knowlesi strain H |
|
PKNH_0205600 | PKNH_0205600.1 | 4 | 4 | 1 | | | forward | protein coding | No | 657 | PKNH_0205600 | proteasome subunit beta type-3, putative | proteasome subunit beta type-3, putative | 7318599 | B3KZJ5 | 2 | PKNH_02_v2:239,786..241,003(+) | PKNH_02_v2:239786..241003(+) | PKNH_02_v2 | Plasmodium knowlesi strain H | 45 | OG6_101970 | 0 | 218 | 657 | 24578 | 4.87 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | GO:0019774 | proteasome core complex, beta-subunit complex | | | GO:0006511 | ubiquitin-dependent protein catabolic process | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0205600ORproteasome subunit beta type-3, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0205600 OR proteasome subunit beta type-3, putative AND Plasmodium knowlesi strain H |
|
PKNH_0209200 | PKNH_0209200.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 10719 | PKNH_0209200 | ubiquitin carboxyl-terminal hydrolase 1, putative | ubiquitin carboxyl-terminal hydrolase 1, putative | 7,31,86,35,73,18,636 | B3KZN1,B3KZN2 | 2 | PKNH_02_v2:377,265..388,136(-) | PKNH_02_v2:377265..388136(-) | PKNH_02_v2 | Plasmodium knowlesi strain H | 38 | OG6_129339 | 0 | 3572 | 10719 | 404821 | 7.80 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0209200ORubiquitin carboxyl-terminal hydrolase 1, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0209200 OR ubiquitin carboxyl-terminal hydrolase 1, putative AND Plasmodium knowlesi strain H |
|
PKNH_0210100 | PKNH_0210100.1 | 1 | 1 | 1 | | | forward | protein coding | No | 4521 | PKNH_0210100 | zinc-carboxypeptidase, putative | zinc-carboxypeptidase, putative | 7318645 | B3KZP1 | 2 | PKNH_02_v2:424,260..428,780(+) | PKNH_02_v2:424260..428780(+) | PKNH_02_v2 | Plasmodium knowlesi strain H | 36 | OG6_101273 | 0 | 1506 | 4521 | 170016 | 9.96 | 0 | | | | | GO:0004181;GO:0008270 | metallocarboxypeptidase activity;zinc ion binding | GO:0006508 | proteolysis | | | | | | | 3.4.17.- (Metallocarboxypeptidases.) | 3.4.17.10 (Carboxypeptidase E) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0210100ORzinc-carboxypeptidase, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0210100 OR zinc-carboxypeptidase, putative AND Plasmodium knowlesi strain H |
|
PKNH_0211100 | PKNH_0211100.1 | 4 | 4 | 1 | | | reverse | protein coding | No | 8901 | PKNH_0211100 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | 7318678 | B3KZQ1 | 2 | PKNH_02_v2:476,310..485,789(-) | PKNH_02_v2:476310..485789(-) | PKNH_02_v2 | Plasmodium knowlesi strain H | 46 | OG6_101317 | 0 | 2966 | 8901 | 340221 | 8.32 | 0 | | | | | GO:0005515;GO:0036459 | protein binding;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0211100ORubiquitin carboxyl-terminal hydrolase, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0211100 OR ubiquitin carboxyl-terminal hydrolase, putative AND Plasmodium knowlesi strain H |
|
PKNH_0212000 | PKNH_0212000.1 | 3 | 3 | 1 | | | forward | protein coding | No | 771 | PKNH_0212000 | proteasome subunit alpha type-5, putative | proteasome subunit alpha type-5, putative | 7318687 | B3KZR0 | 2 | PKNH_02_v2:513,912..515,092(+) | PKNH_02_v2:513912..515092(+) | PKNH_02_v2 | Plasmodium knowlesi strain H | 44 | OG6_101621 | 0 | 256 | 771 | 28347 | 4.70 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0212000ORproteasome subunit alpha type-5, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0212000 OR proteasome subunit alpha type-5, putative AND Plasmodium knowlesi strain H |
|
PKNH_0213300 | PKNH_0213300.1 | 4 | 4 | 1 | | | reverse | protein coding | No | 1800 | PKNH_0213300 | alpha/beta hydrolase, putative | alpha/beta hydrolase, putative | 7318700 | B3KZS3 | 2 | PKNH_02_v2:575,916..578,875(-) | PKNH_02_v2:575916..578875(-) | PKNH_02_v2 | Plasmodium knowlesi strain H | 44 | OG6_110414 | 0 | 599 | 1800 | 68626 | 9.69 | 0 | | | | | | | | | | | GO:0016298 | lipase activity | GO:0006629 | lipid metabolic process | | 3.-.-.- (Hydrolases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0213300ORalpha/beta hydrolase, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0213300 OR alpha/beta hydrolase, putative AND Plasmodium knowlesi strain H |
|
PKNH_0301300 | PKNH_0301300.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1152 | PKNH_0301300 | ubiquitin specific protease, putative | ubiquitin specific protease, putative | 7318802 | B3KZW0 | 3 | PKNH_03_v2:60,845..61,996(+) | PKNH_03_v2:60845..61996(+) | PKNH_03_v2 | Plasmodium knowlesi strain H | 44 | OG6_208753 | 0 | 383 | 1152 | 45131 | 9.02 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0301300ORubiquitin specific protease, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0301300 OR ubiquitin specific protease, putative AND Plasmodium knowlesi strain H |
|
PKNH_0301800 | PKNH_0301800.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2163 | PKNH_0301800 | alpha/beta hydrolase, putative | alpha/beta hydrolase, putative | 7318795 | B3KZW7 | 3 | PKNH_03_v2:84,958..87,120(-) | PKNH_03_v2:84958..87120(-) | PKNH_03_v2 | Plasmodium knowlesi strain H | 134 | OG6_100915 | 3 | 720 | 2163 | 81081 | 9.63 | 0 | | | | | | | | | | | | | | | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0301800ORalpha/beta hydrolase, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0301800 OR alpha/beta hydrolase, putative AND Plasmodium knowlesi strain H |
|
PKNH_0302800 | PKNH_0302800.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 2298 | PKNH_0302800 | dipeptidyl aminopeptidase 3, putative | dipeptidyl aminopeptidase 3, putative | 7318785 | B3KZX7 | 3 | PKNH_03_v2:149,002..151,447(-) | PKNH_03_v2:149002..151447(-) | PKNH_03_v2 | Plasmodium knowlesi strain H | 38 | OG6_533572 | 0 | 765 | 2298 | 87685 | 6.74 | 0 | NN: MILICLLFLAFVSYAKCD, HMM: MILICLLFLAFVSYAKCD | NN Sum: 4, NN D: .87, HMM Prob: 1 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | GO:0045177;GO:0044164 | apical part of cell;host cell cytosol | GO:0004177 | aminopeptidase activity | | | 3.4.14.4 (Dipeptidyl-peptidase III) | 3.4.14.4 (Dipeptidyl-peptidase III) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0302800ORdipeptidyl aminopeptidase 3, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0302800 OR dipeptidyl aminopeptidase 3, putative AND Plasmodium knowlesi strain H |
|
PKNH_0306900 | PKNH_0306900.1 | 5 | 5 | 1 | | | forward | protein coding | No | 2085 | PKNH_0306900 | tRNA N6-adenosine threonylcarbamoyltransferase, putative | tRNA N6-adenosine threonylcarbamoyltransferase, putative | 7318912 | B3L018 | 3 | PKNH_03_v2:325,441..328,097(+) | PKNH_03_v2:325441..328097(+) | PKNH_03_v2 | Plasmodium knowlesi strain H | 88 | OG6_100288 | 1 | 694 | 2085 | 80070 | 9.00 | 1 | NN: MKNAIKNLAIYLPCVLSLLLYVHYAY, HMM: MKNAIKNLAIYLPCVLSLLLYVHYAY | NN Sum: 3, NN D: .62, HMM Prob: .37 | | | | | | | | | | | | | 2.3.1.234 (N(6)-L-threonylcarbamoyladenine synthase) | 2.3.1.234 (N(6)-L-threonylcarbamoyladenine synthase) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0306900ORtRNA N6-adenosine threonylcarbamoyltransferase, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0306900 OR tRNA N6-adenosine threonylcarbamoyltransferase, putative AND Plasmodium knowlesi strain H |
|
PKNH_0314000 | PKNH_0314000.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1401 | PKNH_0314000 | conserved Plasmodium membrane protein, unknown function | conserved Plasmodium membrane protein, unknown function | | | 3 | PKNH_03_v2:669,982..671,382(-) | PKNH_03_v2:669982..671382(-) | PKNH_03_v2 | Plasmodium knowlesi strain H | 44 | OG6_533066 | 0 | 466 | 1401 | 52954 | 9.21 | 5 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0314000ORconserved Plasmodium membrane protein, unknown functionANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0314000 OR conserved Plasmodium membrane protein, unknown function AND Plasmodium knowlesi strain H |
|
PKNH_0317700 | PKNH_0317700.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2880 | PKNH_0317700 | ubiquitin C-terminal hydrolase, putative | ubiquitin C-terminal hydrolase, putative | 7318844 | B3L0B2 | 3 | PKNH_03_v2:813,182..816,061(-) | PKNH_03_v2:813182..816061(-) | PKNH_03_v2 | Plasmodium knowlesi strain H | 43 | OG6_532410 | 0 | 959 | 2880 | 109983 | 6.41 | 0 | | | | | GO:0008270 | zinc ion binding | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0317700ORubiquitin C-terminal hydrolase, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0317700 OR ubiquitin C-terminal hydrolase, putative AND Plasmodium knowlesi strain H |
|
PKNH_0406000 | PKNH_0406000.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 3984 | PKNH_0406000 | conserved Plasmodium protein, unknown function | conserved Plasmodium protein, unknown function | 7319172 | B3L0K3 | 4 | PKNH_04_v2:234,645..238,757(-) | PKNH_04_v2:234645..238757(-) | PKNH_04_v2 | Plasmodium knowlesi strain H | 20 | OG6_532626 | 0 | 1327 | 3984 | 153154 | 8.62 | 11 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0406000ORconserved Plasmodium protein, unknown functionANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0406000 OR conserved Plasmodium protein, unknown function AND Plasmodium knowlesi strain H |
|
PKNH_0413100 | PKNH_0413100.1 | 6 | 6 | 1 | | | forward | protein coding | No | 2853 | PKNH_0413100 | cysteine protease, putative | cysteine protease, putative | 7319261 | B3L0S3 | 4 | PKNH_04_v2:570,335..573,924(+) | PKNH_04_v2:570335..573924(+) | PKNH_04_v2 | Plasmodium knowlesi strain H | 374 | OG6_126098 | 6 | 950 | 2853 | 106727 | 6.54 | 1 | NN: MNPRISFTWAICALFGTYVAAQ, HMM: MNPRISFTWAICALFGTYVAAQ | NN Sum: 4, NN D: .75, HMM Prob: .98 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0413100ORcysteine protease, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0413100 OR cysteine protease, putative AND Plasmodium knowlesi strain H |
|
PKNH_0413200 | PKNH_0413200.1 | 4 | 4 | 1 | | | forward | protein coding | No | 3348 | PKNH_0413200 | cysteine protease, putative | cysteine protease, putative | 7319262 | B3L0S4 | 4 | PKNH_04_v2:576,338..580,170(+) | PKNH_04_v2:576338..580170(+) | PKNH_04_v2 | Plasmodium knowlesi strain H | 374 | OG6_126098 | 6 | 1115 | 3348 | 120654 | 4.51 | 0 | HMM: MKLRICALLLIGLAFASGGARCA, NN: MKLRICALLLIGLAFASGGARCA | NN Sum: 4, NN D: .83, HMM Prob: 1 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0413200ORcysteine protease, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0413200 OR cysteine protease, putative AND Plasmodium knowlesi strain H |
|
PKNH_0413300 | PKNH_0413300.1 | 2 | 2 | 1 | | | forward | protein coding | No | 1272 | PKNH_0413300 | cysteine protease, putative | cysteine protease, putative | 7319263 | B3L0S5 | 4 | PKNH_04_v2:581,933..583,322(+) | PKNH_04_v2:581933..583322(+) | PKNH_04_v2 | Plasmodium knowlesi strain H | 1 | OG6r1_162167 | 0 | 423 | 1272 | 47890 | 5.51 | 0 | HMM: MFLLFFTKSFNAGSLLTHNSGGSVNAE, NN: MFLLFFTKSFNAGSLLTH | NN Sum: 3, NN D: .39, HMM Prob: .28 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0413300ORcysteine protease, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0413300 OR cysteine protease, putative AND Plasmodium knowlesi strain H |
|
PKNH_0413400 | PKNH_0413400.1 | 4 | 4 | 1 | | | forward | protein coding | No | 3240 | PKNH_0413400 | cysteine protease, putative | cysteine protease, putative | 7319264 | B3L0S6 | 4 | PKNH_04_v2:585,320..589,203(+) | PKNH_04_v2:585320..589203(+) | PKNH_04_v2 | Plasmodium knowlesi strain H | 374 | OG6_126098 | 6 | 1079 | 3240 | 119371 | 4.59 | 0 | HMM: MKSSFLLLLALCATYGN, NN: MKSSFLLLLALCATYGNNLAI | NN Sum: 4, NN D: .73, HMM Prob: 1 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0413400ORcysteine protease, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0413400 OR cysteine protease, putative AND Plasmodium knowlesi strain H |
|
PKNH_0413500 | PKNH_0413500.1 | 4 | 4 | 1 | | | forward | protein coding | No | 1581 | PKNH_0413500 | cysteine protease, putative | cysteine protease, putative | 7319265 | B3L0S7 | 4 | PKNH_04_v2:590,286..592,456(+) | PKNH_04_v2:590286..592456(+) | PKNH_04_v2 | Plasmodium knowlesi strain H | 374 | OG6_126098 | 6 | 526 | 1581 | 56677 | 4.51 | 0 | NN: MKARLSLILILCAVCRECT, HMM: MKARLSLILILCAVCRECTVRCT | NN Sum: 2, NN D: .59, HMM Prob: 1 | | | | | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0413500ORcysteine protease, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0413500 OR cysteine protease, putative AND Plasmodium knowlesi strain H |
|
PKNH_0413600 | PKNH_0413600.1 | 4 | 4 | 1 | | | forward | protein coding | No | 3018 | PKNH_0413600 | cysteine protease, putative | cysteine protease, putative | 7319266 | B3L0S8 | 4 | PKNH_04_v2:593,823..597,471(+) | PKNH_04_v2:593823..597471(+) | PKNH_04_v2 | Plasmodium knowlesi strain H | 374 | OG6_126098 | 6 | 1005 | 3018 | 113446 | 6.35 | 0 | HMM: MIKRPVALILILAFLTSANVTICE, NN: MIKRPVALILILAFLTSANVTICE | NN Sum: 4, NN D: .77, HMM Prob: 1 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0413600ORcysteine protease, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0413600 OR cysteine protease, putative AND Plasmodium knowlesi strain H |
|
PKNH_0413700 | PKNH_0413700.1 | 4 | 4 | 1 | | | forward | protein coding | No | 2919 | PKNH_0413700 | cysteine protease, putative | cysteine protease, putative | 7319267 | B3L0S9 | 4 | PKNH_04_v2:598,555..602,227(+) | PKNH_04_v2:598555..602227(+) | PKNH_04_v2 | Plasmodium knowlesi strain H | 374 | OG6_126098 | 6 | 972 | 2919 | 108379 | 6.58 | 0 | NN: MVSRFSVLLIICVTLGTYVTRCGGD, HMM: MVSRFSVLLIICVTLGTYVTRCGGD | NN Sum: 4, NN D: .71, HMM Prob: .95 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0413700ORcysteine protease, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0413700 OR cysteine protease, putative AND Plasmodium knowlesi strain H |
|
PKNH_0413800 | PKNH_0413800.1 | 6 | 6 | 1 | | | forward | protein coding | No | 2118 | PKNH_0413800 | cysteine protease, putative | cysteine protease, putative | 7319268 | B3L0T0 | 4 | PKNH_04_v2:604,410..607,310(+) | PKNH_04_v2:604410..607310(+) | PKNH_04_v2 | Plasmodium knowlesi strain H | 374 | OG6_126098 | 6 | 705 | 2118 | 81921 | 7.13 | 0 | HMM: MKINQIAQYVVFTLVAHLVKRVKSN, NN: MKINQIAQYVVFTLVAHLVKRVKSN | NN Sum: 3, NN D: .51, HMM Prob: .07 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0413800ORcysteine protease, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0413800 OR cysteine protease, putative AND Plasmodium knowlesi strain H |
|
PKNH_0419200 | PKNH_0419200.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3456 | PKNH_0419200 | conserved Plasmodium protein, unknown function | conserved Plasmodium protein, unknown function | 7322666 | B3LBG8 | 4 | PKNH_04_v2:837,801..841,256(-) | PKNH_04_v2:837801..841256(-) | PKNH_04_v2 | Plasmodium knowlesi strain H | 42 | OG6_532401 | 0 | 1151 | 3456 | 132163 | 9.08 | 0 | | | | | GO:0003677 | DNA binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0419200ORconserved Plasmodium protein, unknown functionANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0419200 OR conserved Plasmodium protein, unknown function AND Plasmodium knowlesi strain H |
|
PKNH_0420200 | PKNH_0420200.1 | 3 | 3 | 1 | | | forward | protein coding | No | 306 | PKNH_0420200 | signal peptidase complex subunit SPC1, putative | signal peptidase complex subunit SPC1, putative | 7322656 | B3LBF8 | 4 | PKNH_04_v2:895,458..896,031(+) | PKNH_04_v2:895458..896031(+) | PKNH_04_v2 | Plasmodium knowlesi strain H | 44 | OG6_103297 | 0 | 101 | 306 | 11670 | 10.20 | 2 | | | GO:0016021;GO:0005787 | integral component of membrane;signal peptidase complex | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0420200ORsignal peptidase complex subunit SPC1, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0420200 OR signal peptidase complex subunit SPC1, putative AND Plasmodium knowlesi strain H |
|
PKNH_0421200 | PKNH_0421200.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1632 | PKNH_0421200 | methionine aminopeptidase 2, putative | methionine aminopeptidase 2, putative | 7322646 | B3LBE8 | 4 | PKNH_04_v2:956,856..958,487(+) | PKNH_04_v2:956856..958487(+) | PKNH_04_v2 | Plasmodium knowlesi strain H | 45 | OG6_100815 | 0 | 543 | 1632 | 61279 | 7.82 | 0 | | | | | GO:0004177;GO:0008235 | aminopeptidase activity;metalloexopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0421200ORmethionine aminopeptidase 2, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0421200 OR methionine aminopeptidase 2, putative AND Plasmodium knowlesi strain H |
|
PKNH_0423300 | PKNH_0423300.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 2523 | PKNH_0423300 | conserved protein, unknown function | conserved protein, unknown function | 7322624 | B3LBC6 | 4 | PKNH_04_v2:1,046,821..1,049,488(-) | PKNH_04_v2:1046821..1049488(-) | PKNH_04_v2 | Plasmodium knowlesi strain H | 45 | OG6_146174 | 0 | 840 | 2523 | 98073 | 8.19 | 0 | HMM: MIAKRLLLGSLASRSFGR, NN: MIAKRLLLGSLASRSFGR | NN Sum: 2, NN D: .39, HMM Prob: .56 | | | | | | | | | | | | | | 3.4.21.92 (Endopeptidase Clp) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0423300ORconserved protein, unknown functionANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0423300 OR conserved protein, unknown function AND Plasmodium knowlesi strain H |
|
PKNH_0423400 | PKNH_0423400.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 765 | PKNH_0423400 | ATP-dependent Clp protease proteolytic subunit, putative | ATP-dependent Clp protease proteolytic subunit, putative | | | 4 | PKNH_04_v2:1,049,619..1,050,383(-) | PKNH_04_v2:1049619..1050383(-) | PKNH_04_v2 | Plasmodium knowlesi strain H | 42 | OG6_113660 | 0 | 254 | 765 | 28775 | 9.57 | 0 | HMM: MQSYPLLLLLLLLAAIALSPICAH, NN: MQSYPLLLLLLLLAAIALSPICAH | NN Sum: 4, NN D: .81, HMM Prob: 1 | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0020011 | apicoplast | | | | | 3.4.21.92 (Endopeptidase Clp) | 3.4.21.92 (Endopeptidase Clp) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0423400ORATP-dependent Clp protease proteolytic subunit, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0423400 OR ATP-dependent Clp protease proteolytic subunit, putative AND Plasmodium knowlesi strain H |
|
PKNH_0501300 | PKNH_0501300.1 | 11 | 11 | 1 | | | forward | protein coding | No | 909 | PKNH_0501300 | BEM46-like protein, putative | BEM46-like protein, putative | 7319533 | B3L1B3 | 5 | PKNH_05_v2:53,981..56,955(+) | PKNH_05_v2:53981..56955(+) | PKNH_05_v2 | Plasmodium knowlesi strain H | 45 | OG6_101827 | 0 | 302 | 909 | 34753 | 9.51 | 1 | HMM: MKLFKFLWIPVVTVLLLVLVLNGY, NN: MKLFKFLWIPVVTVLLLVLVLNGY | NN Sum: 4, NN D: .89, HMM Prob: .73 | | | | | | | | | GO:0016298 | lipase activity | GO:0006629 | lipid metabolic process | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0501300ORBEM46-like protein, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0501300 OR BEM46-like protein, putative AND Plasmodium knowlesi strain H |
|
PKNH_0503800 | PKNH_0503800.1 | 1 | 1 | 1 | | | forward | protein coding | No | 3153 | PKNH_0503800 | chaperone protein ClpB1, putative | chaperone protein ClpB1, putative | 7319560 | B3L1E0 | 5 | PKNH_05_v2:162,111..165,263(+) | PKNH_05_v2:162111..165263(+) | PKNH_05_v2 | Plasmodium knowlesi strain H | 95 | OG6_100223 | 1 | 1050 | 3153 | 118174 | 8.68 | 0 | HMM: MSRTGSRTTLFLLFFLINSLFFWKEQSGK, NN: MSRTGSRTTLFLLFFLINSLFFWKEQSGK | NN Sum: 3, NN D: .6, HMM Prob: .7 | | | GO:0005524 | ATP binding | GO:0019538 | protein metabolic process | | | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0503800ORchaperone protein ClpB1, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0503800 OR chaperone protein ClpB1, putative AND Plasmodium knowlesi strain H |
|
PKNH_0505200 | PKNH_0505200.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 1179 | PKNH_0505200 | 26S protease regulatory subunit 6B, putative | 26S protease regulatory subunit 6B, putative | 7319574 | B3L1F4 | 5 | PKNH_05_v2:202,740..204,076(-) | PKNH_05_v2:202740..204076(-) | PKNH_05_v2 | Plasmodium knowlesi strain H | 42 | OG6_101965 | 0 | 392 | 1179 | 44789 | 9.16 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | GO:0008540 | proteasome regulatory particle, base subcomplex | | | GO:0070682;GO:0006511 | proteasome regulatory particle assembly;ubiquitin-dependent protein catabolic process | 3.6.4.8 (Transferred entry: 5.6.1.5) | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0505200OR26S protease regulatory subunit 6B, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0505200 OR 26S protease regulatory subunit 6B, putative AND Plasmodium knowlesi strain H |
|
PKNH_0505500 | PKNH_0505500.1 | 4 | 4 | 1 | | | reverse | protein coding | No | 2679 | PKNH_0505500 | ubiquitin carboxyl-terminal hydrolase 13, putative | ubiquitin carboxyl-terminal hydrolase 13, putative | 7319577 | B3L1F7 | 5 | PKNH_05_v2:210,074..213,232(-) | PKNH_05_v2:210074..213232(-) | PKNH_05_v2 | Plasmodium knowlesi strain H | 42 | OG6_101380 | 0 | 892 | 2679 | 101919 | 5.07 | 0 | | | | | GO:0004843;GO:0036459;GO:0008270 | thiol-dependent ubiquitin-specific protease activity;thiol-dependent ubiquitinyl hydrolase activity;zinc ion binding | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | GO:0101005 | ubiquitinyl hydrolase activity | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0505500ORubiquitin carboxyl-terminal hydrolase 13, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0505500 OR ubiquitin carboxyl-terminal hydrolase 13, putative AND Plasmodium knowlesi strain H |
|
PKNH_0512000 | PKNH_0512000.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 1002 | PKNH_0512000 | conserved Plasmodium protein, unknown function | conserved Plasmodium protein, unknown function | 7319351 | B3L1L9 | 5 | PKNH_05_v2:516,247..517,512(-) | PKNH_05_v2:516247..517512(-) | PKNH_05_v2 | Plasmodium knowlesi strain H | 43 | OG6_174320 | 0 | 333 | 1002 | 39085 | 9.56 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0512000ORconserved Plasmodium protein, unknown functionANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0512000 OR conserved Plasmodium protein, unknown function AND Plasmodium knowlesi strain H |
|
PKNH_0516400 | PKNH_0516400.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1197 | PKNH_0516400 | lysophospholipase, putative | lysophospholipase, putative | 7319423 | B3L1R3 | 5 | PKNH_05_v2:734,464..735,660(+) | PKNH_05_v2:734464..735660(+) | PKNH_05_v2 | Plasmodium knowlesi strain H | 455 | OG6_100231 | 6 | 398 | 1197 | 45569 | 5.85 | 1 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0516400ORlysophospholipase, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0516400 OR lysophospholipase, putative AND Plasmodium knowlesi strain H |
|
PKNH_0601400 | PKNH_0601400.1 | 2 | 2 | 1 | | | forward | protein coding | No | 1677 | PKNH_0601400 | enoyl-CoA hydratase-related protein, putative | enoyl-CoA hydratase-related protein, putative | 7319805 | B3L1T1 | 6 | PKNH_06_v2:60,814..62,633(+) | PKNH_06_v2:60814..62633(+) | PKNH_06_v2 | Plasmodium knowlesi strain H | 43 | OG6_134153 | 0 | 558 | 1677 | 64955 | 8.56 | 0 | | | | | GO:0003860 | 3-hydroxyisobutyryl-CoA hydrolase activity | | | | | | | | | 4.2.1.17 (Enoyl-CoA hydratase) | 3.1.2.4 (3-hydroxyisobutyryl-CoA hydrolase) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0601400ORenoyl-CoA hydratase-related protein, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0601400 OR enoyl-CoA hydratase-related protein, putative AND Plasmodium knowlesi strain H |
|
PKNH_0602500 | PKNH_0602500.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2433 | PKNH_0602500 | peptidase, putative | peptidase, putative | 7319816 | B3L1U2 | 6 | PKNH_06_v2:95,892..98,324(-) | PKNH_06_v2:95892..98324(-) | PKNH_06_v2 | Plasmodium knowlesi strain H | 44 | OG6_124535 | 0 | 810 | 2433 | 92432 | 5.83 | 1 | NN: MDLYHVKCRRWSVLPFLLYGLLILYGGSE, HMM: MDLYHVKCRRWSVLPFLLYGLLILYGGSE | NN Sum: 4, NN D: .7, HMM Prob: .13 | | | | | | | | | | | | | | 3.1.3.16 (Protein-serine/threonine phosphatase) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0602500ORpeptidase, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0602500 OR peptidase, putative AND Plasmodium knowlesi strain H |
|
PKNH_0604100 | PKNH_0604100.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 375 | PKNH_0604100 | autophagy-related protein 8, putative | autophagy-related protein 8, putative | 7319678 | B3L1V7 | 6 | PKNH_06_v2:170,824..171,198(-) | PKNH_06_v2:170824..171198(-) | PKNH_06_v2 | Plasmodium knowlesi strain H | 45 | OG6_100707 | 0 | 124 | 375 | 14620 | 8.04 | 0 | | | | | | | | | GO:0020011;GO:0031410 | apicoplast;cytoplasmic vesicle | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0604100ORautophagy-related protein 8, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0604100 OR autophagy-related protein 8, putative AND Plasmodium knowlesi strain H |
|
PKNH_0615300 | PKNH_0615300.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1791 | PKNH_0615300 | tRNA N6-adenosine threonylcarbamoyltransferase, putative | tRNA N6-adenosine threonylcarbamoyltransferase, putative | 7319634 | B3L268 | 6 | PKNH_06_v2:678,343..680,133(-) | PKNH_06_v2:678343..680133(-) | PKNH_06_v2 | Plasmodium knowlesi strain H | 88 | OG6_100288 | 1 | 596 | 1791 | 66139 | 7.57 | 0 | | | | | | | | | | | | | | | 2.3.1.234 (N(6)-L-threonylcarbamoyladenine synthase) | 2.3.1.234 (N(6)-L-threonylcarbamoyladenine synthase) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0615300ORtRNA N6-adenosine threonylcarbamoyltransferase, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0615300 OR tRNA N6-adenosine threonylcarbamoyltransferase, putative AND Plasmodium knowlesi strain H |
|
PKNH_0616100 | PKNH_0616100.1 | 8 | 8 | 1 | | | forward | protein coding | No | 2730 | PKNH_0616100 | OTU-like cysteine protease, putative | OTU-like cysteine protease, putative | 7319642 | B3L276 | 6 | PKNH_06_v2:697,881..701,990(+) | PKNH_06_v2:697881..701990(+) | PKNH_06_v2 | Plasmodium knowlesi strain H | 45 | OG6_104209 | 0 | 909 | 2730 | 104719 | 7.14 | 0 | | | | | | | | | GO:0020011;GO:0005829;GO:0031982 | apicoplast;cytosol;vesicle | GO:0008233 | peptidase activity | GO:1903060 | negative regulation of protein lipidation | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0616100OROTU-like cysteine protease, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0616100 OR OTU-like cysteine protease, putative AND Plasmodium knowlesi strain H |
|
PKNH_0617300 | PKNH_0617300.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 789 | PKNH_0617300 | DER1-like protein, putative | DER1-like protein, putative | 7319654 | B3L288 | 6 | PKNH_06_v2:765,730..766,981(-) | PKNH_06_v2:765730..766981(-) | PKNH_06_v2 | Plasmodium knowlesi strain H | 44 | OG6_113960 | 0 | 262 | 789 | 30731 | 9.83 | 5 | HMM: MDISGPEVWYGNLPNVTKYLITLIFLVTLLITCNLL, NN: MDISGPEVWYGNLPNVTKYLITLIFLVTLLITCNLL | NN Sum: 3, NN D: .49, HMM Prob: .03 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0617300ORDER1-like protein, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0617300 OR DER1-like protein, putative AND Plasmodium knowlesi strain H |
|
PKNH_0618600 | PKNH_0618600.1 | 8 | 8 | 1 | | | forward | protein coding | No | 1434 | PKNH_0618600 | aspartyl protease, putative | aspartyl protease, putative | 7319667 | B3L2A1 | 6 | PKNH_06_v2:819,661..822,194(+) | PKNH_06_v2:819661..822194(+) | PKNH_06_v2 | Plasmodium knowlesi strain H | 46 | OG6_139465 | 0 | 477 | 1434 | 54406 | 6.34 | 0 | NN: MTPNMVARIGFLCLLNIWLSTFSSSLLK, HMM: MTPNMVARIGFLCLLNIWLSTFSSSLLK | NN Sum: 3, NN D: .65, HMM Prob: .97 | | | GO:0004190 | aspartic-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0618600ORaspartyl protease, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0618600 OR aspartyl protease, putative AND Plasmodium knowlesi strain H |
|
PKNH_0702100 | PKNH_0702100.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 558 | PKNH_0702100 | signal peptidase complex subunit 3, putative | signal peptidase complex subunit 3, putative | 7319841 | B3L354 | 7 | PKNH_07_v2:120,624..121,181(-) | PKNH_07_v2:120624..121181(-) | PKNH_07_v2 | Plasmodium knowlesi strain H | 43 | OG6_102447 | 0 | 185 | 558 | 21806 | 9.47 | 1 | NN: MDNVLNRLNVISYSMALCFLILCLFNYGTSF, HMM: MDNVLNRLNVISYSMALCFLILCLFNYGTSF | NN Sum: 4, NN D: .75, HMM Prob: .38 | GO:0016021;GO:0005787 | integral component of membrane;signal peptidase complex | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | | | | | | | 3.4.21.89 (Signal peptidase I) | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0702100ORsignal peptidase complex subunit 3, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0702100 OR signal peptidase complex subunit 3, putative AND Plasmodium knowlesi strain H |
|
PKNH_0702300 | PKNH_0702300.1 | 2 | 2 | 1 | | | forward | protein coding | No | 4674 | PKNH_0702300 | ubiquitin specific protease, putative | ubiquitin specific protease, putative | 7319843 | B3L356 | 7 | PKNH_07_v2:126,657..131,480(+) | PKNH_07_v2:126657..131480(+) | PKNH_07_v2 | Plasmodium knowlesi strain H | 35 | OG6_122792 | 0 | 1557 | 4674 | 175472 | 6.26 | 0 | | | | | GO:0004843;GO:0036459 | thiol-dependent ubiquitin-specific protease activity;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0702300ORubiquitin specific protease, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0702300 OR ubiquitin specific protease, putative AND Plasmodium knowlesi strain H |
|
PKNH_0705200 | PKNH_0705200.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2511 | PKNH_0705200 | ATP-dependent protease ATPase subunit ClpY, putative | ATP-dependent protease ATPase subunit ClpY, putative | 7319871 | B3L384 | 7 | PKNH_07_v2:279,250..281,760(-) | PKNH_07_v2:279250..281760(-) | PKNH_07_v2 | Plasmodium knowlesi strain H | 44 | OG6_106348 | 0 | 836 | 2511 | 95048 | 7.05 | 0 | | | GO:0009376;GO:0005737 | HslUV protease complex;cytoplasm | GO:0005524;GO:0016887;GO:0070011 | ATP binding;ATPase activity;peptidase activity, acting on L-amino acid peptides | | | GO:0009376 | HslUV protease complex | | | | | | 2.7.1.71 (Shikimate kinase) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0705200ORATP-dependent protease ATPase subunit ClpY, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0705200 OR ATP-dependent protease ATPase subunit ClpY, putative AND Plasmodium knowlesi strain H |
|
PKNH_0710800 | PKNH_0710800.1 | 2 | 2 | 1 | | | forward | protein coding | No | 981 | PKNH_0710800 | 26S proteasome regulatory subunit RPN8, putative | 26S proteasome regulatory subunit RPN8, putative | 7320129 | B3L3E0 | 7 | PKNH_07_v2:529,903..530,995(+) | PKNH_07_v2:529903..530995(+) | PKNH_07_v2 | Plasmodium knowlesi strain H | 47 | OG6_102054 | 0 | 326 | 981 | 37449 | 7.10 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 3.1.3.16 (Protein-serine/threonine phosphatase) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0710800OR26S proteasome regulatory subunit RPN8, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0710800 OR 26S proteasome regulatory subunit RPN8, putative AND Plasmodium knowlesi strain H |
|
PKNH_0711400 | PKNH_0711400.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 1314 | PKNH_0711400 | protease, putative | protease, putative | 7320135 | B3L2F3 | 7 | PKNH_07_v2:544,514..546,202(-) | PKNH_07_v2:544514..546202(-) | PKNH_07_v2 | Plasmodium knowlesi strain H | 43 | OG6_112025 | 0 | 437 | 1314 | 51962 | 9.73 | 9 | NN: MMLHFFCIVLILQLYVGCF, HMM: MMLHFFCIVLILQLYVGCF | NN Sum: 4, NN D: .71, HMM Prob: .89 | GO:0016020 | membrane | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0711400ORprotease, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0711400 OR protease, putative AND Plasmodium knowlesi strain H |
|
PKNH_0716300 | PKNH_0716300.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 963 | PKNH_0716300 | eukaryotic translation initiation factor 3 subunit F, putative | eukaryotic translation initiation factor 3 subunit F, putative | 7319909 | B3L2K1 | 7 | PKNH_07_v2:725,921..727,052(-) | PKNH_07_v2:725921..727052(-) | PKNH_07_v2 | Plasmodium knowlesi strain H | 44 | OG6_103242 | 0 | 320 | 963 | 36639 | 6.76 | 0 | | | | | GO:0005515 | protein binding | | | GO:0005852 | eukaryotic translation initiation factor 3 complex | GO:0003743 | translation initiation factor activity | GO:0006413 | translational initiation | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0716300OReukaryotic translation initiation factor 3 subunit F, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0716300 OR eukaryotic translation initiation factor 3 subunit F, putative AND Plasmodium knowlesi strain H |
|
PKNH_0717200 | PKNH_0717200.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 894 | PKNH_0717200 | PPPDE peptidase, putative | PPPDE peptidase, putative | 7319917 | B3L2K9 | 7 | PKNH_07_v2:765,627..766,661(-) | PKNH_07_v2:765627..766661(-) | PKNH_07_v2 | Plasmodium knowlesi strain H | 90 | OG6_101256 | 1 | 297 | 894 | 33323 | 8.24 | 0 | | | | | | | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0717200ORPPPDE peptidase, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0717200 OR PPPDE peptidase, putative AND Plasmodium knowlesi strain H |
|
PKNH_0721100 | PKNH_0721100.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 699 | PKNH_0721100 | OTU domain-containing protein, putative | OTU domain-containing protein, putative | 7319955 | B3L2P8 | 7 | PKNH_07_v2:916,163..916,861(-) | PKNH_07_v2:916163..916861(-) | PKNH_07_v2 | Plasmodium knowlesi strain H | 44 | OG6_124705 | 0 | 232 | 699 | 27701 | 8.83 | 0 | | | | | | | | | GO:0005737 | cytoplasm | | | GO:0016579 | protein deubiquitination | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0721100OROTU domain-containing protein, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0721100 OR OTU domain-containing protein, putative AND Plasmodium knowlesi strain H |
|
PKNH_0730500 | PKNH_0730500.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 849 | PKNH_0730500 | proteasome subunit beta type-6, putative | proteasome subunit beta type-6, putative | 7320051 | B3L2Z4 | 7 | PKNH_07_v2:1,353,815..1,354,663(-) | PKNH_07_v2:1353815..1354663(-) | PKNH_07_v2 | Plasmodium knowlesi strain H | 44 | OG6_101390 | 0 | 282 | 849 | 32066 | 6.51 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | GO:0005622 | intracellular | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0730500ORproteasome subunit beta type-6, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0730500 OR proteasome subunit beta type-6, putative AND Plasmodium knowlesi strain H |
|
PKNH_0731000 | PKNH_0731000.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1605 | PKNH_0731000 | M18 aspartyl aminopeptidase, putative | M18 aspartyl aminopeptidase, putative | 7320170 | B3L2Z8 | 7 | PKNH_07_v2:1,369,379..1,370,983(-) | PKNH_07_v2:1369379..1370983(-) | PKNH_07_v2 | Plasmodium knowlesi strain H | 44 | OG6_102047 | 0 | 534 | 1605 | 60446 | 6.41 | 0 | | | | | GO:0004177;GO:0008270 | aminopeptidase activity;zinc ion binding | GO:0006508 | proteolysis | | | | | | | 3.4.11.21 (Aspartyl aminopeptidase) | 3.4.11.21 (Aspartyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0731000ORM18 aspartyl aminopeptidase, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0731000 OR M18 aspartyl aminopeptidase, putative AND Plasmodium knowlesi strain H |
|
PKNH_0732300 | PKNH_0732300.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1404 | PKNH_0732300 | mitochondrial-processing peptidase subunit beta, putative | mitochondrial-processing peptidase subunit beta, putative | 7320063 | B3L310 | 7 | PKNH_07_v2:1,408,154..1,409,557(-) | PKNH_07_v2:1408154..1409557(-) | PKNH_07_v2 | Plasmodium knowlesi strain H | 44 | OG6_100777 | 0 | 467 | 1404 | 53432 | 6.46 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | GO:0006508 | proteolysis | GO:0017087 | mitochondrial processing peptidase complex | GO:0004222 | metalloendopeptidase activity | GO:0006627 | protein processing involved in protein targeting to mitochondrion | 3.4.24.64 (Mitochondrial processing peptidase) | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0732300ORmitochondrial-processing peptidase subunit beta, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0732300 OR mitochondrial-processing peptidase subunit beta, putative AND Plasmodium knowlesi strain H |
|
PKNH_0735000 | PKNH_0735000.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1281 | PKNH_0735000 | lysophospholipase, putative | lysophospholipase, putative | 7320089 | B3L336 | 7 | PKNH_07_v2:1,493,581..1,494,861(+) | PKNH_07_v2:1493581..1494861(+) | PKNH_07_v2 | Plasmodium knowlesi strain H | 455 | OG6_100231 | 6 | 426 | 1281 | 48810 | 9.61 | 0 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0735000ORlysophospholipase, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0735000 OR lysophospholipase, putative AND Plasmodium knowlesi strain H |
|
PKNH_0804500 | PKNH_0804500.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 2214 | PKNH_0804500 | peptidase, putative | peptidase, putative | 7320530 | B3L3I8 | 8 | PKNH_08_v2:231,935..234,332(-) | PKNH_08_v2:231935..234332(-) | PKNH_08_v2 | Plasmodium knowlesi strain H | 45 | OG6_100561 | 0 | 737 | 2214 | 85701 | 9.64 | 0 | NN: MNAGKRFIINKCIFLLFSKISPMFCGAE, HMM: MNAGKRFIINKCIFLLFSKISPM | NN Sum: 3, NN D: .46, HMM Prob: .05 | | | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.24.15 (Thimet oligopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0804500ORpeptidase, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0804500 OR peptidase, putative AND Plasmodium knowlesi strain H |
|
PKNH_0805700 | PKNH_0805700.1 | 8 | 8 | 1 | | | forward | protein coding | No | 645 | PKNH_0805700 | PPPDE peptidase, putative | PPPDE peptidase, putative | 7320542 | B3L3K0 | 8 | PKNH_08_v2:271,029..273,078(+) | PKNH_08_v2:271029..273078(+) | PKNH_08_v2 | Plasmodium knowlesi strain H | 90 | OG6_101256 | 1 | 214 | 645 | 24280 | 8.38 | 0 | | | | | | | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0805700ORPPPDE peptidase, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0805700 OR PPPDE peptidase, putative AND Plasmodium knowlesi strain H |
|
PKNH_0807400 | PKNH_0807400.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 1344 | PKNH_0807400 | 26S protease regulatory subunit 4, putative | 26S protease regulatory subunit 4, putative | 7320563 | B3L3L7 | 8 | PKNH_08_v2:346,743..348,386(-) | PKNH_08_v2:346743..348386(-) | PKNH_08_v2 | Plasmodium knowlesi strain H | 45 | OG6_101477 | 0 | 447 | 1344 | 49817 | 8.04 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | GO:0008540 | proteasome regulatory particle, base subcomplex | | | GO:0070682;GO:0006511 | proteasome regulatory particle assembly;ubiquitin-dependent protein catabolic process | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0807400OR26S protease regulatory subunit 4, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0807400 OR 26S protease regulatory subunit 4, putative AND Plasmodium knowlesi strain H |
|
PKNH_0809200 | PKNH_0809200.1 | 4 | 4 | 1 | | | reverse | protein coding | No | 1080 | PKNH_0809200 | metalloprotease, putative | metalloprotease, putative | 7320461 | B3L3N4 | 8 | PKNH_08_v2:421,787..423,670(-) | PKNH_08_v2:421787..423670(-) | PKNH_08_v2 | Plasmodium knowlesi strain H | 45 | OG6_108834 | 0 | 359 | 1080 | 40718 | 9.76 | 0 | | | | | | | | | | | GO:0008237 | metallopeptidase activity | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0809200ORmetalloprotease, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0809200 OR metalloprotease, putative AND Plasmodium knowlesi strain H |
|
PKNH_0811200 | PKNH_0811200.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 813 | PKNH_0811200 | proteasome subunit beta type-5, putative | proteasome subunit beta type-5, putative | 7320481 | B3L3Q4 | 8 | PKNH_08_v2:494,151..494,963(-) | PKNH_08_v2:494151..494963(-) | PKNH_08_v2 | Plasmodium knowlesi strain H | 44 | OG6_100897 | 0 | 270 | 813 | 30367 | 4.91 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0811200ORproteasome subunit beta type-5, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0811200 OR proteasome subunit beta type-5, putative AND Plasmodium knowlesi strain H |
|
PKNH_0815400 | PKNH_0815400.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1317 | PKNH_0815400 | methionine aminopeptidase 1b, putative | methionine aminopeptidase 1b, putative | 7320227 | B3L3U6 | 8 | PKNH_08_v2:696,502..697,818(+) | PKNH_08_v2:696502..697818(+) | PKNH_08_v2 | Plasmodium knowlesi strain H | 43 | OG6_100342 | 0 | 438 | 1317 | 50445 | 7.89 | 0 | | | | | GO:0004177;GO:0008235 | aminopeptidase activity;metalloexopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0815400ORmethionine aminopeptidase 1b, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0815400 OR methionine aminopeptidase 1b, putative AND Plasmodium knowlesi strain H |
|
PKNH_0819300 | PKNH_0819300.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2661 | PKNH_0819300 | peptidase, putative | peptidase, putative | 7320178 | B3L3Y6 | 8 | PKNH_08_v2:874,625..877,285(+) | PKNH_08_v2:874625..877285(+) | PKNH_08_v2 | Plasmodium knowlesi strain H | 45 | OG6_102438 | 0 | 886 | 2661 | 102941 | 7.19 | 0 | | | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | 3.4.19.1 (Acylaminoacyl-peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0819300ORpeptidase, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0819300 OR peptidase, putative AND Plasmodium knowlesi strain H |
|
PKNH_0820100 | PKNH_0820100.1 | 8 | 8 | 1 | | | reverse | protein coding | No | 561 | PKNH_0820100 | signal peptidase complex subunit 2, putative | signal peptidase complex subunit 2, putative | 7320186 | B3L3Z4 | 8 | PKNH_08_v2:908,075..909,764(-) | PKNH_08_v2:908075..909764(-) | PKNH_08_v2 | Plasmodium knowlesi strain H | 44 | OG6_137524 | 0 | 186 | 561 | 21848 | 9.24 | 2 | | | GO:0016021;GO:0005787 | integral component of membrane;signal peptidase complex | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | GO:0005783;GO:0005787 | endoplasmic reticulum;signal peptidase complex | | | GO:0045047;GO:0006465 | protein targeting to ER;signal peptide processing | | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0820100ORsignal peptidase complex subunit 2, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0820100 OR signal peptidase complex subunit 2, putative AND Plasmodium knowlesi strain H |
|
PKNH_0824000 | PKNH_0824000.1 | 1 | 1 | 1 | | | forward | protein coding | No | 759 | PKNH_0824000 | 26S proteasome non-ATPase regulatory subunit 9, putative | 26S proteasome non-ATPase regulatory subunit 9, putative | 7320417 | B3L433 | 8 | PKNH_08_v2:1,097,198..1,097,956(+) | PKNH_08_v2:1097198..1097956(+) | PKNH_08_v2 | Plasmodium knowlesi strain H | 44 | OG6_102356 | 0 | 252 | 759 | 29032 | 6.54 | 0 | | | | | | | | | GO:0005838 | proteasome regulatory particle | | | GO:0070682 | proteasome regulatory particle assembly | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0824000OR26S proteasome non-ATPase regulatory subunit 9, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0824000 OR 26S proteasome non-ATPase regulatory subunit 9, putative AND Plasmodium knowlesi strain H |
|
PKNH_0824800 | PKNH_0824800.1 | 2 | 2 | 1 | | | forward | protein coding | No | 762 | PKNH_0824800 | proteasome subunit alpha type-3, putative | proteasome subunit alpha type-3, putative | 7320425 | B3L441 | 8 | PKNH_08_v2:1,148,246..1,149,128(+) | PKNH_08_v2:1148246..1149128(+) | PKNH_08_v2 | Plasmodium knowlesi strain H | 44 | OG6_102011 | 0 | 253 | 762 | 29104 | 5.96 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0824800ORproteasome subunit alpha type-3, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0824800 OR proteasome subunit alpha type-3, putative AND Plasmodium knowlesi strain H |
|
PKNH_0827800 | PKNH_0827800.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1230 | PKNH_0827800 | DER1-like protein, putative | DER1-like protein, putative | | | 8 | PKNH_08_v2:1,291,447..1,292,676(+) | PKNH_08_v2:1291447..1292676(+) | PKNH_08_v2 | Plasmodium knowlesi strain H | 87 | OG6_130104 | 1 | 409 | 1230 | 48279 | 10.01 | 3 | HMM: MFFLLRLLVSLCVIIVSVRHEHAR, NN: MFFLLRLLVSLCVIIVSVRHEHAR | NN Sum: 4, NN D: .69, HMM Prob: .81 | | | | | | | GO:0020011 | apicoplast | | | GO:0030433 | ubiquitin-dependent ERAD pathway | | | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0827800ORDER1-like protein, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0827800 OR DER1-like protein, putative AND Plasmodium knowlesi strain H |
|
PKNH_0827900 | PKNH_0827900.1 | 1 | 1 | 1 | | | forward | protein coding | No | 3633 | PKNH_0827900 | conserved Plasmodium protein, unknown function | conserved Plasmodium protein, unknown function | 7320439 | B3L455 | 8 | PKNH_08_v2:1,292,783..1,296,415(+) | PKNH_08_v2:1292783..1296415(+) | PKNH_08_v2 | Plasmodium knowlesi strain H | 42 | OG6_533302 | 0 | 1210 | 3633 | 141993 | 10.04 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0827900ORconserved Plasmodium protein, unknown functionANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0827900 OR conserved Plasmodium protein, unknown function AND Plasmodium knowlesi strain H |
|
PKNH_0830700 | PKNH_0830700.1 | 15 | 15 | 1 | | | reverse | protein coding | No | 1317 | PKNH_0830700 | plasmepsin VI, putative | plasmepsin VI, putative | 7320275 | B3L480 | 8 | PKNH_08_v2:1,393,530..1,396,722(-) | PKNH_08_v2:1393530..1396722(-) | PKNH_08_v2 | Plasmodium knowlesi strain H | 158 | OG6_100536 | 1 | 438 | 1317 | 49221 | 8.26 | 1 | HMM: MGLVFLLAPLFILFVALLPSPFLCL, NN: MGLVFLLAPLFILFVALLPSPFLCL | NN Sum: 4, NN D: .76, HMM Prob: 1 | | | GO:0004190 | aspartic-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.23.- (Aspartic endopeptidases.) | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0830700ORplasmepsin VI, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0830700 OR plasmepsin VI, putative AND Plasmodium knowlesi strain H |
|
PKNH_0835300 | PKNH_0835300.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1119 | PKNH_0835300 | ATP-dependent Clp protease proteolytic subunit, putative | ATP-dependent Clp protease proteolytic subunit, putative | 7320318 | B3L4C3 | 8 | PKNH_08_v2:1,600,688..1,601,806(+) | PKNH_08_v2:1600688..1601806(+) | PKNH_08_v2 | Plasmodium knowlesi strain H | 44 | OG6_100939 | 0 | 372 | 1119 | 41880 | 9.32 | 0 | NN: MVCLFSLLLFTLLRNNRTHAK, HMM: MVCLFSLLLFTLLRNNRTHAK | NN Sum: 4, NN D: .68, HMM Prob: 1 | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0020011 | apicoplast | | | | | 3.4.21.92 (Endopeptidase Clp) | 3.4.21.92 (Endopeptidase Clp) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0835300ORATP-dependent Clp protease proteolytic subunit, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0835300 OR ATP-dependent Clp protease proteolytic subunit, putative AND Plasmodium knowlesi strain H |
|
PKNH_0909600 | PKNH_0909600.1 | 3 | 3 | 1 | | | forward | protein coding | No | 777 | PKNH_0909600 | Josephin domain-containing protein, putative | Josephin domain-containing protein, putative | 7320681 | B3L4S1 | 9 | PKNH_09_v2:432,364..433,898(+) | PKNH_09_v2:432364..433898(+) | PKNH_09_v2 | Plasmodium knowlesi strain H | 43 | OG6_104335 | 0 | 258 | 777 | 30302 | 7.15 | 0 | | | | | GO:0004843 | thiol-dependent ubiquitin-specific protease activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0909600ORJosephin domain-containing protein, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0909600 OR Josephin domain-containing protein, putative AND Plasmodium knowlesi strain H |
|
PKNH_0911700 | PKNH_0911700.1 | 4 | 4 | 1 | | | forward | protein coding | No | 831 | PKNH_0911700 | rhomboid protease ROM1, putative | rhomboid protease ROM1, putative | 7320702 | B3L4U2 | 9 | PKNH_09_v2:517,422..518,906(+) | PKNH_09_v2:517422..518906(+) | PKNH_09_v2 | Plasmodium knowlesi strain H | 93 | OG6_100562 | 1 | 276 | 831 | 31391 | 9.23 | 6 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | | 3.4.21.- (Serine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0911700ORrhomboid protease ROM1, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0911700 OR rhomboid protease ROM1, putative AND Plasmodium knowlesi strain H |
|
PKNH_0912800 | PKNH_0912800.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1434 | PKNH_0912800 | knowpain-4 | knowpain-4 | 7320713 | B3L4V3 | 9 | PKNH_09_v2:561,787..563,220(-) | PKNH_09_v2:561787..563220(-) | PKNH_09_v2 | Plasmodium knowlesi strain H | 157 | OG6_100116 | 3 | 477 | 1434 | 55120 | 5.44 | 1 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | GO:0020020 | food vacuole | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0912800ORknowpain-4ANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0912800 OR knowpain-4 AND Plasmodium knowlesi strain H |
|
PKNH_0912900 | PKNH_0912900.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1488 | PKNH_0912900 | knowpain-3 | knowpain-3 | 7320714 | B3L4V4 | 9 | PKNH_09_v2:566,054..567,541(-) | PKNH_09_v2:566054..567541(-) | PKNH_09_v2 | Plasmodium knowlesi strain H | 157 | OG6_100116 | 3 | 495 | 1488 | 56838 | 7.57 | 1 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | GO:0020020 | food vacuole | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0912900ORknowpain-3ANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0912900 OR knowpain-3 AND Plasmodium knowlesi strain H |
|
PKNH_0913000 | PKNH_0913000.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1440 | PKNH_0913000 | knowpain-2 | knowpain-2 | 7320715 | B3L4V5 | 9 | PKNH_09_v2:569,830..571,269(-) | PKNH_09_v2:569830..571269(-) | PKNH_09_v2 | Plasmodium knowlesi strain H | 157 | OG6_100116 | 3 | 479 | 1440 | 55153 | 6.67 | 1 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | GO:0020020 | food vacuole | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0913000ORknowpain-2ANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0913000 OR knowpain-2 AND Plasmodium knowlesi strain H |
|
PKNH_0913300 | PKNH_0913300.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 1224 | PKNH_0913300 | rhomboid protease ROM9, putative | rhomboid protease ROM9, putative | 7320718 | B3L4V8 | 9 | PKNH_09_v2:577,431..578,876(-) | PKNH_09_v2:577431..578876(-) | PKNH_09_v2 | Plasmodium knowlesi strain H | 35 | OG6_106921 | 0 | 407 | 1224 | 47580 | 10.23 | 6 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0913300ORrhomboid protease ROM9, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0913300 OR rhomboid protease ROM9, putative AND Plasmodium knowlesi strain H |
|
PKNH_0913700 | PKNH_0913700.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 2535 | PKNH_0913700 | rhoptry neck protein 4, putative | rhoptry neck protein 4, putative | 7320723 | B3L4W3 | 9 | PKNH_09_v2:622,319..625,194(-) | PKNH_09_v2:622319..625194(-) | PKNH_09_v2 | Plasmodium knowlesi strain H | 40 | OG6_211592 | 0 | 844 | 2535 | 94176 | 5.23 | 0 | NN: MSRKRVFLLSIFLAISAIVDEAESF, HMM: MSRKRVFLLSIFLAISAIVDEAESF | NN Sum: 4, NN D: .78, HMM Prob: .98 | | | | | | | GO:1990225 | rhoptry neck | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0913700ORrhoptry neck protein 4, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0913700 OR rhoptry neck protein 4, putative AND Plasmodium knowlesi strain H |
|
PKNH_0913800 | PKNH_0913800.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 4551 | PKNH_0913800 | serine esterase, putative | serine esterase, putative | 7320724 | B3L4W4 | 9 | PKNH_09_v2:626,486..631,036(-) | PKNH_09_v2:626486..631036(-) | PKNH_09_v2 | Plasmodium knowlesi strain H | 44 | OG6_154686 | 0 | 1516 | 4551 | 174292 | 9.50 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0913800ORserine esterase, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0913800 OR serine esterase, putative AND Plasmodium knowlesi strain H |
|
PKNH_0913900 | PKNH_0913900.1 | 7 | 7 | 1 | | | reverse | protein coding | No | 660 | PKNH_0913900 | pyridoxine biosynthesis protein PDX2, putative | pyridoxine biosynthesis protein PDX2, putative | 7320725 | B3L4W5 | 9 | PKNH_09_v2:633,586..635,219(-) | PKNH_09_v2:633586..635219(-) | PKNH_09_v2 | Plasmodium knowlesi strain H | 49 | OG6_103407 | 0 | 219 | 660 | 24646 | 8.07 | 0 | | | | | GO:0004359 | glutaminase activity | GO:0042823;GO:0042819 | pyridoxal phosphate biosynthetic process;vitamin B6 biosynthetic process | | | | | | | | 3.5.1.2 (Glutaminase) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0913900ORpyridoxine biosynthesis protein PDX2, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0913900 OR pyridoxine biosynthesis protein PDX2, putative AND Plasmodium knowlesi strain H |
|
PKNH_0914400 | PKNH_0914400.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2055 | PKNH_0914400 | dipeptidyl aminopeptidase 1, putative | dipeptidyl aminopeptidase 1, putative | 7320730 | B3L4X0 | 9 | PKNH_09_v2:648,276..650,330(-) | PKNH_09_v2:648276..650330(-) | PKNH_09_v2 | Plasmodium knowlesi strain H | 90 | OG6_103622 | 1 | 684 | 2055 | 78464 | 6.47 | 0 | HMM: MGRARNILSFGLILLHTLYLNLTTAD, NN: MGRARNILSFGLILLHTLYLNLTTAD | NN Sum: 4, NN D: .77, HMM Prob: .98 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.14.1 (Dipeptidyl-peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0914400ORdipeptidyl aminopeptidase 1, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0914400 OR dipeptidyl aminopeptidase 1, putative AND Plasmodium knowlesi strain H |
|
PKNH_0914500 | PKNH_0914500.1 | 4 | 4 | 1 | | | reverse | protein coding | No | 2721 | PKNH_0914500 | heat shock protein 101, putative | heat shock protein 101, putative | 7320731 | B3L4X1 | 9 | PKNH_09_v2:653,983..657,234(-) | PKNH_09_v2:653983..657234(-) | PKNH_09_v2 | Plasmodium knowlesi strain H | 95 | OG6_100223 | 1 | 906 | 2721 | 102813 | 9.51 | 0 | HMM: MMRRAFIWFIYLISLFFLWKNELASCSAN, NN: MMRRAFIWFIYLISLFFLWKNELASCSAN | NN Sum: 4, NN D: .76, HMM Prob: .83 | | | GO:0005524 | ATP binding | GO:0019538 | protein metabolic process | GO:0020026 | merozoite dense granule | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0914500ORheat shock protein 101, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0914500 OR heat shock protein 101, putative AND Plasmodium knowlesi strain H |
|
PKNH_0914800 | PKNH_0914800.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1356 | PKNH_0914800 | ubiquitin carboxyl-terminal hydrolase UCH54, putative | ubiquitin carboxyl-terminal hydrolase UCH54, putative | 7320734 | B3L4X4 | 9 | PKNH_09_v2:670,385..671,740(+) | PKNH_09_v2:670385..671740(+) | PKNH_09_v2 | Plasmodium knowlesi strain H | 44 | OG6_102753 | 0 | 451 | 1356 | 51516 | 4.96 | 0 | | | GO:0005622 | intracellular | GO:0004843 | thiol-dependent ubiquitin-specific protease activity | GO:0006511 | ubiquitin-dependent protein catabolic process | | | GO:0019784 | NEDD8-specific protease activity | GO:0000338;GO:0016579 | protein deneddylation;protein deubiquitination | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0914800ORubiquitin carboxyl-terminal hydrolase UCH54, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0914800 OR ubiquitin carboxyl-terminal hydrolase UCH54, putative AND Plasmodium knowlesi strain H |
|
PKNH_0916000 | PKNH_0916000.1 | 1 | 1 | 1 | | | forward | protein coding | No | 4041 | PKNH_0916000 | insulinase, putative | insulinase, putative | 7320746 | B3L4Y6 | 9 | PKNH_09_v2:711,348..715,388(+) | PKNH_09_v2:711348..715388(+) | PKNH_09_v2 | Plasmodium knowlesi strain H | 47 | OG6_105738 | 0 | 1346 | 4041 | 153552 | 4.95 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | 3.4.24.56 (Insulysin) | 3.4.24.56 (Insulysin) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0916000ORinsulinase, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0916000 OR insulinase, putative AND Plasmodium knowlesi strain H |
|
PKNH_0917300 | PKNH_0917300.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2859 | PKNH_0917300 | ATP-dependent zinc metalloprotease FTSH, putative | ATP-dependent zinc metalloprotease FTSH, putative | 7320973 | B3L4Z9 | 9 | PKNH_09_v2:754,560..757,418(-) | PKNH_09_v2:754560..757418(-) | PKNH_09_v2 | Plasmodium knowlesi strain H | 91 | OG6_100384 | 1 | 952 | 2859 | 107399 | 9.29 | 2 | | | GO:0016021;GO:0016020 | integral component of membrane;membrane | GO:0005524;GO:0004222;GO:0008270 | ATP binding;metalloendopeptidase activity;zinc ion binding | GO:0006508 | proteolysis | | | | | | | 3.4.24.- (Metalloendopeptidases.) | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0917300ORATP-dependent zinc metalloprotease FTSH, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0917300 OR ATP-dependent zinc metalloprotease FTSH, putative AND Plasmodium knowlesi strain H |
|
PKNH_0918100 | PKNH_0918100.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 1101 | PKNH_0918100 | alpha/beta hydrolase fold domain containing protein, putative | alpha/beta hydrolase fold domain containing protein, putative | 7320981 | B3L507 | 9 | PKNH_09_v2:787,324..788,566(-) | PKNH_09_v2:787324..788566(-) | PKNH_09_v2 | Plasmodium knowlesi strain H | 134 | OG6_100915 | 3 | 366 | 1101 | 42600 | 9.68 | 1 | | | | | | | | | | | | | | | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0918100ORalpha/beta hydrolase fold domain containing protein, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0918100 OR alpha/beta hydrolase fold domain containing protein, putative AND Plasmodium knowlesi strain H |
|
PKNH_0919500 | PKNH_0919500.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 5016 | PKNH_0919500 | peptidase M16, putative | peptidase M16, putative | 7320995 | B3L521 | 9 | PKNH_09_v2:841,922..846,937(-) | PKNH_09_v2:841922..846937(-) | PKNH_09_v2 | Plasmodium knowlesi strain H | 43 | OG6_108964 | 0 | 1671 | 5016 | 192887 | 6.39 | 0 | HMM: MKRIMAITKCSLISILFLLLLFYQESSCS, NN: MKRIMAITKCSLISILFLLLLFYQESSCS | NN Sum: 4, NN D: .81, HMM Prob: .91 | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.55 (Pitrilysin) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0919500ORpeptidase M16, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0919500 OR peptidase M16, putative AND Plasmodium knowlesi strain H |
|
PKNH_0924500 | PKNH_0924500.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1833 | PKNH_0924500 | steryl ester hydrolase, putative | steryl ester hydrolase, putative | 7320903 | B3L571 | 9 | PKNH_09_v2:1,087,898..1,089,730(-) | PKNH_09_v2:1087898..1089730(-) | PKNH_09_v2 | Plasmodium knowlesi strain H | 35 | OG6_100408 | 0 | 610 | 1833 | 69842 | 4.77 | 0 | | | | | | | GO:0006629 | lipid metabolic process | | | | | | | 3.1.1.13 (Sterol esterase) | 3.1.1.3 (Triacylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0924500ORsteryl ester hydrolase, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0924500 OR steryl ester hydrolase, putative AND Plasmodium knowlesi strain H |
|
PKNH_0926800 | PKNH_0926800.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1413 | PKNH_0926800 | GPI-anchor transamidase, putative | GPI-anchor transamidase, putative | 7320928 | B3L596 | 9 | PKNH_09_v2:1,187,396..1,188,808(+) | PKNH_09_v2:1187396..1188808(+) | PKNH_09_v2 | Plasmodium knowlesi strain H | 44 | OG6_101767 | 0 | 470 | 1413 | 55064 | 8.69 | 1 | HMM: MELWKVFVYCVLVAIKHAVAP, NN: MELWKVFVYCVLVAIKHAVAPS | NN Sum: 3, NN D: .62, HMM Prob: .92 | | | GO:0008233 | peptidase activity | GO:0006508 | proteolysis | | | GO:0003923 | GPI-anchor transamidase activity | GO:0016255 | attachment of GPI anchor to protein | | 3.-.-.- (Hydrolases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0926800ORGPI-anchor transamidase, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0926800 OR GPI-anchor transamidase, putative AND Plasmodium knowlesi strain H |
|
PKNH_0928500 | PKNH_0928500.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1323 | PKNH_0928500 | 26S protease regulatory subunit 6A, putative | 26S protease regulatory subunit 6A, putative | 7320942 | B3L5B0 | 9 | PKNH_09_v2:1,240,799..1,242,121(+) | PKNH_09_v2:1240799..1242121(+) | PKNH_09_v2 | Plasmodium knowlesi strain H | 44 | OG6_101915 | 0 | 440 | 1323 | 49568 | 4.80 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | GO:0008540 | proteasome regulatory particle, base subcomplex | | | GO:0070682;GO:0006511 | proteasome regulatory particle assembly;ubiquitin-dependent protein catabolic process | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0928500OR26S protease regulatory subunit 6A, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0928500 OR 26S protease regulatory subunit 6A, putative AND Plasmodium knowlesi strain H |
|
PKNH_0931500 | PKNH_0931500.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1692 | PKNH_0931500 | apical membrane antigen 1 | apical membrane antigen 1 | 7320803 | B3L5E1 | 9 | PKNH_09_v2:1,374,159..1,375,850(+) | PKNH_09_v2:1374159..1375850(+) | PKNH_09_v2 | Plasmodium knowlesi strain H | 44 | OG6_130922 | 0 | 563 | 1692 | 64693 | 6.93 | 1 | | | GO:0016020 | membrane | | | GO:0009405 | pathogenesis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0931500ORapical membrane antigen 1ANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0931500 OR apical membrane antigen 1 AND Plasmodium knowlesi strain H |
|
PKNH_0935100 | PKNH_0935100.1 | 2 | 2 | 1 | | | forward | protein coding | No | 4026 | PKNH_0935100 | subtilisin-like protease 2, putative | subtilisin-like protease 2, putative | 7320840 | B3L5H8 | 9 | PKNH_09_v2:1,559,066..1,563,313(+) | PKNH_09_v2:1559066..1563313(+) | PKNH_09_v2 | Plasmodium knowlesi strain H | 42 | OG6_100121 | 0 | 1341 | 4026 | 153096 | 6.39 | 1 | HMM: MLSLLYVLWLMLMNIFFQY, NN: MLSLLYVLWLMLMNIFFQY | NN Sum: 2, NN D: .61, HMM Prob: .75 | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0020009;GO:0044310 | microneme;osmiophilic body | | | | | | 3.4.21.66 (Thermitase) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0935100ORsubtilisin-like protease 2, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0935100 OR subtilisin-like protease 2, putative AND Plasmodium knowlesi strain H |
|
PKNH_0939500 | PKNH_0939500.1 | 5 | 5 | 1 | | | forward | protein coding | No | 981 | PKNH_0939500 | OTU domain-containing protein, putative | OTU domain-containing protein, putative | 7320886 | B3L5M1 | 9 | PKNH_09_v2:1,788,251..1,790,025(+) | PKNH_09_v2:1788251..1790025(+) | PKNH_09_v2 | Plasmodium knowlesi strain H | 43 | OG6_102788 | 0 | 326 | 981 | 38101 | 5.26 | 0 | | | | | | | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0939500OROTU domain-containing protein, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0939500 OR OTU domain-containing protein, putative AND Plasmodium knowlesi strain H |
|
PKNH_0940900 | PKNH_0940900.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1293 | PKNH_0940900 | alpha/beta hydrolase, putative | alpha/beta hydrolase, putative | 7320577 | B3L5N5 | 9 | PKNH_09_v2:1,858,826..1,860,118(+) | PKNH_09_v2:1858826..1860118(+) | PKNH_09_v2 | Plasmodium knowlesi strain H | 44 | OG6_101420 | 0 | 430 | 1293 | 49043 | 9.53 | 0 | NN: MHLPLGRTIFALLYIVRFCRCF, HMM: MHLPLGRTIFALLYIVRFCRCF | NN Sum: 4, NN D: .79, HMM Prob: .95 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_0940900ORalpha/beta hydrolase, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_0940900 OR alpha/beta hydrolase, putative AND Plasmodium knowlesi strain H |
|
PKNH_1005400 | PKNH_1005400.1 | 3 | 3 | 1 | | | forward | protein coding | No | 972 | PKNH_1005400 | methionine aminopeptidase 1a, putative | methionine aminopeptidase 1a, putative | 7321143 | B3L5Y8 | 10 | PKNH_10_v2:248,219..250,129(+) | PKNH_10_v2:248219..250129(+) | PKNH_10_v2 | Plasmodium knowlesi strain H | 43 | OG6_124490 | 0 | 323 | 972 | 36408 | 7.23 | 0 | | | | | GO:0004177;GO:0008235 | aminopeptidase activity;metalloexopeptidase activity | GO:0006508 | proteolysis | | | GO:0003729;GO:0070006 | mRNA binding;metalloaminopeptidase activity | | | 3.4.11.18 (Methionyl aminopeptidase) | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1005400ORmethionine aminopeptidase 1a, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1005400 OR methionine aminopeptidase 1a, putative AND Plasmodium knowlesi strain H |
|
PKNH_1005500 | PKNH_1005500.1 | 2 | 2 | 1 | | | forward | protein coding | No | 1839 | PKNH_1005500 | ubiquitin carboxyl-terminal hydrolase 14, putative | ubiquitin carboxyl-terminal hydrolase 14, putative | 7321144 | B3L5Y9 | 10 | PKNH_10_v2:251,819..254,220(+) | PKNH_10_v2:251819..254220(+) | PKNH_10_v2 | Plasmodium knowlesi strain H | 44 | OG6_101892 | 0 | 612 | 1839 | 68317 | 5.67 | 0 | | | | | GO:0005515;GO:0036459 | protein binding;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1005500ORubiquitin carboxyl-terminal hydrolase 14, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1005500 OR ubiquitin carboxyl-terminal hydrolase 14, putative AND Plasmodium knowlesi strain H |
|
PKNH_1009800 | PKNH_1009800.1 | 2 | 2 | 1 | | | forward | protein coding | No | 1608 | PKNH_1009800 | mitochondrial-processing peptidase subunit alpha, putative | mitochondrial-processing peptidase subunit alpha, putative | 7321187 | B3L632 | 10 | PKNH_10_v2:434,614..436,494(+) | PKNH_10_v2:434614..436494(+) | PKNH_10_v2 | Plasmodium knowlesi strain H | 44 | OG6_102381 | 0 | 535 | 1608 | 61339 | 9.00 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | GO:0017087;GO:0005739 | mitochondrial processing peptidase complex;mitochondrion | GO:0004222 | metalloendopeptidase activity | GO:0006627 | protein processing involved in protein targeting to mitochondrion | 3.4.24.64 (Mitochondrial processing peptidase) | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1009800ORmitochondrial-processing peptidase subunit alpha, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1009800 OR mitochondrial-processing peptidase subunit alpha, putative AND Plasmodium knowlesi strain H |
|
PKNH_1014900 | PKNH_1014900.1 | 4 | 4 | 1 | | | forward | protein coding | No | 726 | PKNH_1014900 | proteasome subunit beta type-1, putative | proteasome subunit beta type-1, putative | 7321240 | B3L684 | 10 | PKNH_10_v2:691,862..693,261(+) | PKNH_10_v2:691862..693261(+) | PKNH_10_v2 | Plasmodium knowlesi strain H | 44 | OG6_101631 | 0 | 241 | 726 | 27267 | 6.51 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1014900ORproteasome subunit beta type-1, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1014900 OR proteasome subunit beta type-1, putative AND Plasmodium knowlesi strain H |
|
PKNH_1015600 | PKNH_1015600.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2151 | PKNH_1015600 | eukaryotic translation initiation factor 3 subunit B, putative | eukaryotic translation initiation factor 3 subunit B, putative | 7321247 | B3L691 | 10 | PKNH_10_v2:713,328..715,478(-) | PKNH_10_v2:713328..715478(-) | PKNH_10_v2 | Plasmodium knowlesi strain H | 45 | OG6_101924 | 0 | 716 | 2151 | 84214 | 7.98 | 0 | | | GO:0005852 | eukaryotic translation initiation factor 3 complex | GO:0003723;GO:0003676;GO:0003743;GO:0031369 | RNA binding;nucleic acid binding;translation initiation factor activity;translation initiation factor binding | GO:0006413 | translational initiation | | | | | | | | 3.6.3.14 (Transferred entry: 7.1.2.2) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1015600OReukaryotic translation initiation factor 3 subunit B, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1015600 OR eukaryotic translation initiation factor 3 subunit B, putative AND Plasmodium knowlesi strain H |
|
PKNH_1015900 | PKNH_1015900.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 3171 | PKNH_1015900 | FACT complex subunit SPT16, putative | FACT complex subunit SPT16, putative | 7321250 | B3L694 | 10 | PKNH_10_v2:724,238..727,678(-) | PKNH_10_v2:724238..727678(-) | PKNH_10_v2 | Plasmodium knowlesi strain H | 38 | OG6_102309 | 0 | 1056 | 3171 | 122120 | 4.78 | 0 | | | | | | | | | GO:0005634 | nucleus | | | | | | 1.1.1.27 (L-lactate dehydrogenase) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1015900ORFACT complex subunit SPT16, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1015900 OR FACT complex subunit SPT16, putative AND Plasmodium knowlesi strain H |
|
PKNH_1016600 | PKNH_1016600.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 3957 | PKNH_1016600 | ubiquitin carboxyl-terminal hydrolase 2, putative | ubiquitin carboxyl-terminal hydrolase 2, putative | 7321257 | B3L6A1 | 10 | PKNH_10_v2:759,145..763,570(-) | PKNH_10_v2:759145..763570(-) | PKNH_10_v2 | Plasmodium knowlesi strain H | 48 | OG6_101021 | 0 | 1318 | 3957 | 152463 | 6.23 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1016600ORubiquitin carboxyl-terminal hydrolase 2, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1016600 OR ubiquitin carboxyl-terminal hydrolase 2, putative AND Plasmodium knowlesi strain H |
|
PKNH_1026100 | PKNH_1026100.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1917 | PKNH_1026100 | subtilisin-like protease 1, putative | subtilisin-like protease 1, putative | 7321109 | B3L6J4 | 10 | PKNH_10_v2:1,180,625..1,182,541(+) | PKNH_10_v2:1180625..1182541(+) | PKNH_10_v2 | Plasmodium knowlesi strain H | 49 | OG6_121085 | 0 | 638 | 1917 | 71771 | 6.27 | 0 | HMM: MVHTARVALLLFPWVVQLLIHRTFAS, NN: MVHTARVALLLFPWVVQLLIHRTFAS | NN Sum: 4, NN D: .87, HMM Prob: 1 | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0044311;GO:0020003 | exoneme;symbiont-containing vacuole | | | | | 3.4.21.62 (Subtilisin) | 3.4.21.62 (Subtilisin) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1026100ORsubtilisin-like protease 1, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1026100 OR subtilisin-like protease 1, putative AND Plasmodium knowlesi strain H |
|
PKNH_1026300 | PKNH_1026300.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2922 | PKNH_1026300 | subtilisin-like ookinete protein SOPT, putative | subtilisin-like ookinete protein SOPT, putative | 7321111 | B3L6J6 | 10 | PKNH_10_v2:1,185,194..1,188,115(+) | PKNH_10_v2:1185194..1188115(+) | PKNH_10_v2 | Plasmodium knowlesi strain H | 30 | OG6_533144 | 0 | 973 | 2922 | 111605 | 7.51 | 0 | | | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0071944;GO:0009986 | cell periphery;cell surface | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1026300ORsubtilisin-like ookinete protein SOPT, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1026300 OR subtilisin-like ookinete protein SOPT, putative AND Plasmodium knowlesi strain H |
|
PKNH_1026400 | PKNH_1026400.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1791 | PKNH_1026400 | subtilisin-like protease 3, putative | subtilisin-like protease 3, putative | 7321112 | B3L6J7 | 10 | PKNH_10_v2:1,189,828..1,191,618(+) | PKNH_10_v2:1189828..1191618(+) | PKNH_10_v2 | Plasmodium knowlesi strain H | 42 | OG6_532299 | 0 | 596 | 1791 | 66176 | 8.16 | 0 | HMM: MTIRKYHCAFVCLLIFGMVKNMSV, NN: MTIRKYHCAFVCLLIFGMVKNMSV | NN Sum: 2, NN D: .53, HMM Prob: .18 | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0005737 | cytoplasm | | | | | | 3.4.21.62 (Subtilisin) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1026400ORsubtilisin-like protease 3, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1026400 OR subtilisin-like protease 3, putative AND Plasmodium knowlesi strain H |
|
PKNH_1026700 | PKNH_1026700.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1995 | PKNH_1026700 | rhomboid protease ROM4, putative | rhomboid protease ROM4, putative | 7321115 | B3L6K0 | 10 | PKNH_10_v2:1,198,318..1,200,312(+) | PKNH_10_v2:1198318..1200312(+) | PKNH_10_v2 | Plasmodium knowlesi strain H | 44 | OG6_126349 | 0 | 664 | 1995 | 73688 | 9.75 | 7 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | 3.4.21.105 (Rhomboid protease) | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1026700ORrhomboid protease ROM4, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1026700 OR rhomboid protease ROM4, putative AND Plasmodium knowlesi strain H |
|
PKNH_1103100 | PKNH_1103100.1 | 3 | 3 | 1 | | | forward | protein coding | No | 936 | PKNH_1103100 | 26S proteasome regulatory subunit RPN11, putative | 26S proteasome regulatory subunit RPN11, putative | 7321465 | B3L6T8 | 11 | PKNH_11_v2:127,715..128,929(+) | PKNH_11_v2:127715..128929(+) | PKNH_11_v2 | Plasmodium knowlesi strain H | 43 | OG6_101835 | 0 | 311 | 936 | 35038 | 6.88 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1103100OR26S proteasome regulatory subunit RPN11, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1103100 OR 26S proteasome regulatory subunit RPN11, putative AND Plasmodium knowlesi strain H |
|
PKNH_1108900 | PKNH_1108900.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 6033 | PKNH_1108900 | calpain, putative | calpain, putative | 7321771 | B3L6Z7 | 11 | PKNH_11_v2:362,087..368,119(-) | PKNH_11_v2:362087..368119(-) | PKNH_11_v2 | Plasmodium knowlesi strain H | 44 | OG6_103851 | 0 | 2010 | 6033 | 232082 | 9.76 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1108900ORcalpain, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1108900 OR calpain, putative AND Plasmodium knowlesi strain H |
|
PKNH_1109800 | PKNH_1109800.1 | 12 | 12 | 1 | | | forward | protein coding | No | 1101 | PKNH_1109800 | PH domain-containing protein, putative | PH domain-containing protein, putative | 7321780 | B3L706 | 11 | PKNH_11_v2:399,853..402,672(+) | PKNH_11_v2:399853..402672(+) | PKNH_11_v2 | Plasmodium knowlesi strain H | 41 | OG6_129725 | 0 | 366 | 1101 | 43047 | 8.14 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1109800ORPH domain-containing protein, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1109800 OR PH domain-containing protein, putative AND Plasmodium knowlesi strain H |
|
PKNH_1110600 | PKNH_1110600.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3462 | PKNH_1110600 | falcilysin, putative | falcilysin, putative | 7321788 | B3L714 | 11 | PKNH_11_v2:447,441..450,902(-) | PKNH_11_v2:447441..450902(-) | PKNH_11_v2 | Plasmodium knowlesi strain H | 44 | OG6_101809 | 0 | 1153 | 3462 | 133583 | 6.95 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | GO:0006508 | proteolysis | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1110600ORfalcilysin, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1110600 OR falcilysin, putative AND Plasmodium knowlesi strain H |
|
PKNH_1111400 | PKNH_1111400.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 5742 | PKNH_1111400 | conserved Plasmodium protein, unknown function | conserved Plasmodium protein, unknown function | 7321797 | B3L723 | 11 | PKNH_11_v2:487,370..493,111(-) | PKNH_11_v2:487370..493111(-) | PKNH_11_v2 | Plasmodium knowlesi strain H | 46 | OG6_156430 | 0 | 1913 | 5742 | 220654 | 9.83 | 4 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1111400ORconserved Plasmodium protein, unknown functionANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1111400 OR conserved Plasmodium protein, unknown function AND Plasmodium knowlesi strain H |
|
PKNH_1113200 | PKNH_1113200.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1008 | PKNH_1113200 | rhomboid protease ROM7, putative | rhomboid protease ROM7, putative | 7321810 | B3L741 | 11 | PKNH_11_v2:613,048..614,055(+) | PKNH_11_v2:613048..614055(+) | PKNH_11_v2 | Plasmodium knowlesi strain H | 44 | OG6_533468 | 0 | 335 | 1008 | 39650 | 10.07 | 5 | NN: MNLLILLAIATCLTIGNAF, HMM: MNLLILLAIATCLTIGNAF | NN Sum: 4, NN D: .88, HMM Prob: 1 | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | GO:0020011 | apicoplast | | | | | 3.4.21.105 (Rhomboid protease) | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1113200ORrhomboid protease ROM7, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1113200 OR rhomboid protease ROM7, putative AND Plasmodium knowlesi strain H |
|
PKNH_1115200 | PKNH_1115200.1 | 7 | 7 | 1 | | | reverse | protein coding | No | 609 | PKNH_1115200 | ubiquitin-conjugating enzyme E2, putative | ubiquitin-conjugating enzyme E2, putative | 7321828 | B3L761 | 11 | PKNH_11_v2:694,893..696,747(-) | PKNH_11_v2:694893..696747(-) | PKNH_11_v2 | Plasmodium knowlesi strain H | 44 | OG6_103192 | 0 | 202 | 609 | 22833 | 4.70 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 6.3.2.19 (Transferred entry: 2.3.2.23, 2.3.2.27 and 6.2.1.45) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1115200ORubiquitin-conjugating enzyme E2, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1115200 OR ubiquitin-conjugating enzyme E2, putative AND Plasmodium knowlesi strain H |
|
PKNH_1117000 | PKNH_1117000.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1929 | PKNH_1117000 | metacaspase-1, putative | metacaspase-1, putative | 7321845 | B3L778 | 11 | PKNH_11_v2:794,549..796,477(+) | PKNH_11_v2:794549..796477(+) | PKNH_11_v2 | Plasmodium knowlesi strain H | 83 | OG6_101407 | 1 | 642 | 1929 | 73477 | 8.16 | 0 | | | | | | | | | | | GO:0008233 | peptidase activity | GO:0006915;GO:0006508 | apoptotic process;proteolysis | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1117000ORmetacaspase-1, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1117000 OR metacaspase-1, putative AND Plasmodium knowlesi strain H |
|
PKNH_1117800 | PKNH_1117800.1 | 4 | 4 | 1 | | | reverse | protein coding | No | 726 | PKNH_1117800 | proteasome subunit alpha type-7, putative | proteasome subunit alpha type-7, putative | 7321853 | B3L786 | 11 | PKNH_11_v2:820,854..822,164(-) | PKNH_11_v2:820854..822164(-) | PKNH_11_v2 | Plasmodium knowlesi strain H | 45 | OG6_101207 | 0 | 241 | 726 | 27190 | 7.87 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1117800ORproteasome subunit alpha type-7, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1117800 OR proteasome subunit alpha type-7, putative AND Plasmodium knowlesi strain H |
|
PKNH_1117900 | PKNH_1117900.1 | 2 | 2 | 1 | | | forward | protein coding | No | 741 | PKNH_1117900 | proteasome subunit alpha type-4, putative | proteasome subunit alpha type-4, putative | 7321854 | B3L787 | 11 | PKNH_11_v2:824,114..825,001(+) | PKNH_11_v2:824114..825001(+) | PKNH_11_v2 | Plasmodium knowlesi strain H | 45 | OG6_101968 | 0 | 246 | 741 | 27782 | 6.55 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1117900ORproteasome subunit alpha type-4, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1117900 OR proteasome subunit alpha type-4, putative AND Plasmodium knowlesi strain H |
|
PKNH_1120200 | PKNH_1120200.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2274 | PKNH_1120200 | phospholipase, putative | phospholipase, putative | 7321494 | B3L7B0 | 11 | PKNH_11_v2:936,052..938,325(-) | PKNH_11_v2:936052..938325(-) | PKNH_11_v2 | Plasmodium knowlesi strain H | 44 | OG6_101376 | 0 | 757 | 2274 | 85474 | 4.93 | 1 | NN: MSTLFLLIALWHFLMPTSVVLGF, HMM: MSTLFLLIALWHFLMPTSVVLGF | NN Sum: 4, NN D: .82, HMM Prob: 1 | | | GO:0008374 | O-acyltransferase activity | GO:0006629 | lipid metabolic process | | | | | | | 2.3.1.43 (Phosphatidylcholine--sterol O-acyltransferase) | 2.3.1.43 (Phosphatidylcholine--sterol O-acyltransferase) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1120200ORphospholipase, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1120200 OR phospholipase, putative AND Plasmodium knowlesi strain H |
|
PKNH_1121400 | PKNH_1121400.1 | 8 | 8 | 1 | | | reverse | protein coding | No | 1062 | PKNH_1121400 | protease, putative | protease, putative | 7321507 | B3L7C3 | 11 | PKNH_11_v2:1,021,521..1,023,877(-) | PKNH_11_v2:1021521..1023877(-) | PKNH_11_v2 | Plasmodium knowlesi strain H | 44 | OG6_168022 | 0 | 353 | 1062 | 40256 | 6.88 | 8 | | | | | GO:0008233 | peptidase activity | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1121400ORprotease, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1121400 OR protease, putative AND Plasmodium knowlesi strain H |
|
PKNH_1122300 | PKNH_1122300.1 | 3 | 3 | 1 | | | forward | protein coding | No | 570 | PKNH_1122300 | protein DJ-1, putative | protein DJ-1, putative | 7321516 | B3L7D2 | 11 | PKNH_11_v2:1,094,434..1,095,457(+) | PKNH_11_v2:1094434..1095457(+) | PKNH_11_v2 | Plasmodium knowlesi strain H | 44 | OG6_101257 | 0 | 189 | 570 | 20240 | 6.91 | 0 | | | | | | | | | GO:0005829 | cytosol | GO:0008233;GO:0036524 | peptidase activity;protein deglycase activity | GO:0036525;GO:0006457 | protein deglycation;protein folding | | 2.7.1.50 (Hydroxyethylthiazole kinase) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1122300ORprotein DJ-1, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1122300 OR protein DJ-1, putative AND Plasmodium knowlesi strain H |
|
PKNH_1122500 | PKNH_1122500.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1542 | PKNH_1122500 | E3 ubiquitin-protein ligase RNF5, putative | E3 ubiquitin-protein ligase RNF5, putative | 7321518 | B3L7D4 | 11 | PKNH_11_v2:1,099,885..1,101,426(+) | PKNH_11_v2:1099885..1101426(+) | PKNH_11_v2 | Plasmodium knowlesi strain H | 44 | OG6_102074 | 0 | 513 | 1542 | 58183 | 4.76 | 1 | | | | | | | | | | | | | | | 6.3.2.19 (Transferred entry: 2.3.2.23, 2.3.2.27 and 6.2.1.45) | 6.3.2.19 (Transferred entry: 2.3.2.23, 2.3.2.27 and 6.2.1.45) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1122500ORE3 ubiquitin-protein ligase RNF5, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1122500 OR E3 ubiquitin-protein ligase RNF5, putative AND Plasmodium knowlesi strain H |
|
PKNH_1131800 | PKNH_1131800.1 | 8 | 8 | 1 | | | forward | protein coding | No | 825 | PKNH_1131800 | rhomboid protease ROM10, putative | rhomboid protease ROM10, putative | 7321406 | B3L7M2 | 11 | PKNH_11_v2:1,483,502..1,485,395(+) | PKNH_11_v2:1483502..1485395(+) | PKNH_11_v2 | Plasmodium knowlesi strain H | 44 | OG6_103838 | 0 | 274 | 825 | 30853 | 9.66 | 6 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1131800ORrhomboid protease ROM10, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1131800 OR rhomboid protease ROM10, putative AND Plasmodium knowlesi strain H |
|
PKNH_1141700 | PKNH_1141700.1 | 2 | 2 | 1 | | | forward | protein coding | No | 708 | PKNH_1141700 | proteasome subunit alpha type-2, putative | proteasome subunit alpha type-2, putative | 7321628 | B3L7X1 | 11 | PKNH_11_v2:1,959,550..1,960,464(+) | PKNH_11_v2:1959550..1960464(+) | PKNH_11_v2 | Plasmodium knowlesi strain H | 43 | OG6_101969 | 0 | 235 | 708 | 26353 | 5.00 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1141700ORproteasome subunit alpha type-2, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1141700 OR proteasome subunit alpha type-2, putative AND Plasmodium knowlesi strain H |
|
PKNH_1146900 | PKNH_1146900.1 | 19 | 19 | 1 | | | forward | protein coding | No | 5619 | PKNH_1146900 | centrosomal protein CEP76, putative | centrosomal protein CEP76, putative | 7321684 | B3L825 | 11 | PKNH_11_v2:2,197,904..2,207,321(+) | PKNH_11_v2:2197904..2207321(+) | PKNH_11_v2 | Plasmodium knowlesi strain H | 46 | OG6_126374 | 0 | 1872 | 5619 | 218961 | 6.66 | 1 | | | | | | | | | | | | | | | | 1.3.-.- (Acting on the CH-CH group of donors.) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1146900ORcentrosomal protein CEP76, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1146900 OR centrosomal protein CEP76, putative AND Plasmodium knowlesi strain H |
|
PKNH_1200500 | PKNH_1200500.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 813 | PKNH_1200500 | proteasome subunit beta type-7, putative | proteasome subunit beta type-7, putative | 7322515 | B3L8V3 | 12 | PKNH_12_v2:48,047..48,859(-) | PKNH_12_v2:48047..48859(-) | PKNH_12_v2 | Plasmodium knowlesi strain H | 43 | OG6_101382 | 0 | 270 | 813 | 29594 | 7.87 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1200500ORproteasome subunit beta type-7, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1200500 OR proteasome subunit beta type-7, putative AND Plasmodium knowlesi strain H |
|
PKNH_1205300 | PKNH_1205300.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1602 | PKNH_1205300 | plasmepsin V, putative | plasmepsin V, putative | 7322562 | B3L900 | 12 | PKNH_12_v2:256,721..258,322(-) | PKNH_12_v2:256721..258322(-) | PKNH_12_v2 | Plasmodium knowlesi strain H | 44 | OG6_107443 | 0 | 533 | 1602 | 61428 | 7.42 | 1 | HMM: MGVISFGNRVCGSLSRMIFSVICILILCTLNTNCKSE, NN: MGVISFGNRVCGSLSRMIFSVICILILCTLNTNCKSE | NN Sum: 4, NN D: .59, HMM Prob: .28 | | | GO:0004190 | aspartic-type endopeptidase activity | GO:0006508 | proteolysis | GO:0005783 | endoplasmic reticulum | | | | | 3.4.23.- (Aspartic endopeptidases.) | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1205300ORplasmepsin V, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1205300 OR plasmepsin V, putative AND Plasmodium knowlesi strain H |
|
PKNH_1208600 | PKNH_1208600.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 3246 | PKNH_1208600 | M1-family alanyl aminopeptidase, putative | M1-family alanyl aminopeptidase, putative | 7322137 | B3L933 | 12 | PKNH_12_v2:381,769..385,333(-) | PKNH_12_v2:381769..385333(-) | PKNH_12_v2 | Plasmodium knowlesi strain H | 37 | OG6_532703 | 0 | 1081 | 3246 | 128314 | 10.48 | 0 | | | | | GO:0008237;GO:0008270 | metallopeptidase activity;zinc ion binding | | | | | | | | | | 3.4.11.2 (Membrane alanyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1208600ORM1-family alanyl aminopeptidase, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1208600 OR M1-family alanyl aminopeptidase, putative AND Plasmodium knowlesi strain H |
|
PKNH_1209100 | PKNH_1209100.1 | 2 | 2 | 1 | | | forward | protein coding | No | 5901 | PKNH_1209100 | conserved Plasmodium protein, unknown function | conserved Plasmodium protein, unknown function | 7,32,21,42,73,22,143 | B3L938,B3L939 | 12 | PKNH_12_v2:399,909..406,158(+) | PKNH_12_v2:399909..406158(+) | PKNH_12_v2 | Plasmodium knowlesi strain H | 32 | OG6_532336 | 0 | 1966 | 5901 | 227959 | 8.60 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1209100ORconserved Plasmodium protein, unknown functionANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1209100 OR conserved Plasmodium protein, unknown function AND Plasmodium knowlesi strain H |
|
PKNH_1210100 | PKNH_1210100.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 588 | PKNH_1210100 | proteasome subunit beta type-2, putative | proteasome subunit beta type-2, putative | 7322280 | B3L948 | 12 | PKNH_12_v2:442,895..443,833(-) | PKNH_12_v2:442895..443833(-) | PKNH_12_v2 | Plasmodium knowlesi strain H | 44 | OG6_102061 | 0 | 195 | 588 | 22718 | 8.53 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1210100ORproteasome subunit beta type-2, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1210100 OR proteasome subunit beta type-2, putative AND Plasmodium knowlesi strain H |
|
PKNH_1211400 | PKNH_1211400.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 8766 | PKNH_1211400 | acetyl-CoA carboxylase, putative | acetyl-CoA carboxylase, putative | 7322292 | B3L960 | 12 | PKNH_12_v2:478,273..487,298(-) | PKNH_12_v2:478273..487298(-) | PKNH_12_v2 | Plasmodium knowlesi strain H | 41 | OG6_101052 | 0 | 2921 | 8766 | 332420 | 7.41 | 0 | NN: MVNGLTGAFSLVLLFQNFVEPI, HMM: MVNGLTGAFSLVLLFQNFVEPI | NN Sum: 3, NN D: .6, HMM Prob: .72 | | | GO:0005524;GO:0016874;GO:0046872 | ATP binding;ligase activity;metal ion binding | | | GO:0020011 | apicoplast | | | | | 6.4.1.2 (Acetyl-CoA carboxylase) | 6.4.1.2 (Acetyl-CoA carboxylase) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1211400ORacetyl-CoA carboxylase, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1211400 OR acetyl-CoA carboxylase, putative AND Plasmodium knowlesi strain H |
|
PKNH_1212700 | PKNH_1212700.1 | 6 | 6 | 1 | | | forward | protein coding | No | 642 | PKNH_1212700 | derlin-1, putative | derlin-1, putative | 7322305 | B3L973 | 12 | PKNH_12_v2:544,176..545,798(+) | PKNH_12_v2:544176..545798(+) | PKNH_12_v2 | Plasmodium knowlesi strain H | 44 | OG6_101672 | 0 | 213 | 642 | 24927 | 7.33 | 5 | HMM: MVQLGELLGTIPLITRLYLILSSILMVLCSLD, NN: MVQLGELLGTIPLITRLYLILSSILMVLCS | NN Sum: 3, NN D: .61, HMM Prob: .28 | | | | | | | GO:0005783;GO:0005789 | endoplasmic reticulum;endoplasmic reticulum membrane | | | GO:0030970;GO:0030433 | retrograde protein transport, ER to cytosol;ubiquitin-dependent ERAD pathway | | | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1212700ORderlin-1, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1212700 OR derlin-1, putative AND Plasmodium knowlesi strain H |
|
PKNH_1215800 | PKNH_1215800.1 | 13 | 13 | 1 | | | forward | protein coding | No | 1122 | PKNH_1215800 | plasmepsin VIII, putative | plasmepsin VIII, putative | 7322335 | B3L9A3 | 12 | PKNH_12_v2:708,371..711,151(+) | PKNH_12_v2:708371..711151(+) | PKNH_12_v2 | Plasmodium knowlesi strain H | 44 | OG6_124673 | 0 | 373 | 1122 | 42735 | 9.66 | 0 | HMM: MNFLLSIFVFIIFNIHPWVKSA, NN: MNFLLSIFVFIIFNIHPWVKSA | NN Sum: 4, NN D: .71, HMM Prob: .89 | | | GO:0004190 | aspartic-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.17.4 (Gly-Xaa carboxypeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1215800ORplasmepsin VIII, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1215800 OR plasmepsin VIII, putative AND Plasmodium knowlesi strain H |
|
PKNH_1216600 | PKNH_1216600.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2109 | PKNH_1216600 | ATP-dependent zinc metalloprotease FTSH, putative | ATP-dependent zinc metalloprotease FTSH, putative | 7322270 | B3L9B1 | 12 | PKNH_12_v2:740,516..742,624(+) | PKNH_12_v2:740516..742624(+) | PKNH_12_v2 | Plasmodium knowlesi strain H | 44 | OG6_101196 | 0 | 702 | 2109 | 79160 | 9.49 | 0 | | | GO:0016020 | membrane | GO:0005524;GO:0004222 | ATP binding;metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.24.- (Metalloendopeptidases.) | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1216600ORATP-dependent zinc metalloprotease FTSH, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1216600 OR ATP-dependent zinc metalloprotease FTSH, putative AND Plasmodium knowlesi strain H |
|
PKNH_1221300 | PKNH_1221300.1 | 9 | 9 | 1 | | | reverse | protein coding | No | 687 | PKNH_1221300 | ubiquitin carboxyl-terminal hydrolase isozyme L3, putative | ubiquitin carboxyl-terminal hydrolase isozyme L3, putative | 7322035 | B3L9G0 | 12 | PKNH_12_v2:971,024..972,940(-) | PKNH_12_v2:971024..972940(-) | PKNH_12_v2 | Plasmodium knowlesi strain H | 44 | OG6_101218 | 0 | 228 | 687 | 25845 | 4.87 | 0 | | | GO:0005622 | intracellular | GO:0004843 | thiol-dependent ubiquitin-specific protease activity | GO:0006511 | ubiquitin-dependent protein catabolic process | | | GO:0019784 | NEDD8-specific protease activity | GO:0000338 | protein deneddylation | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1221300ORubiquitin carboxyl-terminal hydrolase isozyme L3, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1221300 OR ubiquitin carboxyl-terminal hydrolase isozyme L3, putative AND Plasmodium knowlesi strain H |
|
PKNH_1223800 | PKNH_1223800.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1737 | PKNH_1223800 | knowpain-1 | knowpain-1 | 7321987 | B3L9I5 | 12 | PKNH_12_v2:1,047,824..1,049,560(-) | PKNH_12_v2:1047824..1049560(-) | PKNH_12_v2 | Plasmodium knowlesi strain H | 157 | OG6_100116 | 3 | 578 | 1737 | 65775 | 6.52 | 1 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1223800ORknowpain-1ANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1223800 OR knowpain-1 AND Plasmodium knowlesi strain H |
|
PKNH_1224800 | PKNH_1224800.1 | 9 | 9 | 1 | | | forward | protein coding | No | 1242 | PKNH_1224800 | signal peptide peptidase, putative | signal peptide peptidase, putative | 7322343 | B3L9J5 | 12 | PKNH_12_v2:1,100,490..1,103,290(+) | PKNH_12_v2:1100490..1103290(+) | PKNH_12_v2 | Plasmodium knowlesi strain H | 44 | OG6_102328 | 0 | 413 | 1242 | 47425 | 9.25 | 8 | | | GO:0016021 | integral component of membrane | GO:0004190 | aspartic-type endopeptidase activity | | | | | | | | | 3.4.21.89 (Signal peptidase I) | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1224800ORsignal peptide peptidase, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1224800 OR signal peptide peptidase, putative AND Plasmodium knowlesi strain H |
|
PKNH_1227700 | PKNH_1227700.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2415 | PKNH_1227700 | aminopeptidase P, putative | aminopeptidase P, putative | 7322373 | B3L9M5 | 12 | PKNH_12_v2:1,236,010..1,238,424(-) | PKNH_12_v2:1236010..1238424(-) | PKNH_12_v2 | Plasmodium knowlesi strain H | 44 | OG6_100896 | 0 | 804 | 2415 | 92507 | 6.41 | 1 | | | | | GO:0016787 | hydrolase activity | | | GO:0005829;GO:0020020 | cytosol;food vacuole | GO:0070006;GO:0042803 | metalloaminopeptidase activity;protein homodimerization activity | | | 3.4.11.9 (Xaa-Pro aminopeptidase) | 3.4.11.9 (Xaa-Pro aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1227700ORaminopeptidase P, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1227700 OR aminopeptidase P, putative AND Plasmodium knowlesi strain H |
|
PKNH_1229800 | PKNH_1229800.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1068 | PKNH_1229800 | DER1-like protein, putative | DER1-like protein, putative | 7322392 | B3L9P4 | 12 | PKNH_12_v2:1,327,939..1,329,006(+) | PKNH_12_v2:1327939..1329006(+) | PKNH_12_v2 | Plasmodium knowlesi strain H | 44 | OG6_160757 | 0 | 355 | 1068 | 41945 | 10.31 | 5 | HMM: MNIVLCLFWILIYIADDGSKGN, NN: MNIVLCLFWILIYIADDGSKGN | NN Sum: 3, NN D: .51, HMM Prob: .88 | | | | | | | GO:0020011 | apicoplast | | | GO:0030433 | ubiquitin-dependent ERAD pathway | | | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1229800ORDER1-like protein, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1229800 OR DER1-like protein, putative AND Plasmodium knowlesi strain H |
|
PKNH_1236000 | PKNH_1236000.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1830 | PKNH_1236000 | M17 leucyl aminopeptidase, putative | M17 leucyl aminopeptidase, putative | 7321946 | B3L9V6 | 12 | PKNH_12_v2:1,588,750..1,590,579(+) | PKNH_12_v2:1588750..1590579(+) | PKNH_12_v2 | Plasmodium knowlesi strain H | 47 | OG6_100682 | 0 | 609 | 1830 | 67966 | 8.94 | 0 | | | GO:0005737;GO:0005622 | cytoplasm;intracellular | GO:0004177;GO:0030145;GO:0008235 | aminopeptidase activity;manganese ion binding;metalloexopeptidase activity | GO:0019538;GO:0006508 | protein metabolic process;proteolysis | | | | | | | 3.4.11.1 (Leucyl aminopeptidase) | 3.4.11.1 (Leucyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1236000ORM17 leucyl aminopeptidase, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1236000 OR M17 leucyl aminopeptidase, putative AND Plasmodium knowlesi strain H |
|
PKNH_1240600 | PKNH_1240600.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1470 | PKNH_1240600 | mitochondrial inner membrane protease ATP23, putative | mitochondrial inner membrane protease ATP23, putative | 7322059 | B3LA00 | 12 | PKNH_12_v2:1,793,360..1,794,829(-) | PKNH_12_v2:1793360..1794829(-) | PKNH_12_v2 | Plasmodium knowlesi strain H | 44 | OG6_102968 | 0 | 489 | 1470 | 56905 | 9.19 | 0 | | | | | GO:0004222 | metalloendopeptidase activity | | | GO:0005758 | mitochondrial intermembrane space | | | GO:0034982;GO:0033615 | mitochondrial protein processing;mitochondrial proton-transporting ATP synthase complex assembly | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1240600ORmitochondrial inner membrane protease ATP23, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1240600 OR mitochondrial inner membrane protease ATP23, putative AND Plasmodium knowlesi strain H |
|
PKNH_1242000 | PKNH_1242000.1 | 6 | 6 | 1 | | | reverse | protein coding | No | 4419 | PKNH_1242000 | stromal-processing peptidase, putative | stromal-processing peptidase, putative | 7322073 | B3LA14 | 12 | PKNH_12_v2:1,856,782..1,864,759(-) | PKNH_12_v2:1856782..1864759(-) | PKNH_12_v2 | Plasmodium knowlesi strain H | 43 | OG6_110270 | 0 | 1472 | 4419 | 172257 | 7.15 | 0 | HMM: MIKIDGIILLYLSVLNLVCCL, NN: MIKIDGIILLYLSVLNLVCCL | NN Sum: 4, NN D: .79, HMM Prob: .82 | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | GO:0020011 | apicoplast | | | | | | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1242000ORstromal-processing peptidase, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1242000 OR stromal-processing peptidase, putative AND Plasmodium knowlesi strain H |
|
PKNH_1244000 | PKNH_1244000.1 | 7 | 7 | 1 | | | reverse | protein coding | No | 5586 | PKNH_1244000 | metacaspase-2, putative | metacaspase-2, putative | 7322093 | B3LA34 | 12 | PKNH_12_v2:1,958,233..1,965,839(-) | PKNH_12_v2:1958233..1965839(-) | PKNH_12_v2 | Plasmodium knowlesi strain H | 83 | OG6_101407 | 1 | 1861 | 5586 | 212729 | 9.70 | 0 | | | | | | | | | GO:0005737 | cytoplasm | GO:0008234 | cysteine-type peptidase activity | GO:0006915 | apoptotic process | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1244000ORmetacaspase-2, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1244000 OR metacaspase-2, putative AND Plasmodium knowlesi strain H |
|
PKNH_1245100 | PKNH_1245100.1 | 3 | 3 | 1 | | | forward | protein coding | No | 810 | PKNH_1245100 | proteasome subunit alpha type-1, putative | proteasome subunit alpha type-1, putative | 7322102 | B3LA43 | 12 | PKNH_12_v2:2,019,491..2,020,741(+) | PKNH_12_v2:2019491..2020741(+) | PKNH_12_v2 | Plasmodium knowlesi strain H | 44 | OG6_102143 | 0 | 269 | 810 | 30369 | 6.26 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1245100ORproteasome subunit alpha type-1, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1245100 OR proteasome subunit alpha type-1, putative AND Plasmodium knowlesi strain H |
|
PKNH_1251200 | PKNH_1251200.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 732 | PKNH_1251200 | peptidase, putative | peptidase, putative | 7322186 | B3L896 | 12 | PKNH_12_v2:2,298,632..2,299,654(-) | PKNH_12_v2:2298632..2299654(-) | PKNH_12_v2 | Plasmodium knowlesi strain H | 44 | OG6_110253 | 0 | 243 | 732 | 27890 | 7.32 | 6 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1251200ORpeptidase, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1251200 OR peptidase, putative AND Plasmodium knowlesi strain H |
|
PKNH_1256100 | PKNH_1256100.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1710 | PKNH_1256100 | rhomboid protease ROM6, putative | rhomboid protease ROM6, putative | 7322240 | B3L8E6 | 12 | PKNH_12_v2:2,528,660..2,530,369(+) | PKNH_12_v2:2528660..2530369(+) | PKNH_12_v2 | Plasmodium knowlesi strain H | 44 | OG6_124366 | 0 | 569 | 1710 | 66461 | 10.27 | 5 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | 3.4.21.105 (Rhomboid protease) | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1256100ORrhomboid protease ROM6, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1256100 OR rhomboid protease ROM6, putative AND Plasmodium knowlesi strain H |
|
PKNH_1262900 | PKNH_1262900.1 | 8 | 8 | 1 | | | forward | protein coding | No | 1386 | PKNH_1262900 | SprT-like domain-containing protein, putative | SprT-like domain-containing protein, putative | 7322456 | B3L8K8 | 12 | PKNH_12_v2:2,814,702..2,817,255(+) | PKNH_12_v2:2814702..2817255(+) | PKNH_12_v2 | Plasmodium knowlesi strain H | 45 | OG6_104384 | 0 | 461 | 1386 | 53616 | 8.71 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1262900ORSprT-like domain-containing protein, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1262900 OR SprT-like domain-containing protein, putative AND Plasmodium knowlesi strain H |
|
PKNH_1264300 | PKNH_1264300.1 | 2 | 2 | 1 | | | forward | protein coding | No | 2940 | PKNH_1264300 | mitochondrial intermediate peptidase, putative | mitochondrial intermediate peptidase, putative | 7322469 | B3L8M1 | 12 | PKNH_12_v2:2,870,119..2,873,202(+) | PKNH_12_v2:2870119..2873202(+) | PKNH_12_v2 | Plasmodium knowlesi strain H | 44 | OG6_102110 | 0 | 979 | 2940 | 113706 | 7.61 | 0 | | | | | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | GO:0005739 | mitochondrion | | | | | 3.4.24.- (Metalloendopeptidases.);3.4.24.59 (Mitochondrial intermediate peptidase) | 3.4.24.59 (Mitochondrial intermediate peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1264300ORmitochondrial intermediate peptidase, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1264300 OR mitochondrial intermediate peptidase, putative AND Plasmodium knowlesi strain H |
|
PKNH_1269200 | PKNH_1269200.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 555 | PKNH_1269200 | signal peptidase complex catalytic subunit SEC11, putative | signal peptidase complex catalytic subunit SEC11, putative | 7321883 | B3L8R9 | 12 | PKNH_12_v2:3,017,105..3,017,894(-) | PKNH_12_v2:3017105..3017894(-) | PKNH_12_v2 | Plasmodium knowlesi strain H | 44 | OG6_100807 | 0 | 184 | 555 | 21064 | 6.14 | 3 | | | GO:0016021;GO:0016020 | integral component of membrane;membrane | GO:0008233;GO:0008236 | peptidase activity;serine-type peptidase activity | GO:0006465 | signal peptide processing | GO:0005783;GO:0005787 | endoplasmic reticulum;signal peptidase complex | | | | | 3.4.21.89 (Signal peptidase I) | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1269200ORsignal peptidase complex catalytic subunit SEC11, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1269200 OR signal peptidase complex catalytic subunit SEC11, putative AND Plasmodium knowlesi strain H |
|
PKNH_1271900 | PKNH_1271900.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2748 | PKNH_1271900 | alpha/beta-hydrolase, putative | alpha/beta-hydrolase, putative | 7322507 | B3L8U5 | 12 | PKNH_12_v2:3,120,615..3,123,362(+) | PKNH_12_v2:3120615..3123362(+) | PKNH_12_v2 | Plasmodium knowlesi strain H | 120 | OG6_157547 | 0 | 915 | 2748 | 102811 | 7.33 | 0 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1271900ORalpha/beta-hydrolase, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1271900 OR alpha/beta-hydrolase, putative AND Plasmodium knowlesi strain H |
|
PKNH_1301100 | PKNH_1301100.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1152 | PKNH_1301100 | lysophospholipase, putative | lysophospholipase, putative | | | 13 | PKNH_13_v2:57,987..59,138(-) | PKNH_13_v2:57987..59138(-) | PKNH_13_v2 | Plasmodium knowlesi strain H | 455 | OG6_100231 | 6 | 383 | 1152 | 44931 | 9.83 | 0 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1301100ORlysophospholipase, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1301100 OR lysophospholipase, putative AND Plasmodium knowlesi strain H |
|
PKNH_1302000 | PKNH_1302000.1 | 7 | 7 | 1 | | | forward | protein coding | No | 1035 | PKNH_1302000 | SRAP domain-containing protein, putative | SRAP domain-containing protein, putative | 7322768 | B3LB09 | 13 | PKNH_13_v2:86,915..89,147(+) | PKNH_13_v2:86915..89147(+) | PKNH_13_v2 | Plasmodium knowlesi strain H | 42 | OG6_102318 | 0 | 344 | 1035 | 40423 | 6.37 | 0 | | | | | | | | | | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1302000ORSRAP domain-containing protein, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1302000 OR SRAP domain-containing protein, putative AND Plasmodium knowlesi strain H |
|
PKNH_1305600 | PKNH_1305600.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3504 | PKNH_1305600 | conserved protein, unknown function | conserved protein, unknown function | 7322803 | B3LB44 | 13 | PKNH_13_v2:250,067..253,570(-) | PKNH_13_v2:250067..253570(-) | PKNH_13_v2 | Plasmodium knowlesi strain H | 43 | OG6_102131 | 0 | 1167 | 3504 | 130828 | 5.67 | 4 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1305600ORconserved protein, unknown functionANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1305600 OR conserved protein, unknown function AND Plasmodium knowlesi strain H |
|
PKNH_1317400 | PKNH_1317400.1 | 5 | 5 | 1 | | | forward | protein coding | No | 1566 | PKNH_1317400 | alpha/beta hydrolase, putative | alpha/beta hydrolase, putative | 7319477 | B3L157 | 13 | PKNH_13_v2:785,939..788,293(+) | PKNH_13_v2:785939..788293(+) | PKNH_13_v2 | Plasmodium knowlesi strain H | 44 | OG6_105308 | 0 | 521 | 1566 | 60440 | 7.98 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1317400ORalpha/beta hydrolase, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1317400 OR alpha/beta hydrolase, putative AND Plasmodium knowlesi strain H |
|
PKNH_1320400 | PKNH_1320400.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1980 | PKNH_1320400 | alpha/beta hydrolase, putative | alpha/beta hydrolase, putative | 7319447 | B3L127 | 13 | PKNH_13_v2:915,277..917,256(-) | PKNH_13_v2:915277..917256(-) | PKNH_13_v2 | Plasmodium knowlesi strain H | 67 | OG6_129556 | 0 | 659 | 1980 | 75493 | 9.55 | 0 | | | | | | | | | | | | | | | | 3.4.11.- (Aminopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1320400ORalpha/beta hydrolase, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1320400 OR alpha/beta hydrolase, putative AND Plasmodium knowlesi strain H |
|
PKNH_1320500 | PKNH_1320500.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1422 | PKNH_1320500 | SPRY domain, putative | SPRY domain, putative | 7319446 | B3L126 | 13 | PKNH_13_v2:919,796..921,217(+) | PKNH_13_v2:919796..921217(+) | PKNH_13_v2 | Plasmodium knowlesi strain H | 44 | OG6_102272 | 0 | 473 | 1422 | 52922 | 6.29 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1320500ORSPRY domain, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1320500 OR SPRY domain, putative AND Plasmodium knowlesi strain H |
|
PKNH_1322100 | PKNH_1322100.1 | 4 | 4 | 1 | | | forward | protein coding | No | 807 | PKNH_1322100 | rhomboid protease ROM3, putative | rhomboid protease ROM3, putative | 7319430 | B3L110 | 13 | PKNH_13_v2:985,936..987,151(+) | PKNH_13_v2:985936..987151(+) | PKNH_13_v2 | Plasmodium knowlesi strain H | 93 | OG6_100562 | 1 | 268 | 807 | 30039 | 8.13 | 7 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | 3.4.21.105 (Rhomboid protease) | 3.4.21.- (Serine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1322100ORrhomboid protease ROM3, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1322100 OR rhomboid protease ROM3, putative AND Plasmodium knowlesi strain H |
|
PKNH_1324900 | PKNH_1324900.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1128 | PKNH_1324900 | esterase, putative | esterase, putative | 7319377 | B3L0Y4 | 13 | PKNH_13_v2:1,117,075..1,118,202(+) | PKNH_13_v2:1117075..1118202(+) | PKNH_13_v2 | Plasmodium knowlesi strain H | 455 | OG6_100231 | 6 | 375 | 1128 | 42944 | 6.51 | 0 | | | | | | | | | | | GO:0016788 | hydrolase activity, acting on ester bonds | | | 3.1.-.- (Acting on ester bonds.) | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1324900OResterase, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1324900 OR esterase, putative AND Plasmodium knowlesi strain H |
|
PKNH_1328500 | PKNH_1328500.1 | 8 | 8 | 1 | | | reverse | protein coding | No | 2121 | PKNH_1328500 | plasmepsin IX, putative | plasmepsin IX, putative | 7322701 | B3LA89 | 13 | PKNH_13_v2:1,314,332..1,317,469(-) | PKNH_13_v2:1314332..1317469(-) | PKNH_13_v2 | Plasmodium knowlesi strain H | 91 | OG6_119797 | 1 | 706 | 2121 | 81940 | 8.92 | 0 | NN: MPPHRFQKLGNRLLSTLLIHPKASLLFVVHLFLFRQGTCL, HMM: MPPHRFQKLGNRLLSTLLIHPKASLLFVVHLFLFRQGTCL | NN Sum: 4, NN D: .59, HMM Prob: .9 | | | GO:0004190 | aspartic-type endopeptidase activity | GO:0006508 | proteolysis | GO:0020008 | rhoptry | | | | | 3.4.23.- (Aspartic endopeptidases.) | 3.4.23.1 (Pepsin A) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1328500ORplasmepsin IX, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1328500 OR plasmepsin IX, putative AND Plasmodium knowlesi strain H |
|
PKNH_1330400 | PKNH_1330400.1 | 2 | 2 | 1 | | | forward | protein coding | No | 1137 | PKNH_1330400 | proliferation-associated protein 2g4, putative | proliferation-associated protein 2g4, putative | 7322722 | B3LAB0 | 13 | PKNH_13_v2:1,408,177..1,409,455(+) | PKNH_13_v2:1408177..1409455(+) | PKNH_13_v2 | Plasmodium knowlesi strain H | 42 | OG6_101895 | 0 | 378 | 1137 | 42552 | 7.88 | 0 | | | | | | | | | | | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1330400ORproliferation-associated protein 2g4, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1330400 OR proliferation-associated protein 2g4, putative AND Plasmodium knowlesi strain H |
|
PKNH_1331600 | PKNH_1331600.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 4599 | PKNH_1331600 | lipase, putative | lipase, putative | 7322733 | B3LAC1 | 13 | PKNH_13_v2:1,457,332..1,461,930(-) | PKNH_13_v2:1457332..1461930(-) | PKNH_13_v2 | Plasmodium knowlesi strain H | 43 | OG6_145929 | 0 | 1532 | 4599 | 177159 | 4.77 | 0 | NN: MIPCLLLCFFNLLFLAYLLEVSCS, HMM: MIPCLLLCFFNLLFLAYLLEVSCS | NN Sum: 3, NN D: .71, HMM Prob: 1 | | | | | GO:0006629 | lipid metabolic process | | | | | | | 3.1.1.3 (Triacylglycerol lipase) | 3.1.1.3 (Triacylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1331600ORlipase, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1331600 OR lipase, putative AND Plasmodium knowlesi strain H |
|
PKNH_1333400 | PKNH_1333400.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1446 | PKNH_1333400 | enoyl-CoA hydratase, putative | enoyl-CoA hydratase, putative | 7322856 | B3LAD8 | 13 | PKNH_13_v2:1,522,594..1,524,039(+) | PKNH_13_v2:1522594..1524039(+) | PKNH_13_v2 | Plasmodium knowlesi strain H | 44 | OG6_102410 | 0 | 481 | 1446 | 55375 | 9.13 | 0 | | | | | GO:0003824 | catalytic activity | GO:0008152 | metabolic process | | | | | | | 4.2.1.17 (Enoyl-CoA hydratase) | 4.2.1.17 (Enoyl-CoA hydratase) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1333400ORenoyl-CoA hydratase, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1333400 OR enoyl-CoA hydratase, putative AND Plasmodium knowlesi strain H |
|
PKNH_1340700 | PKNH_1340700.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 3006 | PKNH_1340700 | cysteine protease ATG4, putative | cysteine protease ATG4, putative | 7322982 | B3LAJ3 | 13 | PKNH_13_v2:1,791,669..1,794,977(-) | PKNH_13_v2:1791669..1794977(-) | PKNH_13_v2 | Plasmodium knowlesi strain H | 41 | OG6_100501 | 0 | 1001 | 3006 | 115350 | 9.41 | 0 | | | | | | | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1340700ORcysteine protease ATG4, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1340700 OR cysteine protease ATG4, putative AND Plasmodium knowlesi strain H |
|
PKNH_1341900 | PKNH_1341900.1 | 1 | 1 | 1 | | | forward | protein coding | No | 5895 | PKNH_1341900 | metacaspase-3, putative | metacaspase-3, putative | 7322987 | B3LAJ8 | 13 | PKNH_13_v2:1,863,371..1,869,265(+) | PKNH_13_v2:1863371..1869265(+) | PKNH_13_v2 | Plasmodium knowlesi strain H | 46 | OG6_119794 | 0 | 1964 | 5895 | 221207 | 9.76 | 0 | | | | | | | | | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1341900ORmetacaspase-3, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1341900 OR metacaspase-3, putative AND Plasmodium knowlesi strain H |
|
PKNH_1343200 | PKNH_1343200.1 | 1 | 1 | 1 | | | forward | protein coding | No | 3096 | PKNH_1343200 | ATP-dependent protease, putative | ATP-dependent protease, putative | 7323000 | B3LAL1 | 13 | PKNH_13_v2:1,921,550..1,924,645(+) | PKNH_13_v2:1921550..1924645(+) | PKNH_13_v2 | Plasmodium knowlesi strain H | 47 | OG6_100411 | 0 | 1031 | 3096 | 117446 | 8.40 | 0 | | | | | GO:0005524;GO:0004176;GO:0004252 | ATP binding;ATP-dependent peptidase activity;serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1343200ORATP-dependent protease, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1343200 OR ATP-dependent protease, putative AND Plasmodium knowlesi strain H |
|
PKNH_1343400 | PKNH_1343400.1 | 1 | 1 | 1 | | | forward | protein coding | No | 3714 | PKNH_1343400 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | 7323002 | B3LAL3 | 13 | PKNH_13_v2:1,930,118..1,933,831(+) | PKNH_13_v2:1930118..1933831(+) | PKNH_13_v2 | Plasmodium knowlesi strain H | 48 | OG6_101457 | 0 | 1237 | 3714 | 138983 | 9.96 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1343400ORubiquitin carboxyl-terminal hydrolase, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1343400 OR ubiquitin carboxyl-terminal hydrolase, putative AND Plasmodium knowlesi strain H |
|
PKNH_1343600 | PKNH_1343600.1 | 5 | 5 | 1 | | | forward | protein coding | No | 6825 | PKNH_1343600 | atypical protein kinase, ABC-1 family, putative | atypical protein kinase, ABC-1 family, putative | 7323004 | B3LAL5 | 13 | PKNH_13_v2:1,939,556..1,947,140(+) | PKNH_13_v2:1939556..1947140(+) | PKNH_13_v2 | Plasmodium knowlesi strain H | 48 | OG6_112296 | 0 | 2274 | 6825 | 261064 | 9.75 | 0 | | | | | | | | | | | | | | | | 1.14.13.- (With NADH or NADPH as one donor, and incorporation of one atom of oxygen.) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1343600ORatypical protein kinase, ABC-1 family, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1343600 OR atypical protein kinase, ABC-1 family, putative AND Plasmodium knowlesi strain H |
|
PKNH_1347100 | PKNH_1347100.1 | 4 | 4 | 1 | | | forward | protein coding | No | 2376 | PKNH_1347100 | rhomboid protease ROM8, putative | rhomboid protease ROM8, putative | 7323042 | B3LAQ3 | 13 | PKNH_13_v2:2,106,291..2,109,133(+) | PKNH_13_v2:2106291..2109133(+) | PKNH_13_v2 | Plasmodium knowlesi strain H | 44 | OG6_533440 | 0 | 791 | 2376 | 92184 | 9.67 | 5 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1347100ORrhomboid protease ROM8, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1347100 OR rhomboid protease ROM8, putative AND Plasmodium knowlesi strain H |
|
PKNH_1348200 | PKNH_1348200.1 | 7 | 7 | 1 | | | reverse | protein coding | No | 945 | PKNH_1348200 | alpha/beta hydrolase, putative | alpha/beta hydrolase, putative | 7322889 | B3LAR5 | 13 | PKNH_13_v2:2,166,475..2,168,577(-) | PKNH_13_v2:2166475..2168577(-) | PKNH_13_v2 | Plasmodium knowlesi strain H | 43 | OG6_112275 | 0 | 314 | 945 | 36490 | 9.68 | 0 | | | | | | | | | GO:0005737 | cytoplasm | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1348200ORalpha/beta hydrolase, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1348200 OR alpha/beta hydrolase, putative AND Plasmodium knowlesi strain H |
|
PKNH_1349100 | PKNH_1349100.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1182 | PKNH_1349100 | DNA damage-inducible protein 1, putative | DNA damage-inducible protein 1, putative | 7322897 | B3LAS3 | 13 | PKNH_13_v2:2,212,828..2,214,009(-) | PKNH_13_v2:2212828..2214009(-) | PKNH_13_v2 | Plasmodium knowlesi strain H | 45 | OG6_101685 | 0 | 393 | 1182 | 44035 | 4.85 | 0 | | | | | GO:0004190 | aspartic-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1349100ORDNA damage-inducible protein 1, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1349100 OR DNA damage-inducible protein 1, putative AND Plasmodium knowlesi strain H |
|
PKNH_1350300 | PKNH_1350300.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1353 | PKNH_1350300 | plasmepsin IV, putative | plasmepsin IV, putative | 7322907 | B3LAT3 | 13 | PKNH_13_v2:2,279,872..2,281,224(-) | PKNH_13_v2:2279872..2281224(-) | PKNH_13_v2 | Plasmodium knowlesi strain H | 158 | OG6_100536 | 1 | 450 | 1353 | 51686 | 4.91 | 1 | | | | | GO:0004190 | aspartic-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1350300ORplasmepsin IV, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1350300 OR plasmepsin IV, putative AND Plasmodium knowlesi strain H |
|
PKNH_1351500 | PKNH_1351500.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3732 | PKNH_1351500 | ATP-dependent Clp protease regulatory subunit ClpC, putative | ATP-dependent Clp protease regulatory subunit ClpC, putative | 7322918 | B3LAU4 | 13 | PKNH_13_v2:2,326,360..2,330,091(-) | PKNH_13_v2:2326360..2330091(-) | PKNH_13_v2 | Plasmodium knowlesi strain H | 42 | OG6_532618 | 0 | 1243 | 3732 | 142714 | 6.76 | 0 | NN: MNALYLLLCMVTLKLVVTI, HMM: MNALYLLLCMVTLKLVVTI | NN Sum: 4, NN D: .74, HMM Prob: .99 | | | GO:0005524 | ATP binding | GO:0019538 | protein metabolic process | GO:0020011 | apicoplast | | | | | | 3.4.21.92 (Endopeptidase Clp) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1351500ORATP-dependent Clp protease regulatory subunit ClpC, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1351500 OR ATP-dependent Clp protease regulatory subunit ClpC, putative AND Plasmodium knowlesi strain H |
|
PKNH_1351600 | PKNH_1351600.1 | 2 | 2 | 1 | | | forward | protein coding | No | 4434 | PKNH_1351600 | WD repeat-containing protein 65, putative | WD repeat-containing protein 65, putative | 7322919 | B3LAU5 | 13 | PKNH_13_v2:2,331,952..2,336,621(+) | PKNH_13_v2:2331952..2336621(+) | PKNH_13_v2 | Plasmodium knowlesi strain H | 50 | OG6_102663 | 0 | 1477 | 4434 | 171321 | 7.36 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1351600ORWD repeat-containing protein 65, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1351600 OR WD repeat-containing protein 65, putative AND Plasmodium knowlesi strain H |
|
PKNH_1401500 | PKNH_1401500.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1281 | PKNH_1401500 | lysophospholipase, putative | lysophospholipase, putative | | | 14 | PKNH_14_v2:69,635..70,915(-) | PKNH_14_v2:69635..70915(-) | PKNH_14_v2 | Plasmodium knowlesi strain H | 455 | OG6_100231 | 6 | 426 | 1281 | 48694 | 9.02 | 0 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1401500ORlysophospholipase, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1401500 OR lysophospholipase, putative AND Plasmodium knowlesi strain H |
|
PKNH_1405800 | PKNH_1405800.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 993 | PKNH_1405800 | site-2 protease S2P, putative | site-2 protease S2P, putative | 7323374 | B3LBL7 | 14 | PKNH_14_v2:276,403..277,554(-) | PKNH_14_v2:276403..277554(-) | PKNH_14_v2 | Plasmodium knowlesi strain H | 43 | OG6_107106 | 0 | 330 | 993 | 38732 | 7.19 | 8 | | | | | | | | | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1405800ORsite-2 protease S2P, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1405800 OR site-2 protease S2P, putative AND Plasmodium knowlesi strain H |
|
PKNH_1406600 | PKNH_1406600.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1182 | PKNH_1406600 | 26S protease regulatory subunit 10B, putative | 26S protease regulatory subunit 10B, putative | 7323382 | B3LBM5 | 14 | PKNH_14_v2:302,550..303,731(-) | PKNH_14_v2:302550..303731(-) | PKNH_14_v2 | Plasmodium knowlesi strain H | 44 | OG6_101751 | 0 | 393 | 1182 | 44681 | 8.93 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | GO:0008540 | proteasome regulatory particle, base subcomplex | | | GO:0070682;GO:0006511 | proteasome regulatory particle assembly;ubiquitin-dependent protein catabolic process | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1406600OR26S protease regulatory subunit 10B, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1406600 OR 26S protease regulatory subunit 10B, putative AND Plasmodium knowlesi strain H |
|
PKNH_1411900 | PKNH_1411900.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 1263 | PKNH_1411900 | 26S protease regulatory subunit 7, putative | 26S protease regulatory subunit 7, putative | 7323518 | B3LBS7 | 14 | PKNH_14_v2:521,678..523,156(-) | PKNH_14_v2:521678..523156(-) | PKNH_14_v2 | Plasmodium knowlesi strain H | 44 | OG6_101899 | 0 | 420 | 1263 | 46736 | 6.38 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | | | | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1411900OR26S protease regulatory subunit 7, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1411900 OR 26S protease regulatory subunit 7, putative AND Plasmodium knowlesi strain H |
|
PKNH_1412500 | PKNH_1412500.1 | 1 | 1 | 1 | | | forward | protein coding | No | 3294 | PKNH_1412500 | M1-family alanyl aminopeptidase, putative | M1-family alanyl aminopeptidase, putative | 7323524 | B3LBT3 | 14 | PKNH_14_v2:568,291..571,584(+) | PKNH_14_v2:568291..571584(+) | PKNH_14_v2 | Plasmodium knowlesi strain H | 44 | OG6_106799 | 0 | 1097 | 3294 | 126306 | 7.30 | 1 | NN: MIRERMLNLYFLFITVLAALAI, HMM: MIRERMLNLYFLFITVLAALAI | NN Sum: 4, NN D: .83, HMM Prob: .51 | | | GO:0008237;GO:0008270 | metallopeptidase activity;zinc ion binding | | | | | | | | | | 3.4.11.2 (Membrane alanyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1412500ORM1-family alanyl aminopeptidase, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1412500 OR M1-family alanyl aminopeptidase, putative AND Plasmodium knowlesi strain H |
|
PKNH_1417700 | PKNH_1417700.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2049 | PKNH_1417700 | U4/U6.U5 tri-snRNP-associated protein 2, putative | U4/U6.U5 tri-snRNP-associated protein 2, putative | 7323576 | B3LBY5 | 14 | PKNH_14_v2:787,564..789,612(+) | PKNH_14_v2:787564..789612(+) | PKNH_14_v2 | Plasmodium knowlesi strain H | 45 | OG6_102786 | 0 | 682 | 2049 | 78378 | 8.02 | 0 | | | | | GO:0036459;GO:0008270 | thiol-dependent ubiquitinyl hydrolase activity;zinc ion binding | GO:0016579 | protein deubiquitination | | | | | GO:0000398;GO:0000245 | mRNA splicing, via spliceosome;spliceosomal complex assembly | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1417700ORU4/U6.U5 tri-snRNP-associated protein 2, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1417700 OR U4/U6.U5 tri-snRNP-associated protein 2, putative AND Plasmodium knowlesi strain H |
|
PKNH_1419900 | PKNH_1419900.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2067 | PKNH_1419900 | ubiquitin carboxyl-terminal hydrolase MINDY, putative | ubiquitin carboxyl-terminal hydrolase MINDY, putative | 7323433 | B3LC06 | 14 | PKNH_14_v2:876,508..878,574(+) | PKNH_14_v2:876508..878574(+) | PKNH_14_v2 | Plasmodium knowlesi strain H | 44 | OG6_102202 | 0 | 688 | 2067 | 78566 | 8.09 | 0 | | | | | GO:1990380;GO:0004843 | Lys48-specific deubiquitinase activity;thiol-dependent ubiquitin-specific protease activity | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1419900ORubiquitin carboxyl-terminal hydrolase MINDY, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1419900 OR ubiquitin carboxyl-terminal hydrolase MINDY, putative AND Plasmodium knowlesi strain H |
|
PKNH_1421000 | PKNH_1421000.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 951 | PKNH_1421000 | signal peptidase, putative | signal peptidase, putative | 7323444 | B3LC17 | 14 | PKNH_14_v2:926,649..927,599(-) | PKNH_14_v2:926649..927599(-) | PKNH_14_v2 | Plasmodium knowlesi strain H | 44 | OG6_100609 | 0 | 316 | 951 | 37012 | 10.56 | 1 | | | GO:0016021;GO:0016020 | integral component of membrane;membrane | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1421000ORsignal peptidase, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1421000 OR signal peptidase, putative AND Plasmodium knowlesi strain H |
|
PKNH_1428400 | PKNH_1428400.1 | 12 | 12 | 1 | | | forward | protein coding | No | 1446 | PKNH_1428400 | trypsin-like serine protease, putative | trypsin-like serine protease, putative | 7323062 | B3LC87 | 14 | PKNH_14_v2:1,223,601..1,227,235(+) | PKNH_14_v2:1223601..1227235(+) | PKNH_14_v2 | Plasmodium knowlesi strain H | 39 | OG6_100391 | 0 | 481 | 1446 | 54873 | 8.12 | 0 | | | | | GO:0005515;GO:0004252 | protein binding;serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.21.107 (Peptidase Do) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1428400ORtrypsin-like serine protease, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1428400 OR trypsin-like serine protease, putative AND Plasmodium knowlesi strain H |
|
PKNH_1428500 | PKNH_1428500.1 | 5 | 5 | 1 | | | forward | protein coding | No | 870 | PKNH_1428500 | GTP-binding protein YihA3, putative | GTP-binding protein YihA3, putative | | | 14 | PKNH_14_v2:1,227,331..1,229,070(+) | PKNH_14_v2:1227331..1229070(+) | PKNH_14_v2 | Plasmodium knowlesi strain H | 131 | OG6_101142 | 2 | 289 | 870 | 33817 | 10.24 | 0 | NN: MRNLVKSPVSPFFWVLFLNVIRLCCF, HMM: MRNLVKSPVSPFFWVLFLNVIRLCCF | NN Sum: 3, NN D: .59, HMM Prob: .77 | | | GO:0005525 | GTP binding | | | GO:0020011;GO:0005829 | apicoplast;cytosol | GO:0003924;GO:0043022 | GTPase activity;ribosome binding | | | | 3.6.5.1 (Heterotrimeric G-protein GTPase) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1428500ORGTP-binding protein YihA3, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1428500 OR GTP-binding protein YihA3, putative AND Plasmodium knowlesi strain H |
|
PKNH_1431100 | PKNH_1431100.1 | 1 | 1 | 1 | | | forward | protein coding | No | 15678 | PKNH_1431100 | peptidase family C50, putative | peptidase family C50, putative | 7323088 | B3LCB3 | 14 | PKNH_14_v2:1,354,916..1,370,593(+) | PKNH_14_v2:1354916..1370593(+) | PKNH_14_v2 | Plasmodium knowlesi strain H | 36 | OG6_150828 | 0 | 5225 | 15678 | 614010 | 8.75 | 9 | | | | | GO:0008233 | peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.49 (Separase) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1431100ORpeptidase family C50, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1431100 OR peptidase family C50, putative AND Plasmodium knowlesi strain H |
|
PKNH_1437500 | PKNH_1437500.1 | 3 | 3 | 1 | | | forward | protein coding | No | 1254 | PKNH_1437500 | PPPDE peptidase domain-containing protein, putative | PPPDE peptidase domain-containing protein, putative | 7323273 | B3LCH3 | 14 | PKNH_14_v2:1,596,994..1,598,622(+) | PKNH_14_v2:1596994..1598622(+) | PKNH_14_v2 | Plasmodium knowlesi strain H | 44 | OG6_102579 | 0 | 417 | 1254 | 48262 | 4.87 | 0 | | | | | | | | | | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1437500ORPPPDE peptidase domain-containing protein, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1437500 OR PPPDE peptidase domain-containing protein, putative AND Plasmodium knowlesi strain H |
|
PKNH_1446200 | PKNH_1446200.1 | 6 | 6 | 1 | | | forward | protein coding | No | 1209 | PKNH_1446200 | ataxin-3, putative | ataxin-3, putative | 7323659 | B3LCQ8 | 14 | PKNH_14_v2:1,999,682..2,001,728(+) | PKNH_14_v2:1999682..2001728(+) | PKNH_14_v2 | Plasmodium knowlesi strain H | 44 | OG6_104644 | 0 | 402 | 1209 | 46156 | 5.36 | 0 | | | | | GO:0005515;GO:0004843 | protein binding;thiol-dependent ubiquitin-specific protease activity | GO:0016579 | protein deubiquitination | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1446200ORataxin-3, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1446200 OR ataxin-3, putative AND Plasmodium knowlesi strain H |
|
PKNH_1449800 | PKNH_1449800.1 | 5 | 5 | 1 | | | reverse | protein coding | No | 627 | PKNH_1449800 | ATP-dependent protease subunit ClpQ, putative | ATP-dependent protease subunit ClpQ, putative | 7323163 | B3LCU5 | 14 | PKNH_14_v2:2,158,975..2,160,314(-) | PKNH_14_v2:2158975..2160314(-) | PKNH_14_v2 | Plasmodium knowlesi strain H | 44 | OG6_107204 | 0 | 208 | 627 | 22888 | 8.48 | 0 | HMM: MFLRHLSGFIRVPPAISRTA, NN: MFLRHLSGFIRVPPAISR | NN Sum: 3, NN D: .44, HMM Prob: .03 | GO:0009376;GO:0005839 | HslUV protease complex;proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0006508;GO:0051603 | proteolysis;proteolysis involved in cellular protein catabolic process | | | | | | | 3.4.25.2 (HslU--HslV peptidase) | 3.4.25.2 (HslU--HslV peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1449800ORATP-dependent protease subunit ClpQ, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1449800 OR ATP-dependent protease subunit ClpQ, putative AND Plasmodium knowlesi strain H |
|
PKNH_1453300 | PKNH_1453300.1 | 3 | 3 | 1 | | | forward | protein coding | No | 3114 | PKNH_1453300 | sentrin-specific protease 1, putative | sentrin-specific protease 1, putative | 7323200 | B3LCY2 | 14 | PKNH_14_v2:2,334,871..2,338,377(+) | PKNH_14_v2:2334871..2338377(+) | PKNH_14_v2 | Plasmodium knowlesi strain H | 44 | OG6_101235 | 0 | 1037 | 3114 | 118947 | 8.19 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.68 (Ulp1 peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1453300ORsentrin-specific protease 1, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1453300 OR sentrin-specific protease 1, putative AND Plasmodium knowlesi strain H |
|
PKNH_1453800 | PKNH_1453800.1 | 6 | 6 | 1 | | | reverse | protein coding | No | 1695 | PKNH_1453800 | microgamete surface protein MiGS, putative | microgamete surface protein MiGS, putative | 7323205 | B3LCY7 | 14 | PKNH_14_v2:2,362,952..2,365,286(-) | PKNH_14_v2:2362952..2365286(-) | PKNH_14_v2 | Plasmodium knowlesi strain H | 44 | OG6_127652 | 0 | 564 | 1695 | 62456 | 7.41 | 1 | HMM: MALIIPLLFTLATLLLHTQNVTVCSAD, NN: MALIIPLLFTLATLLLHTQNVTVCSAD | NN Sum: 4, NN D: .66, HMM Prob: 1 | | | | | | | GO:0009986;GO:0044310 | cell surface;osmiophilic body | | | | | | 3.4.23.3 (Gastricsin) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1453800ORmicrogamete surface protein MiGS, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1453800 OR microgamete surface protein MiGS, putative AND Plasmodium knowlesi strain H |
|
PKNH_1459800 | PKNH_1459800.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2577 | PKNH_1459800 | ATP-dependent zinc metalloprotease FTSH 1, putative | ATP-dependent zinc metalloprotease FTSH 1, putative | 7323591 | B3LD47 | 14 | PKNH_14_v2:2,649,561..2,652,137(+) | PKNH_14_v2:2649561..2652137(+) | PKNH_14_v2 | Plasmodium knowlesi strain H | 91 | OG6_100384 | 1 | 858 | 2577 | 96551 | 9.71 | 1 | | | GO:0016020 | membrane | GO:0005524;GO:0004222 | ATP binding;metalloendopeptidase activity | GO:0006508 | proteolysis | GO:0020011;GO:0005739 | apicoplast;mitochondrion | GO:0005524;GO:0004176;GO:0004222 | ATP binding;ATP-dependent peptidase activity;metalloendopeptidase activity | GO:0006508;GO:0042493 | proteolysis;response to drug | 3.4.24.- (Metalloendopeptidases.) | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1459800ORATP-dependent zinc metalloprotease FTSH 1, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1459800 OR ATP-dependent zinc metalloprotease FTSH 1, putative AND Plasmodium knowlesi strain H |
|
PKNH_1460100 | PKNH_1460100.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1605 | PKNH_1460100 | 3-hydroxyisobutyryl-CoA hydrolase, putative | 3-hydroxyisobutyryl-CoA hydrolase, putative | 7323594 | B3LD50 | 14 | PKNH_14_v2:2,676,545..2,678,149(+) | PKNH_14_v2:2676545..2678149(+) | PKNH_14_v2 | Plasmodium knowlesi strain H | 49 | OG6_102025 | 0 | 534 | 1605 | 61098 | 8.59 | 0 | | | | | GO:0003860 | 3-hydroxyisobutyryl-CoA hydrolase activity | | | | | | | | | 3.1.2.4 (3-hydroxyisobutyryl-CoA hydrolase) | 3.1.2.4 (3-hydroxyisobutyryl-CoA hydrolase) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1460100OR3-hydroxyisobutyryl-CoA hydrolase, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1460100 OR 3-hydroxyisobutyryl-CoA hydrolase, putative AND Plasmodium knowlesi strain H |
|
PKNH_1467500 | PKNH_1467500.1 | 9 | 9 | 1 | | | forward | protein coding | No | 1755 | PKNH_1467500 | dipeptidyl aminopeptidase 2, putative | dipeptidyl aminopeptidase 2, putative | 7323665 | B3LDB9 | 14 | PKNH_14_v2:2,989,507..2,992,642(+) | PKNH_14_v2:2989507..2992642(+) | PKNH_14_v2 | Plasmodium knowlesi strain H | 90 | OG6_103622 | 1 | 584 | 1755 | 66633 | 6.88 | 0 | HMM: MKYLLVISFLFLLVRYVEGD, NN: MKYLLVISFLFLLVRYVEGD | NN Sum: 4, NN D: .92, HMM Prob: 1 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | GO:0044310 | osmiophilic body | | | | | 3.4.14.1 (Dipeptidyl-peptidase I) | 3.4.14.1 (Dipeptidyl-peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1467500ORdipeptidyl aminopeptidase 2, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1467500 OR dipeptidyl aminopeptidase 2, putative AND Plasmodium knowlesi strain H |
|
PKNH_1468600 | PKNH_1468600.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1275 | PKNH_1468600 | 26S protease regulatory subunit 8, putative | 26S protease regulatory subunit 8, putative | 7323676 | B3LDD0 | 14 | PKNH_14_v2:3,026,246..3,027,520(-) | PKNH_14_v2:3026246..3027520(-) | PKNH_14_v2 | Plasmodium knowlesi strain H | 44 | OG6_101513 | 0 | 424 | 1275 | 48271 | 6.61 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | GO:0008540 | proteasome regulatory particle, base subcomplex | | | GO:0070682;GO:0043161 | proteasome regulatory particle assembly;proteasome-mediated ubiquitin-dependent protein catabolic process | | 3.6.4.3 (Transferred entry: 5.6.1.1) | https://pubmed.ncbi.nlm.nih.gov/?term=PKNH_1468600OR26S protease regulatory subunit 8, putativeANDPlasmodium knowlesi strain H | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PKNH_1468600 OR 26S protease regulatory subunit 8, putative AND Plasmodium knowlesi strain H |