|
TGME49_200290 | TGME49_200290-t26_1 | 5 | 5 | 1 | 489 | 656 | forward | protein coding | No | 2027 | TGME49_200290 | rhomboid protease ROM1 | rhomboid protease ROM1 | 7895866 | S8G8W2 | VIII | TGME49_chrVIII:6,774,898..6,778,962(+) | TGME49_chrVIII:6775554..6778473(+) | TGME49_chrVIII | Toxoplasma gondii ME49 | 52 | OG6_100562 | 1 | 293 | 882 | 32866 | 7.88 | 6 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | GO:0005794;GO:0045177;GO:0005783 | Golgi apparatus;apical part of cell;endoplasmic reticulum | | | | | 3.4.21.105 (Rhomboid protease) | 3.4.21.- (Serine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_200290ORrhomboid protease ROM1ANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_200290 OR rhomboid protease ROM1 AND Toxoplasma gondii ME49 |
|
TGME49_200350 | TGME49_200350-t26_1 | 6 | 6 | 1 | | | forward | protein coding | No | 2910 | TGME49_200350 | subtilisin SUB3 | subtilisin SUB3 | 7895872 | | VIII | TGME49_chrVIII:6,815,991..6,821,227(+) | TGME49_chrVIII:6815991..6821227(+) | TGME49_chrVIII | Toxoplasma gondii ME49 | 25 | OG6_156705 | 0 | 969 | 2910 | 104114 | 6.14 | 1 | | | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.21.62 (Subtilisin) | 3.4.21.62 (Subtilisin) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_200350ORsubtilisin SUB3ANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_200350 OR subtilisin SUB3 AND Toxoplasma gondii ME49 |
|
TGME49_201840 | TGME49_201840-t26_1 | 9 | 9 | 1 | 1039 | 589 | forward | protein coding | No | 3488 | TGME49_201840 | aspartyl protease ASP1 | aspartyl protease ASP1 | 7894180 | S8F3D0 | VIIa | TGME49_chrVIIa:3,748,209..3,755,973(+) | TGME49_chrVIIa:3748798..3754934(+) | TGME49_chrVIIa | Toxoplasma gondii ME49 | 50 | OG6_100536 | 1 | 619 | 1860 | 66900 | 6.77 | 1 | | | | | GO:0004190 | aspartic-type endopeptidase activity | GO:0006508 | proteolysis | GO:0045177;GO:0070258 | apical part of cell;inner membrane pellicle complex | | | | | 3.4.23.5 (Cathepsin D) | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_201840ORaspartyl protease ASP1ANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_201840 OR aspartyl protease ASP1 AND Toxoplasma gondii ME49 |
|
TGME49_202310 | TGME49_202310-t26_1 | 3 | 3 | 1 | 1164 | 483 | forward | protein coding | No | 3390 | TGME49_202310 | O-sialoglycoprotein endopeptidase | O-sialoglycoprotein endopeptidase | 7894447 | S8F373 | VIIa | TGME49_chrVIIa:3,429,611..3,433,855(+) | TGME49_chrVIIa:3430094..3432691(+) | TGME49_chrVIIa | Toxoplasma gondii ME49 | 43 | OG6_100288 | 1 | 580 | 1743 | 62758 | 7.10 | 0 | | | | | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.24.57 (O-sialoglycoprotein endopeptidase) | 2.3.1.234 (N(6)-L-threonylcarbamoyladenine synthase) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_202310ORO-sialoglycoprotein endopeptidaseANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_202310 OR O-sialoglycoprotein endopeptidase AND Toxoplasma gondii ME49 |
|
TGME49_202580 | TGME49_202580-t26_1 | 18 | 18 | 1 | 1614 | 77 | forward | protein coding | No | 4805 | TGME49_202580 | ATPase, AAA family protein | ATPase, AAA family protein | 7897470 | | VIIa | TGME49_chrVIIa:3,190,729..3,205,864(+) | TGME49_chrVIIa:3190806..3204250(+) | TGME49_chrVIIa | Toxoplasma gondii ME49 | 51 | OG6_119511 | 0 | 1037 | 3114 | 112942 | 9.02 | 0 | | | GO:0005622 | intracellular | GO:0005524;GO:0016887;GO:0008134 | ATP binding;ATPase activity;transcription factor binding | GO:0019538;GO:0006355 | protein metabolic process;regulation of transcription, DNA-templated | | | | | | | | 3.4.21.92 (Endopeptidase Clp) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_202580ORATPase, AAA family proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_202580 OR ATPase, AAA family protein AND Toxoplasma gondii ME49 |
|
TGME49_202630 | TGME49_202630-t26_1 | 17 | 17 | 1 | 771 | 831 | reverse | protein coding | No | 5169 | TGME49_202630 | ATP-dependent metallopeptidase HflB subfamily protein | ATP-dependent metallopeptidase HflB subfamily protein | 7897475 | S8F993 | VIIa | TGME49_chrVIIa:3,149,594..3,162,966(-) | TGME49_chrVIIa:3150365..3162135(-) | TGME49_chrVIIa | Toxoplasma gondii ME49 | 42 | OG6_100384 | 0 | 1188 | 3567 | 128442 | 9.24 | 2 | HMM: MRALTLLHRGGSRSVAASPTLFSLGSSS, NN: MRALTLLHRGGSRSVAAS | NN Sum: 0, NN D: .32, HMM Prob: .95 | GO:0016020 | membrane | GO:0005524;GO:0004222;GO:0008568 | ATP binding;metalloendopeptidase activity;microtubule-severing ATPase activity | GO:0006508 | proteolysis | | | | | | | 3.6.4.3 (Transferred entry: 5.6.1.1) | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_202630ORATP-dependent metallopeptidase HflB subfamily proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_202630 OR ATP-dependent metallopeptidase HflB subfamily protein AND Toxoplasma gondii ME49 |
|
TGME49_202680 | TGME49_202680-t26_1 | 8 | 8 | 1 | 775 | 1358 | reverse | protein coding | No | 3825 | TGME49_202680 | peptidase M16, alpha subunit, putative | peptidase M16, alpha subunit, putative | 7894031 | S8GED8 | VIIa | TGME49_chrVIIa:3,107,031..3,115,474(-) | TGME49_chrVIIa:3107806..3114116(-) | TGME49_chrVIIa | Toxoplasma gondii ME49 | 27 | OG6_102381 | 0 | 563 | 1692 | 62203 | 8.45 | 0 | HMM: MNASILFRRNAPGVSTCLRRRCLRPAALAAASASGVSTPASGV, NN: MNASILFRRNAPGVSTCLRRRCLRPAALA | NN Sum: 0, NN D: .18, HMM Prob: .94 | | | GO:0003824;GO:0046872;GO:0004222;GO:0008270 | catalytic activity;metal ion binding;metalloendopeptidase activity;zinc ion binding | GO:0006508 | proteolysis | | | | | | | 3.4.24.64 (Mitochondrial processing peptidase) | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_202680ORpeptidase M16, alpha subunit, putativeANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_202680 OR peptidase M16, alpha subunit, putative AND Toxoplasma gondii ME49 |
|
TGME49_202910 | TGME49_202910-t26_1 | 9 | 9 | 1 | 196 | 35 | forward | protein coding | No | 1188 | TGME49_202910 | zinc carboxypeptidase superfamily protein | zinc carboxypeptidase superfamily protein | 7894033 | | VIIa | TGME49_chrVIIa:2,947,788..2,949,431(+) | TGME49_chrVIIa:2947823..2949181(+) | TGME49_chrVIIa | Toxoplasma gondii ME49 | 23 | OG6_162756 | 0 | 318 | 957 | 35209 | 6.98 | 0 | HMM: MKCVPGLAVIAGTFVAMLRASAE, NN: MKCVPGLAVIAGTFVAMLRASAE | NN Sum: 4, NN D: .7, HMM Prob: .99 | | | GO:0004181;GO:0008270 | metallocarboxypeptidase activity;zinc ion binding | GO:0006508 | proteolysis | | | | | | | 3.4.17.1 (Carboxypeptidase A) | 3.4.17.1 (Carboxypeptidase A) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_202910ORzinc carboxypeptidase superfamily proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_202910 OR zinc carboxypeptidase superfamily protein AND Toxoplasma gondii ME49 |
|
TGME49_203270 | TGME49_203270-t26_1 | 4 | 4 | 1 | 702 | 1043 | forward | protein coding | No | 4115 | TGME49_203270 | ATP-dependent Clp endopeptidase, proteolytic subunit ClpP domain-containing protein | ATP-dependent Clp endopeptidase, proteolytic subunit ClpP domain-containing protein | 7894053 | | VIIa | TGME49_chrVIIa:2,625,125..2,631,309(+) | TGME49_chrVIIa:2626168..2630607(+) | TGME49_chrVIIa | Toxoplasma gondii ME49 | 38 | OG6_100939 | 1 | 789 | 2370 | 84816 | 9.98 | 0 | HMM: MLLPSSSHNALPLRPSLHPRGLSSPRFLLFLFLALPVLLPLGVSHSL, NN: MLLPSSSHNALPLRPSLHPRGLSSPRFLLFLFLALPVLLPLGVSHSL | NN Sum: 3, NN D: .41, HMM Prob: .97 | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.21.92 (Endopeptidase Clp) | 3.4.21.92 (Endopeptidase Clp) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_203270ORATP-dependent Clp endopeptidase, proteolytic subunit ClpP domain-containing proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_203270 OR ATP-dependent Clp endopeptidase, proteolytic subunit ClpP domain-containing protein AND Toxoplasma gondii ME49 |
|
TGME49_203300 | TGME49_203300-t26_1 | 11 | 11 | 1 | 474 | 313 | forward | protein coding | No | 4993 | TGME49_203300 | hypothetical protein | hypothetical protein | 7894056 | | VIIa | TGME49_chrVIIa:2,607,323..2,617,842(+) | TGME49_chrVIIa:2607636..2617368(+) | TGME49_chrVIIa | Toxoplasma gondii ME49 | 35 | OG6_102131 | 0 | 1401 | 4206 | 149701 | 5.36 | 2 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_203300ORhypothetical proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_203300 OR hypothetical protein AND Toxoplasma gondii ME49 |
|
TGME49_204040 | TGME49_204040-t26_1 | 5 | 5 | 1 | | | reverse | protein coding | No | 2391 | TGME49_204040 | hypothetical protein | hypothetical protein | 7897436 | | VIIa | TGME49_chrVIIa:2,040,605..2,044,834(-) | TGME49_chrVIIa:2040605..2044834(-) | TGME49_chrVIIa | Toxoplasma gondii ME49 | 16 | OG6_101989 | 0 | 796 | 2391 | 85265 | 7.67 | 8 | | | GO:0016021 | integral component of membrane | GO:0004190 | aspartic-type endopeptidase activity | GO:0016485 | protein processing | | | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_204040ORhypothetical proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_204040 OR hypothetical protein AND Toxoplasma gondii ME49 |
|
TGME49_204050 | TGME49_204050-t26_1 | 8 | 8 | 1 | 1107 | | forward | protein coding | No | 3393 | TGME49_204050 | subtilisin SUB1 | subtilisin SUB1 | 7897437 | S8F5S3 | VIIa | TGME49_chrVIIa:2,030,677..2,037,589(+) | TGME49_chrVIIa:2030677..2036482(+) | TGME49_chrVIIa | Toxoplasma gondii ME49 | 56 | OG6_121085 | 1 | 761 | 2286 | 81776 | 4.87 | 0 | HMM: MGSSHAIVACAALIVLLSTNARGL, NN: MGSSHAIVACAALIVLLSTNARGL | NN Sum: 4, NN D: .75, HMM Prob: 1 | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0045177 | apical part of cell | | | | | 3.4.21.62 (Subtilisin) | 3.4.21.62 (Subtilisin) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_204050ORsubtilisin SUB1ANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_204050 OR subtilisin SUB1 AND Toxoplasma gondii ME49 |
|
TGME49_204360 | TGME49_204360-t26_1 | 8 | 8 | 1 | 1080 | 103 | forward | protein coding | No | 4912 | TGME49_204360 | subtilisin SUB4 | subtilisin SUB4 | 7894425 | | VIIa | TGME49_chrVIIa:1,850,364..1,858,615(+) | TGME49_chrVIIa:1850467..1857535(+) | TGME49_chrVIIa | Toxoplasma gondii ME49 | 23 | OG6_223122 | 0 | 1242 | 3729 | 134493 | 4.83 | 1 | HMM: MGVCEYSLSAAFQSRHESVTRKRPRLGFSRWVFGFLLPVFWSLSSGSSAA, NN: MGVCEYSLSAAFQSRHESVTRKRPRLGFSRWVFGFLLPVFWSLSSGSSAA | NN Sum: 1, NN D: .3, HMM Prob: .84 | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.21.62 (Subtilisin) | 3.4.21.62 (Subtilisin) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_204360ORsubtilisin SUB4ANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_204360 OR subtilisin SUB4 AND Toxoplasma gondii ME49 |
|
TGME49_205600 | TGME49_205600-t26_1 | 5 | 5 | 1 | 707 | 1393 | forward | protein coding | No | 3669 | TGME49_205600 | zinc finger, C3HC4 type (RING finger) domain-containing protein | zinc finger, C3HC4 type (RING finger) domain-containing protein | 7894153 | | VIIa | TGME49_chrVIIa:1,278,721..1,285,055(+) | TGME49_chrVIIa:1280114..1284348(+) | TGME49_chrVIIa | Toxoplasma gondii ME49 | 22 | OG6_102074 | 0 | 522 | 1569 | 56834 | 4.96 | 2 | | | | | | | | | | | | | | | | 6.3.2.19 (Transferred entry: 2.3.2.23, 2.3.2.27 and 6.2.1.45) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_205600ORzinc finger, C3HC4 type (RING finger) domain-containing proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_205600 OR zinc finger, C3HC4 type (RING finger) domain-containing protein AND Toxoplasma gondii ME49 |
|
TGME49_206450 | TGME49_206450-t26_1 | 3 | 3 | 1 | 861 | 803 | reverse | protein coding | No | 12923 | TGME49_206450 | autophagy-related cysteine peptidase atg4, putative | autophagy-related cysteine peptidase atg4, putative | 7894397 | | VIIa | TGME49_chrVIIa:957,556..971,369(-) | TGME49_chrVIIa:958417..970566(-) | TGME49_chrVIIa | Toxoplasma gondii ME49 | 21 | OG6_100501 | 0 | 3752 | 11259 | 397383 | 5.19 | 0 | | | | | | | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_206450ORautophagy-related cysteine peptidase atg4, putativeANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_206450 OR autophagy-related cysteine peptidase atg4, putative AND Toxoplasma gondii ME49 |
|
TGME49_206490 | TGME49_206490-t26_1 | 11 | 11 | 1 | 590 | 1066 | forward | protein coding | No | 3885 | TGME49_206490 | ICE family protease (caspase) p20 domain-containing protein | ICE family protease (caspase) p20 domain-containing protein | 7894163 | S8F2G8 | VIIa | TGME49_chrVIIa:932,292..942,138(+) | TGME49_chrVIIa:933358..941548(+) | TGME49_chrVIIa | Toxoplasma gondii ME49 | 36 | OG6_101407 | 0 | 742 | 2229 | 80267 | 7.59 | 0 | | | | | GO:0004197 | cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_206490ORICE family protease (caspase) p20 domain-containing proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_206490 OR ICE family protease (caspase) p20 domain-containing protein AND Toxoplasma gondii ME49 |
|
TGME49_206510 | TGME49_206510-t26_1 | 14 | 14 | 1 | 1582 | 186 | forward | protein coding | No | 8791 | TGME49_206510 | toxolysin TLN4 | toxolysin TLN4 | 7894165 | | VIIa | TGME49_chrVIIa:903,219..919,335(+) | TGME49_chrVIIa:903405..917753(+) | TGME49_chrVIIa | Toxoplasma gondii ME49 | 38 | OG6_174421 | 0 | 2340 | 7023 | 246738 | 5.12 | 0 | | | | | GO:0003824;GO:0046872;GO:0004222;GO:0008270 | catalytic activity;metal ion binding;metalloendopeptidase activity;zinc ion binding | GO:0006508 | proteolysis | GO:0045177 | apical part of cell | | | | | 3.4.24.56 (Insulysin) | 3.4.24.56 (Insulysin) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_206510ORtoxolysin TLN4ANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_206510 OR toxolysin TLN4 AND Toxoplasma gondii ME49 |
|
TGME49_206630 | TGME49_206630-t26_1 | 2 | 2 | 1 | 914 | 2715 | reverse | protein coding | No | 5627 | TGME49_206630 | hypothetical protein | hypothetical protein | 7894017 | | VIIa | TGME49_chrVIIa:768,994..775,054(-) | TGME49_chrVIIa:769908..772339(-) | TGME49_chrVIIa | Toxoplasma gondii ME49 | 23 | OG6_158735 | 0 | 665 | 1998 | 71323 | 6.11 | 6 | | | GO:0016020 | membrane | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_206630ORhypothetical proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_206630 OR hypothetical protein AND Toxoplasma gondii ME49 |
|
TGME49_207650 | TGME49_207650-t26_1 | 1 | 1 | 1 | 321 | 990 | forward | protein coding | No | 1971 | TGME49_207650 | OTU family cysteine protease | OTU family cysteine protease | 7896258 | B6KNZ6 | Ib | TGME49_chrIb:189,415..191,385(+) | TGME49_chrIb:190405..191064(+) | TGME49_chrIb | Toxoplasma gondii ME49 | 101 | OG6_124104 | 10 | 219 | 660 | 25565 | 7.54 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_207650OROTU family cysteine proteaseANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_207650 OR OTU family cysteine protease AND Toxoplasma gondii ME49 |
|
TGME49_209530 | TGME49_209530-t26_1 | 3 | 3 | 1 | 559 | 598 | forward | protein coding | No | 2471 | TGME49_209530 | hypothetical protein | hypothetical protein | 7897139 | | Ib | TGME49_chrIb:1,307,812..1,311,307(+) | TGME49_chrIb:1308410..1310748(+) | TGME49_chrIb | Toxoplasma gondii ME49 | 15 | OG6_490585 | 0 | 437 | 1314 | 46631 | 6.19 | 2 | HMM: MTLVPSPSSSSSSCSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS, NN: MTLVPSPSSSS | NN Sum: 0, NN D: .03, HMM Prob: .91 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_209530ORhypothetical proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_209530 OR hypothetical protein AND Toxoplasma gondii ME49 |
|
TGME49_209620 | TGME49_209620-t26_1 | 8 | 8 | 1 | 646 | 1710 | reverse | protein coding | No | 3538 | TGME49_209620 | eukaryotic aspartyl protease superfamily protein | eukaryotic aspartyl protease superfamily protein | 7897148 | | Ib | TGME49_chrIb:1,362,590..1,366,587(-) | TGME49_chrIb:1363300..1364877(-) | TGME49_chrIb | Toxoplasma gondii ME49 | 16 | OG6_491673 | 0 | 393 | 1182 | 43488 | 6.94 | 0 | HMM: MMRLSTVLSVTLFPLLWAVLTY, NN: MMRLSTVLSVTLFPLLWAV | NN Sum: 4, NN D: .7, HMM Prob: .99 | | | GO:0004190 | aspartic-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.23.34 (Cathepsin E) | 3.4.23.34 (Cathepsin E) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_209620OReukaryotic aspartyl protease superfamily proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_209620 OR eukaryotic aspartyl protease superfamily protein AND Toxoplasma gondii ME49 |
|
TGME49_210678 | TGME49_210678-t26_1 | 1 | 1 | 1 | | 197 | forward | protein coding | No | 1883 | TGME49_210678 | OTU family cysteine protease | OTU family cysteine protease | | | IV | TGME49_chrIV:2,166,140..2,168,022(+) | TGME49_chrIV:2166337..2168022(+) | TGME49_chrIV | Toxoplasma gondii ME49 | 101 | OG6_124104 | 10 | 561 | 1686 | 62660 | 4.48 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_210678OROTU family cysteine proteaseANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_210678 OR OTU family cysteine protease AND Toxoplasma gondii ME49 |
|
TGME49_210760 | TGME49_210760-t26_1 | 3 | 3 | 1 | 1409 | 133 | forward | protein coding | No | 3099 | TGME49_210760 | glutamine amidotransferase-related, putative | glutamine amidotransferase-related, putative | 7901497 | B9PVQ8 | IV | TGME49_chrIV:2,089,348..2,092,917(+) | TGME49_chrIV:2089481..2091508(+) | TGME49_chrIV | Toxoplasma gondii ME49 | 18 | OG6_107498 | 0 | 518 | 1557 | 56709 | 5.17 | 0 | | | | | GO:0016787 | hydrolase activity | GO:0006541 | glutamine metabolic process | | | | | | | | 2.4.2.- (Pentosyltransferases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_210760ORglutamine amidotransferase-related, putativeANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_210760 OR glutamine amidotransferase-related, putative AND Toxoplasma gondii ME49 |
|
TGME49_210778 | TGME49_210778-t26_1 | 15 | 15 | 1 | 57 | | forward | protein coding | No | 1887 | TGME49_210778 | hemimethylated DNA binding domain-containing protein | hemimethylated DNA binding domain-containing protein | | | IV | TGME49_chrIV:2,080,697..2,086,847(+) | TGME49_chrIV:2080697..2086790(+) | TGME49_chrIV | Toxoplasma gondii ME49 | 31 | OG6_153953 | 0 | 609 | 1830 | 68796 | 6.97 | 0 | | | | | GO:0003677 | DNA binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_210778ORhemimethylated DNA binding domain-containing proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_210778 OR hemimethylated DNA binding domain-containing protein AND Toxoplasma gondii ME49 |
|
TGME49_210781 | TGME49_210781-t26_1 | 3 | 3 | 1 | 400 | 1349 | forward | protein coding | No | 12558 | TGME49_210781 | ubiquitin carboxyl-terminal hydrolase | ubiquitin carboxyl-terminal hydrolase | 7901499 | | IV | TGME49_chrIV:2,065,477..2,078,612(+) | TGME49_chrIV:2066826..2078212(+) | TGME49_chrIV | Toxoplasma gondii ME49 | 16 | OG6_490656 | 0 | 3602 | 10809 | 372319 | 7.70 | 0 | | | | | GO:0004221;GO:0036459 | obsolete ubiquitin thiolesterase activity;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | 3.1.2.15 (Deleted entry) | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_210781ORubiquitin carboxyl-terminal hydrolaseANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_210781 OR ubiquitin carboxyl-terminal hydrolase AND Toxoplasma gondii ME49 |
|
TGME49_211330 | TGME49_211330-t26_1 | 6 | 6 | 1 | 527 | 320 | forward | protein coding | No | 2941 | TGME49_211330 | methionine aminopeptidase | methionine aminopeptidase | 7900987 | | IV | TGME49_chrIV:1,824,915..1,830,061(+) | TGME49_chrIV:1825235..1829534(+) | TGME49_chrIV | Toxoplasma gondii ME49 | 64 | OG6_100342 | 1 | 697 | 2094 | 76286 | 8.57 | 0 | | | | | GO:0004177;GO:0008235 | aminopeptidase activity;metalloexopeptidase activity | GO:0009987;GO:0006508 | cellular process;proteolysis | | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_211330ORmethionine aminopeptidaseANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_211330 OR methionine aminopeptidase AND Toxoplasma gondii ME49 |
|
TGME49_212910 | TGME49_212910-t26_1 | 12 | 12 | 1 | 72 | 108 | reverse | protein coding | No | 972 | TGME49_212910 | rhomboid protease ROM3 | rhomboid protease ROM3 | 7893621 | S8F8U9 | V | TGME49_chrV:697,358..698,954(-) | TGME49_chrV:697430..698846(-) | TGME49_chrV | Toxoplasma gondii ME49 | 52 | OG6_100562 | 1 | 263 | 792 | 29358 | 8.10 | 8 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | 3.4.21.105 (Rhomboid protease) | 3.4.21.- (Serine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_212910ORrhomboid protease ROM3ANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_212910 OR rhomboid protease ROM3 AND Toxoplasma gondii ME49 |
|
TGME49_213060 | TGME49_213060-t26_1 | 9 | 9 | 1 | 671 | 1854 | forward | protein coding | No | 11786 | TGME49_213060 | WD domain, G-beta repeat-containing protein | WD domain, G-beta repeat-containing protein | 7893636 | | V | TGME49_chrV:822,368..838,121(+) | TGME49_chrV:824222..837450(+) | TGME49_chrV | Toxoplasma gondii ME49 | 40 | OG6_100503 | 0 | 3086 | 9261 | 328236 | 6.95 | 0 | HMM: MCRLTCVITSGQPLLLAD, NN: MCRLTCVITSGQPLLLAD | NN Sum: 3, NN D: .51, HMM Prob: .52 | | | GO:0005515 | protein binding | | | | | | | | | 3.4.13.20 (Beta-Ala-His dipeptidase) | 3.4.13.20 (Beta-Ala-His dipeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_213060ORWD domain, G-beta repeat-containing proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_213060 OR WD domain, G-beta repeat-containing protein AND Toxoplasma gondii ME49 |
|
TGME49_213115 | TGME49_213115-t26_1 | 8 | 8 | 1 | 829 | 550 | forward | protein coding | No | 3587 | TGME49_213115 | hypothetical protein | hypothetical protein | 78,93,64,17,89,36,42,70 | | V | TGME49_chrV:860,657..867,251(+) | TGME49_chrV:861470..866422(+) | TGME49_chrV | Toxoplasma gondii ME49 | 18 | OG6_222901 | 0 | 735 | 2208 | 77620 | 9.74 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_213115ORhypothetical proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_213115 OR hypothetical protein AND Toxoplasma gondii ME49 |
|
TGME49_213520 | TGME49_213520-t26_1 | 9 | 9 | 1 | 1077 | 816 | reverse | protein coding | No | 3438 | TGME49_213520 | peptidase M20D, amidohydrolase | peptidase M20D, amidohydrolase | 7898969 | S7UP86 | V | TGME49_chrV:1,111,634..1,119,738(-) | TGME49_chrV:1112711..1118922(-) | TGME49_chrV | Toxoplasma gondii ME49 | 30 | OG6_101553 | 0 | 514 | 1545 | 55116 | 6.76 | 1 | HMM: MPRGGHKKMASKTFWNRGIIFLRSYSFFFLPLLAAAASSPAS, NN: MPRGGHKKMASKTFWNRGIIFLRSYSFFFLPLLAAAA | NN Sum: 3, NN D: .51, HMM Prob: .99 | | | GO:0050118;GO:0016787 | N-acetyldiaminopimelate deacetylase activity;hydrolase activity | GO:0008152 | metabolic process | | | | | | | 3.5.1.47 (N-acetyldiaminopimelate deacetylase) | 3.5.1.14 (N-acyl-aliphatic-L-amino acid amidohydrolase) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_213520ORpeptidase M20D, amidohydrolaseANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_213520 OR peptidase M20D, amidohydrolase AND Toxoplasma gondii ME49 |
|
TGME49_213620 | TGME49_213620-t26_1 | 2 | 2 | 1 | 2241 | 1505 | forward | protein coding | No | 9500 | TGME49_213620 | ABC1 family protein | ABC1 family protein | 7898931 | S8FC30 | V | TGME49_chrV:1,177,588..1,187,260(+) | TGME49_chrV:1179266..1185019(+) | TGME49_chrV | Toxoplasma gondii ME49 | 29 | OG6_100510 | 0 | 1917 | 5754 | 211215 | 7.51 | 0 | | | | | | | | | | | | | | | | 2.7.-.- (Transferring phosphorus-containing groups.) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_213620ORABC1 family proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_213620 OR ABC1 family protein AND Toxoplasma gondii ME49 |
|
TGME49_213870 | TGME49_213870-t26_1 | 13 | 13 | 1 | 976 | 484 | reverse | protein coding | No | 4676 | TGME49_213870 | UBA/TS-N domain-containing protein | UBA/TS-N domain-containing protein | 7898956 | | V | TGME49_chrV:1,388,385..1,399,518(-) | TGME49_chrV:1389361..1399034(-) | TGME49_chrV | Toxoplasma gondii ME49 | 32 | OG6_101380 | 0 | 1071 | 3216 | 117176 | 4.76 | 0 | | | | | GO:0004221;GO:0005515;GO:0036459;GO:0008270 | obsolete ubiquitin thiolesterase activity;protein binding;thiol-dependent ubiquitinyl hydrolase activity;zinc ion binding | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | 3.1.2.15 (Deleted entry) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_213870ORUBA/TS-N domain-containing proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_213870 OR UBA/TS-N domain-containing protein AND Toxoplasma gondii ME49 |
|
TGME49_214290 | TGME49_214290-t26_1 | 4 | 4 | 1 | 463 | 372 | forward | protein coding | No | 1606 | TGME49_214290 | DJ-1 family protein | DJ-1 family protein | 7896860 | S8EW18 | X | TGME49_chrX:6,216,690..6,219,352(+) | TGME49_chrX:6217062..6218889(+) | TGME49_chrX | Toxoplasma gondii ME49 | 26 | OG6_101257 | 0 | 256 | 771 | 27938 | 9.32 | 0 | HMM: MSPLGFGAFLSPLLLFCVSPHLRTGV, NN: MSPLGFGAFLSPLLLFCVSPHLRTG | NN Sum: 3, NN D: .54, HMM Prob: .99 | | | | | | | | | | | | | | 2.7.1.50 (Hydroxyethylthiazole kinase) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_214290ORDJ-1 family proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_214290 OR DJ-1 family protein AND Toxoplasma gondii ME49 |
|
TGME49_214470 | TGME49_214470-t26_1 | 13 | 13 | 1 | 1087 | 450 | reverse | protein coding | No | 3853 | TGME49_214470 | Ulp1 protease family, C-terminal catalytic domain-containing protein | Ulp1 protease family, C-terminal catalytic domain-containing protein | 7897079 | | X | TGME49_chrX:6,296,827..6,305,787(-) | TGME49_chrX:6297914..6305337(-) | TGME49_chrX | Toxoplasma gondii ME49 | 41 | OG6_101235 | 0 | 771 | 2316 | 85259 | 7.86 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.22.68 (Ulp1 peptidase) | 3.4.22.68 (Ulp1 peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_214470ORUlp1 protease family, C-terminal catalytic domain-containing proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_214470 OR Ulp1 protease family, C-terminal catalytic domain-containing protein AND Toxoplasma gondii ME49 |
|
TGME49_214490 | TGME49_214490-t26_1 | 10 | 10 | 1 | 626 | 267 | reverse | protein coding | No | 4955 | TGME49_214490 | peptidase M16 inactive domain-containing protein | peptidase M16 inactive domain-containing protein | 7900721 | S8EZF6 | X | TGME49_chrX:6,310,526..6,320,728(-) | TGME49_chrX:6311152..6320461(-) | TGME49_chrX | Toxoplasma gondii ME49 | 30 | OG6_105738 | 0 | 1353 | 4062 | 148866 | 4.99 | 0 | | | | | GO:0003824;GO:0046872;GO:0004222;GO:0008270 | catalytic activity;metal ion binding;metalloendopeptidase activity;zinc ion binding | GO:0006508 | proteolysis | | | | | | | | 3.4.24.56 (Insulysin) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_214490ORpeptidase M16 inactive domain-containing proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_214490 OR peptidase M16 inactive domain-containing protein AND Toxoplasma gondii ME49 |
|
TGME49_215010 | TGME49_215010-t26_1 | 5 | 5 | 1 | 1225 | 1596 | forward | protein coding | No | 5587 | TGME49_215010 | hypothetical protein | hypothetical protein | 7900763 | | X | TGME49_chrX:6,676,232..6,683,812(+) | TGME49_chrX:6677828..6682587(+) | TGME49_chrX | Toxoplasma gondii ME49 | 23 | OG6_492212 | 0 | 921 | 2766 | 97320 | 8.05 | 6 | HMM: MYFCPTYIYIYIYICMYICVSPSLFMLVCASLYLLVVLVLPPCFSR, NN: MYFCPTYIYIYIYICMYICVSPSLFMLVCASLYLLVVLVLPPCFSR | NN Sum: 3, NN D: .62, HMM Prob: 0 | | | GO:0008233 | peptidase activity | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_215010ORhypothetical proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_215010 OR hypothetical protein AND Toxoplasma gondii ME49 |
|
TGME49_216020 | TGME49_216020-t26_1 | 7 | 7 | 1 | 721 | 666 | forward | protein coding | No | 3949 | TGME49_216020 | peptidase family c78 protein | peptidase family c78 protein | 7897096 | B9Q0L1 | XI | TGME49_chrXI:6,461,391..6,467,320(+) | TGME49_chrXI:6462057..6466599(+) | TGME49_chrXI | Toxoplasma gondii ME49 | 25 | OG6_102601 | 0 | 853 | 2562 | 91763 | 6.84 | 0 | HMM: MATARSPAIRIDWKLAAFLRHLRSQLILRRDSLSSPFLAVLVGVPLSSAS, NN: MATARSPAIRIDWKLAAFLRHLRSQLILRRDSLSSPFLAVLVGVPLSSAS | NN Sum: 1, NN D: .17, HMM Prob: .9 | | | | | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_216020ORpeptidase family c78 proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_216020 OR peptidase family c78 protein AND Toxoplasma gondii ME49 |
|
TGME49_216150 | TGME49_216150-t26_1 | 8 | 8 | 1 | 538 | 85 | forward | protein coding | No | 2144 | TGME49_216150 | peptidase family M3 protein | peptidase family M3 protein | 7897109 | | XI | TGME49_chrXI:6,376,866..6,381,856(+) | TGME49_chrXI:6376951..6381318(+) | TGME49_chrXI | Toxoplasma gondii ME49 | 44 | OG6_110341 | 1 | 506 | 1521 | 56610 | 5.63 | 0 | | | | | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_216150ORpeptidase family M3 proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_216150 OR peptidase family M3 protein AND Toxoplasma gondii ME49 |
|
TGME49_216155 | TGME49_216155-t26_1 | 5 | 5 | 1 | 324 | 1453 | forward | protein coding | No | 2203 | TGME49_216155 | hypothetical protein | hypothetical protein | | | XI | TGME49_chrXI:6,373,662..6,376,903(+) | TGME49_chrXI:6375773..6376513(+) | TGME49_chrXI | Toxoplasma gondii ME49 | 14 | OG6_491539 | 0 | 141 | 426 | 16312 | 5.10 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_216155ORhypothetical proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_216155 OR hypothetical protein AND Toxoplasma gondii ME49 |
|
TGME49_216440 | TGME49_216440-t26_1 | 2 | 2 | 1 | 817 | 1164 | reverse | protein coding | No | 3823 | TGME49_216440 | OTU family cysteine protease | OTU family cysteine protease | 7898470 | B6KT23 | XI | TGME49_chrXI:6,143,198..6,147,596(-) | TGME49_chrXI:6144015..6146432(-) | TGME49_chrXI | Toxoplasma gondii ME49 | 15 | OG6_100428 | 0 | 613 | 1842 | 68134 | 10.11 | 1 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_216440OROTU family cysteine proteaseANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_216440 OR OTU family cysteine protease AND Toxoplasma gondii ME49 |
|
TGME49_216450 | TGME49_216450-t26_1 | 4 | 4 | 1 | 621 | 758 | forward | protein coding | No | 2162 | TGME49_216450 | peptidase, T1 family protein | peptidase, T1 family protein | 7898471 | B6KT24 | XI | TGME49_chrXI:6,138,532..6,142,565(+) | TGME49_chrXI:6139290..6141944(+) | TGME49_chrXI | Toxoplasma gondii ME49 | 24 | OG6_102011 | 0 | 260 | 783 | 27938 | 4.86 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_216450ORpeptidase, T1 family proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_216450 OR peptidase, T1 family protein AND Toxoplasma gondii ME49 |
|
TGME49_217160 | TGME49_217160-t26_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 639 | TGME49_217160 | Der1 family protein | Der1 family protein | 7893593 | | XI | TGME49_chrXI:5,697,992..5,699,353(-) | TGME49_chrXI:5697992..5699353(-) | TGME49_chrXI | Toxoplasma gondii ME49 | 27 | OG6_101672 | 0 | 212 | 639 | 24705 | 8.86 | 5 | HMM: MAQVDLFFSHLPPVTRFYLFCSTALMLLCTLEIVSPF, NN: MAQVDLFFSHLPPVTRFYLFCSTALMLLCTLEIVSPF | NN Sum: 3, NN D: .56, HMM Prob: .55 | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_217160ORDer1 family proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_217160 OR Der1 family protein AND Toxoplasma gondii ME49 |
|
TGME49_218540 | TGME49_218540-t26_1 | 5 | 5 | 1 | 520 | 282 | reverse | protein coding | No | 2041 | TGME49_218540 | peptidase S15, putative | peptidase S15, putative | 7893524 | S8EN43 | XII | TGME49_chrXII:1,469,873..1,474,479(-) | TGME49_chrXII:1470393..1474197(-) | TGME49_chrXII | Toxoplasma gondii ME49 | 27 | OG6_116896 | 0 | 412 | 1239 | 45091 | 9.16 | 1 | HMM: MGFSSSNWSWAGLGCGLLALAILLPPDPGL, NN: MGFSSSNWSWAGLGCGLLALAI | NN Sum: 3, NN D: .59, HMM Prob: .8 | | | | | | | | | | | | | | 2.3.-.- (Acyltransferases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_218540ORpeptidase S15, putativeANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_218540 OR peptidase S15, putative AND Toxoplasma gondii ME49 |
|
TGME49_218560 | TGME49_218560-t26_1 | 40 | 40 | 1 | 1689 | 1538 | reverse | protein coding | No | 13427 | TGME49_218560 | acetyl-coA carboxylase ACC2 | acetyl-coA carboxylase ACC2 | 7893525 | S8EUN2 | XII | TGME49_chrXII:1,425,733..1,457,806(-) | TGME49_chrXII:1427422..1456268(-) | TGME49_chrXII | Toxoplasma gondii ME49 | 84 | OG6_101052 | 1 | 3399 | 10200 | 365031 | 6.82 | 0 | | | | | GO:0005524;GO:0008716;GO:0003989;GO:0003824;GO:0016874;GO:0046872;GO:0004658 | ATP binding;D-alanine-D-alanine ligase activity;acetyl-CoA carboxylase activity;catalytic activity;ligase activity;metal ion binding;propionyl-CoA carboxylase activity | GO:0006633;GO:0008152 | fatty acid biosynthetic process;metabolic process | GO:0005737 | cytoplasm | | | | | 6.4.1.2 (Acetyl-CoA carboxylase);6.4.1.3 (Propionyl-CoA carboxylase) | 6.4.1.2 (Acetyl-CoA carboxylase) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_218560ORacetyl-coA carboxylase ACC2ANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_218560 OR acetyl-coA carboxylase ACC2 AND Toxoplasma gondii ME49 |
|
TGME49_218920 | TGME49_218920-t26_1 | 10 | 10 | 1 | 551 | 644 | forward | protein coding | No | 2125 | TGME49_218920 | proteasome subunit beta type, putative | proteasome subunit beta type, putative | 7893551 | B9PQJ5 | XII | TGME49_chrXII:1,211,403..1,217,325(+) | TGME49_chrXII:1212047..1216774(+) | TGME49_chrXII | Toxoplasma gondii ME49 | 27 | OG6_100897 | 0 | 309 | 930 | 33757 | 6.67 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_218920ORproteasome subunit beta type, putativeANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_218920 OR proteasome subunit beta type, putative AND Toxoplasma gondii ME49 |
|
TGME49_219485 | TGME49_219485-t26_1 | 4 | 4 | 1 | 705 | 974 | reverse | protein coding | No | 8687 | TGME49_219485 | hypothetical protein | hypothetical protein | 7,89,35,87,78,93,588 | | XII | TGME49_chrXII:909,925..920,726(-) | TGME49_chrXII:910630..919752(-) | TGME49_chrXII | Toxoplasma gondii ME49 | 17 | OG6_490012 | 0 | 2335 | 7008 | 255029 | 6.75 | 0 | | | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_219485ORhypothetical proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_219485 OR hypothetical protein AND Toxoplasma gondii ME49 |
|
TGME49_221170 | TGME49_221170-t26_1 | 6 | 6 | 1 | 300 | 646 | forward | protein coding | No | 2245 | TGME49_221170 | CAAX metallo endopeptidase | CAAX metallo endopeptidase | 7895232 | S7ULH4 | II | TGME49_chrII:102,411..107,434(+) | TGME49_chrII:103057..107134(+) | TGME49_chrII | Toxoplasma gondii ME49 | 37 | OG6_101632 | 0 | 432 | 1299 | 49431 | 7.35 | 5 | | | GO:0016020 | membrane | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.24.84 (Ste24 endopeptidase) | 3.4.24.84 (Ste24 endopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_221170ORCAAX metallo endopeptidaseANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_221170 OR CAAX metallo endopeptidase AND Toxoplasma gondii ME49 |
|
TGME49_221310 | TGME49_221310-t26_1 | 11 | 11 | 1 | 673 | 476 | reverse | protein coding | No | 4359 | TGME49_221310 | aminopeptidase N protein | aminopeptidase N protein | 7899956 | | II | TGME49_chrII:225,609..234,262(-) | TGME49_chrII:226282..233786(-) | TGME49_chrII | Toxoplasma gondii ME49 | 110 | OG6_106799 | 2 | 1069 | 3210 | 121298 | 8.14 | 0 | | | | | GO:0008237;GO:0008270 | metallopeptidase activity;zinc ion binding | | | | | | | | | 3.4.11.2 (Membrane alanyl aminopeptidase) | 3.4.11.2 (Membrane alanyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_221310ORaminopeptidase N proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_221310 OR aminopeptidase N protein AND Toxoplasma gondii ME49 |
|
TGME49_221320 | TGME49_221320-t26_1 | 16 | 16 | 1 | 1836 | 674 | reverse | protein coding | No | 10349 | TGME49_221320 | acetyl-CoA carboxylase ACC1 | acetyl-CoA carboxylase ACC1 | 7895246 | | II | TGME49_chrII:234,389..252,960(-) | TGME49_chrII:236225..252286(-) | TGME49_chrII | Toxoplasma gondii ME49 | 84 | OG6_101052 | 1 | 2612 | 7839 | 287679 | 7.50 | 1 | HMM: MPIRTHARVRSVCTMGVVSRAAAA, NN: MPIRTHARVRSVCTMGVVSRAAAA | NN Sum: 3, NN D: .49, HMM Prob: .96 | | | GO:0005524;GO:0008716;GO:0003989;GO:0003824;GO:0016874;GO:0046872;GO:0004658 | ATP binding;D-alanine-D-alanine ligase activity;acetyl-CoA carboxylase activity;catalytic activity;ligase activity;metal ion binding;propionyl-CoA carboxylase activity | GO:0006633;GO:0008152 | fatty acid biosynthetic process;metabolic process | GO:0020011 | apicoplast | | | | | 6.4.1.2 (Acetyl-CoA carboxylase);6.4.1.3 (Propionyl-CoA carboxylase) | 6.4.1.2 (Acetyl-CoA carboxylase) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_221320ORacetyl-CoA carboxylase ACC1ANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_221320 OR acetyl-CoA carboxylase ACC1 AND Toxoplasma gondii ME49 |
|
TGME49_221450 | TGME49_221450-t26_1 | 8 | 8 | 1 | 1045 | 419 | forward | protein coding | No | 3030 | TGME49_221450 | SPRY domain-containing protein | SPRY domain-containing protein | 7895259 | | II | TGME49_chrII:356,803..363,136(+) | TGME49_chrII:357222..362091(+) | TGME49_chrII | Toxoplasma gondii ME49 | 82 | OG6_102272 | 2 | 521 | 1566 | 56593 | 9.29 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_221450ORSPRY domain-containing proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_221450 OR SPRY domain-containing protein AND Toxoplasma gondii ME49 |
|
TGME49_221610 | TGME49_221610-t26_1 | 6 | 6 | 1 | 492 | 4263 | forward | protein coding | No | 7143 | TGME49_221610 | ubiquitin carboxyl-terminal hydrolase | ubiquitin carboxyl-terminal hydrolase | 7895275 | | II | TGME49_chrII:477,178..486,237(+) | TGME49_chrII:481441..485745(+) | TGME49_chrII | Toxoplasma gondii ME49 | 18 | OG6_103260 | 0 | 795 | 2388 | 87236 | 7.71 | 0 | | | | | GO:0004221;GO:0036459 | obsolete ubiquitin thiolesterase activity;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | 3.1.2.15 (Deleted entry) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_221610ORubiquitin carboxyl-terminal hydrolaseANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_221610 OR ubiquitin carboxyl-terminal hydrolase AND Toxoplasma gondii ME49 |
|
TGME49_221670 | TGME49_221670-t26_1 | 19 | 19 | 1 | 1122 | 1658 | reverse | protein coding | No | 6377 | TGME49_221670 | transcriptional elongation factor FACT140 | transcriptional elongation factor FACT140 | 7895281 | S7ULL0 | II | TGME49_chrII:537,012..553,077(-) | TGME49_chrII:538134..551419(-) | TGME49_chrII | Toxoplasma gondii ME49 | 31 | OG6_102309 | 0 | 1198 | 3597 | 134597 | 4.85 | 0 | | | | | | | GO:0009987 | cellular process | | | | | | | | 1.1.1.27 (L-lactate dehydrogenase) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_221670ORtranscriptional elongation factor FACT140ANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_221670 OR transcriptional elongation factor FACT140 AND Toxoplasma gondii ME49 |
|
TGME49_221830 | TGME49_221830-t26_1 | 12 | 12 | 1 | | | reverse | protein coding | No | 5838 | TGME49_221830 | subtilisin SUB12 | subtilisin SUB12 | 7895287 | S8GTW7 | II | TGME49_chrII:609,242..622,525(-) | TGME49_chrII:609242..622525(-) | TGME49_chrII | Toxoplasma gondii ME49 | 72 | OG6_100121 | 1 | 1945 | 5838 | 209633 | 4.96 | 0 | | | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.21.66 (Thermitase) | 3.4.21.66 (Thermitase) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_221830ORsubtilisin SUB12ANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_221830 OR subtilisin SUB12 AND Toxoplasma gondii ME49 |
|
TGME49_222860 | TGME49_222860-t26_1 | 18 | 18 | 1 | 1013 | 543 | reverse | protein coding | No | 3827 | TGME49_222860 | eukaryotic translation initiation factor, putative | eukaryotic translation initiation factor, putative | 7895678 | B9PYW7 | II | TGME49_chrII:1,258,625..1,271,652(-) | TGME49_chrII:1259638..1271109(-) | TGME49_chrII | Toxoplasma gondii ME49 | 35 | OG6_101924 | 0 | 756 | 2271 | 88391 | 5.17 | 0 | | | GO:0005852 | eukaryotic translation initiation factor 3 complex | GO:0003723;GO:0003676;GO:0003743;GO:0031369 | RNA binding;nucleic acid binding;translation initiation factor activity;translation initiation factor binding | GO:0006413 | translational initiation | | | | | | | | 3.6.3.14 (Transferred entry: 7.1.2.2) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_222860OReukaryotic translation initiation factor, putativeANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_222860 OR eukaryotic translation initiation factor, putative AND Toxoplasma gondii ME49 |
|
TGME49_223450 | TGME49_223450-t26_1 | 6 | 6 | 1 | 2387 | 1880 | reverse | protein coding | No | 11452 | TGME49_223450 | ubiquitin carboxyl-terminal hydrolase | ubiquitin carboxyl-terminal hydrolase | 7896356 | | X | TGME49_chrX:3,824,771..3,839,375(-) | TGME49_chrX:3827158..3837495(-) | TGME49_chrX | Toxoplasma gondii ME49 | 20 | OG6_164734 | 0 | 2394 | 7185 | 258492 | 8.64 | 0 | | | | | GO:0004221;GO:0036459 | obsolete ubiquitin thiolesterase activity;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | 3.1.2.15 (Deleted entry) | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_223450ORubiquitin carboxyl-terminal hydrolaseANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_223450 OR ubiquitin carboxyl-terminal hydrolase AND Toxoplasma gondii ME49 |
|
TGME49_223510 | TGME49_223510-t26_1 | 7 | 7 | 1 | 1018 | 1403 | reverse | protein coding | No | 3780 | TGME49_223510 | hypothetical protein | hypothetical protein | 7896386 | S5Y8U5 | X | TGME49_chrX:3,764,641..3,770,663(-) | TGME49_chrX:3765659..3769260(-) | TGME49_chrX | Toxoplasma gondii ME49 | 62 | OG6_100915 | 1 | 452 | 1359 | 49382 | 8.13 | 0 | | | | | | | | | | | | | | | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_223510ORhypothetical proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_223510 OR hypothetical protein AND Toxoplasma gondii ME49 |
|
TGME49_223590 | TGME49_223590-t26_1 | 2 | 2 | 1 | 454 | 154 | reverse | protein coding | No | 1718 | TGME49_223590 | proteasome subunit | proteasome subunit | 7896369 | | X | TGME49_chrX:3,721,847..3,723,788(-) | TGME49_chrX:3722301..3723634(-) | TGME49_chrX | Toxoplasma gondii ME49 | 26 | OG6_101390 | 0 | 369 | 1110 | 39397 | 8.74 | 0 | HMM: MKNYRCERFSCLLFACAVCPSTLR, NN: MKNYRCERFSCLLFACAVCPSTLRKHQVTFCGIWSRFELVVFAA | NN Sum: 0, NN D: .37, HMM Prob: .69 | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_223590ORproteasome subunitANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_223590 OR proteasome subunit AND Toxoplasma gondii ME49 |
|
TGME49_223960 | TGME49_223960-t26_1 | 7 | 7 | 1 | 783 | 789 | reverse | protein coding | No | 2739 | TGME49_223960 | ubiquitin interaction motif family protein | ubiquitin interaction motif family protein | 7896378 | B9PM09 | X | TGME49_chrX:3,424,021..3,429,743(-) | TGME49_chrX:3424804..3428954(-) | TGME49_chrX | Toxoplasma gondii ME49 | 35 | OG6_102002 | 0 | 388 | 1167 | 41376 | 4.23 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_223960ORubiquitin interaction motif family proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_223960 OR ubiquitin interaction motif family protein AND Toxoplasma gondii ME49 |
|
TGME49_224090 | TGME49_224090-t26_1 | 6 | 6 | 1 | 3098 | 644 | forward | protein coding | No | 5413 | TGME49_224090 | enoyl-CoA hydratase/isomerase family protein | enoyl-CoA hydratase/isomerase family protein | 7898228 | | X | TGME49_chrX:3,326,428..3,333,931(+) | TGME49_chrX:3327072..3330833(+) | TGME49_chrX | Toxoplasma gondii ME49 | 31 | OG6_102025 | 0 | 556 | 1671 | 59225 | 6.26 | 0 | HMM: MATGSSRRLLRLSTHLSEVVRAR, NN: MATGSSRRLLRLSTHLSEVVRAR | NN Sum: 1, NN D: .2, HMM Prob: .62 | | | GO:0003860;GO:0003824 | 3-hydroxyisobutyryl-CoA hydrolase activity;catalytic activity | GO:0008152 | metabolic process | | | | | | | 3.1.2.4 (3-hydroxyisobutyryl-CoA hydrolase) | 3.1.2.4 (3-hydroxyisobutyryl-CoA hydrolase) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_224090ORenoyl-CoA hydratase/isomerase family proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_224090 OR enoyl-CoA hydratase/isomerase family protein AND Toxoplasma gondii ME49 |
|
TGME49_224350 | TGME49_224350-t26_1 | 11 | 11 | 1 | 547 | 1341 | reverse | protein coding | No | 6148 | TGME49_224350 | aminopeptidase N, putative | aminopeptidase N, putative | 7897662 | S8G5K8 | X | TGME49_chrX:3,062,276..3,073,347(-) | TGME49_chrX:3062823..3072006(-) | TGME49_chrX | Toxoplasma gondii ME49 | 110 | OG6_106799 | 2 | 1419 | 4260 | 156759 | 8.14 | 1 | | | | | GO:0008237;GO:0008270 | metallopeptidase activity;zinc ion binding | | | | | | | | | 3.4.11.2 (Membrane alanyl aminopeptidase) | 3.4.11.2 (Membrane alanyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_224350ORaminopeptidase N, putativeANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_224350 OR aminopeptidase N, putative AND Toxoplasma gondii ME49 |
|
TGME49_224460 | TGME49_224460-t26_1 | 10 | 10 | 1 | 428 | 562 | forward | protein coding | No | 3903 | TGME49_224460 | aminopeptidase n, putative | aminopeptidase n, putative | 7895435 | S8EU57 | X | TGME49_chrX:3,052,826..3,061,802(+) | TGME49_chrX:3053388..3061374(+) | TGME49_chrX | Toxoplasma gondii ME49 | 110 | OG6_106799 | 2 | 970 | 2913 | 108716 | 5.71 | 0 | HMM: MVTLSATTMNATVSPCRISGGVSSRLCGWGVLSFLLASVITVQVSRAG, NN: MVTLSATTMNATVSPCRISGGVSSRLCGWGVLSFLLASVITVQVSRAG | NN Sum: 1, NN D: .3, HMM Prob: .86 | | | GO:0008237;GO:0008270 | metallopeptidase activity;zinc ion binding | | | | | | | | | 3.4.11.2 (Membrane alanyl aminopeptidase) | 3.4.11.2 (Membrane alanyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_224460ORaminopeptidase n, putativeANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_224460 OR aminopeptidase n, putative AND Toxoplasma gondii ME49 |
|
TGME49_225580 | TGME49_225580-t26_1 | 3 | 3 | 1 | 190 | 922 | forward | protein coding | No | 1847 | TGME49_225580 | proteasome (prosome, macropain) 26S subunit, non-ATPase, 9, putative | proteasome (prosome, macropain) 26S subunit, non-ATPase, 9, putative | 7895079 | | X | TGME49_chrX:2,144,605..2,147,321(+) | TGME49_chrX:2145527..2147131(+) | TGME49_chrX | Toxoplasma gondii ME49 | 27 | OG6_102356 | 0 | 244 | 735 | 26650 | 4.66 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_225580ORproteasome (prosome, macropain) 26S subunit, non-ATPase, 9, putativeANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_225580 OR proteasome (prosome, macropain) 26S subunit, non-ATPase, 9, putative AND Toxoplasma gondii ME49 |
|
TGME49_225850 | TGME49_225850-t26_1 | 11 | 11 | 1 | 522 | 425 | forward | protein coding | No | 5615 | TGME49_225850 | peptidase, M28 family protein | peptidase, M28 family protein | 7896334 | S8F0T7 | X | TGME49_chrX:1,998,100..2,009,906(+) | TGME49_chrX:1998525..2009384(+) | TGME49_chrX | Toxoplasma gondii ME49 | 26 | OG6_101747 | 0 | 1555 | 4668 | 167668 | 9.13 | 9 | | | | | GO:0008233 | peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_225850ORpeptidase, M28 family proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_225850 OR peptidase, M28 family protein AND Toxoplasma gondii ME49 |
|
TGME49_226390 | TGME49_226390-t26_1 | 1 | 1 | 1 | 1297 | 482 | forward | protein coding | No | 4779 | TGME49_226390 | hypothetical protein | hypothetical protein | 7897593 | S8GFB8 | X | TGME49_chrX:1,665,302..1,670,080(+) | TGME49_chrX:1665784..1668783(+) | TGME49_chrX | Toxoplasma gondii ME49 | 26 | OG6_490279 | 0 | 999 | 3000 | 108161 | 7.67 | 0 | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_226390ORhypothetical proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_226390 OR hypothetical protein AND Toxoplasma gondii ME49 |
|
TGME49_226420 | TGME49_226420-t26_1 | 11 | 11 | 1 | 456 | 606 | forward | protein coding | No | 3066 | TGME49_226420 | peptidase family M3 protein | peptidase family M3 protein | 7897596 | S8EXL9 | X | TGME49_chrX:1,647,517..1,655,623(+) | TGME49_chrX:1648123..1655167(+) | TGME49_chrX | Toxoplasma gondii ME49 | 44 | OG6_110341 | 1 | 667 | 2004 | 75363 | 7.49 | 0 | HMM: MISPVASVFSTMPHWKQGARLHAPGGRFTFAARIYLFLLLSCLGFSCSGE, NN: MISPVASVFSTMPHWKQGARLHAPGGRFTFAARIYLFLLLSCLGF | NN Sum: 2, NN D: .32, HMM Prob: .97 | | | GO:0004222;GO:0008237;GO:0008270 | metalloendopeptidase activity;metallopeptidase activity;zinc ion binding | GO:0006508 | proteolysis | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_226420ORpeptidase family M3 proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_226420 OR peptidase family M3 protein AND Toxoplasma gondii ME49 |
|
TGME49_226920 | TGME49_226920-t26_1 | 2 | 2 | 1 | 1009 | 582 | forward | protein coding | No | 4558 | TGME49_226920 | hypothetical protein | hypothetical protein | 7897599 | S8F115 | X | TGME49_chrX:1,223,137..1,228,342(+) | TGME49_chrX:1223719..1227333(+) | TGME49_chrX | Toxoplasma gondii ME49 | 19 | OG6_223067 | 0 | 988 | 2967 | 106274 | 7.48 | 1 | HMM: MEKRIFSTRLPRLSPLTSRTRSPLFALVFLLLCAALCIFSLALRRSSAVRTLHLEASLAAAH, NN: MEKRIFSTRLPRLSPLTSRTRSPLFALVFLLLCAALCIFSLALRRSSAV | NN Sum: 3, NN D: .46, HMM Prob: .29 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_226920ORhypothetical proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_226920 OR hypothetical protein AND Toxoplasma gondii ME49 |
|
TGME49_226940 | TGME49_226940-t26_1 | 3 | 3 | 1 | 988 | 441 | reverse | protein coding | No | 4528 | TGME49_226940 | ubiquitin carboxyl-terminal hydrolase | ubiquitin carboxyl-terminal hydrolase | 7897601 | | X | TGME49_chrX:1,213,281..1,219,123(-) | TGME49_chrX:1214269..1218682(-) | TGME49_chrX | Toxoplasma gondii ME49 | 27 | OG6_200960 | 0 | 1032 | 3099 | 113101 | 6.92 | 0 | | | | | GO:0004221;GO:0036459 | obsolete ubiquitin thiolesterase activity;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | 3.1.2.15 (Deleted entry) | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_226940ORubiquitin carboxyl-terminal hydrolaseANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_226940 OR ubiquitin carboxyl-terminal hydrolase AND Toxoplasma gondii ME49 |
|
TGME49_227370 | TGME49_227370-t26_1 | 9 | 9 | 1 | 337 | 224 | reverse | protein coding | No | 4344 | TGME49_227370 | hydrolase CocE/NonD family protein | hydrolase CocE/NonD family protein | 7896136 | | X | TGME49_chrX:977,455..985,515(-) | TGME49_chrX:977792..985291(-) | TGME49_chrX | Toxoplasma gondii ME49 | 29 | OG6_124529 | 0 | 1260 | 3783 | 140635 | 9.28 | 3 | HMM: MRFVSRILAVACCLSLFITVTAF, NN: MRFVSRILAVACCLSLFITVTAF | NN Sum: 4, NN D: .75, HMM Prob: .92 | | | GO:0004177;GO:0008239;GO:0016787 | aminopeptidase activity;dipeptidyl-peptidase activity;hydrolase activity | GO:0006508 | proteolysis | | | | | | | | 3.1.1.- (Carboxylic ester hydrolases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_227370ORhydrolase CocE/NonD family proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_227370 OR hydrolase CocE/NonD family protein AND Toxoplasma gondii ME49 |
|
TGME49_227948 | TGME49_227948-t26_1 | 13 | 13 | 1 | 1323 | 1127 | forward | protein coding | No | 6371 | TGME49_227948 | peptidase M16 inactive domain-containing protein | peptidase M16 inactive domain-containing protein | 7897628 | | X | TGME49_chrX:715,237..727,811(+) | TGME49_chrX:716364..726488(+) | TGME49_chrX | Toxoplasma gondii ME49 | 49 | OG6_101809 | 0 | 1306 | 3921 | 142762 | 6.80 | 0 | HMM: MRFSVVSAPMATPSTATGS, NN: MRFSVVSAPMATPSTATGS | NN Sum: 1, NN D: .19, HMM Prob: .9 | | | GO:0003824;GO:0046872;GO:0004222;GO:0008237;GO:0008270 | catalytic activity;metal ion binding;metalloendopeptidase activity;metallopeptidase activity;zinc ion binding | GO:0006508 | proteolysis | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_227948ORpeptidase M16 inactive domain-containing proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_227948 OR peptidase M16 inactive domain-containing protein AND Toxoplasma gondii ME49 |
|
TGME49_227952 | TGME49_227952-t26_1 | 5 | 5 | 1 | 1605 | 1476 | forward | protein coding | No | 4350 | TGME49_227952 | 14-3-3 superfamily protein | 14-3-3 superfamily protein | | | X | TGME49_chrX:709,787..716,046(+) | TGME49_chrX:711263..714441(+) | TGME49_chrX | Toxoplasma gondii ME49 | 21 | OG6_490121 | 0 | 422 | 1269 | 47992 | 9.94 | 0 | HMM: MSISLATLPLAGGLAV, NN: MSISLATLPLAGGLAV | NN Sum: 1, NN D: .33, HMM Prob: .99 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_227952OR14-3-3 superfamily proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_227952 OR 14-3-3 superfamily protein AND Toxoplasma gondii ME49 |
|
TGME49_228190 | TGME49_228190-t26_1 | 3 | 3 | 1 | 1454 | 719 | forward | protein coding | No | 3214 | TGME49_228190 | eukaryotic initiation factor-3, subunit 5, putative | eukaryotic initiation factor-3, subunit 5, putative | 7896149 | B9PN38 | X | TGME49_chrX:504,300..508,704(+) | TGME49_chrX:505019..507250(+) | TGME49_chrX | Toxoplasma gondii ME49 | 29 | OG6_103242 | 0 | 346 | 1041 | 38069 | 6.51 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_228190OReukaryotic initiation factor-3, subunit 5, putativeANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_228190 OR eukaryotic initiation factor-3, subunit 5, putative AND Toxoplasma gondii ME49 |
|
TGME49_228210 | TGME49_228210-t26_1 | 10 | 10 | 1 | 179 | 744 | reverse | protein coding | No | 2120 | TGME49_228210 | 26S proteasome regulatory subunit | 26S proteasome regulatory subunit | 7895390 | S8G6I9 | X | TGME49_chrX:486,596..494,065(-) | TGME49_chrX:486775..493321(-) | TGME49_chrX | Toxoplasma gondii ME49 | 39 | OG6_101751 | 0 | 398 | 1197 | 44454 | 7.37 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016887;GO:0009378;GO:0016787;GO:0008568 | ATP binding;ATPase activity;four-way junction helicase activity;hydrolase activity;microtubule-severing ATPase activity | GO:0006310;GO:0006281;GO:0030163 | DNA recombination;DNA repair;protein catabolic process | | | | | | | 3.6.4.3 (Transferred entry: 5.6.1.1) | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_228210OR26S proteasome regulatory subunitANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_228210 OR 26S proteasome regulatory subunit AND Toxoplasma gondii ME49 |
|
TGME49_229030 | TGME49_229030-t26_1 | 7 | 7 | 1 | | 893 | forward | protein coding | No | 1580 | TGME49_229030 | hypothetical protein | hypothetical protein | 7894320 | S8GKQ0 | VIII | TGME49_chrVIII:39,665..43,844(+) | TGME49_chrVIII:40837..43844(+) | TGME49_chrVIII | Toxoplasma gondii ME49 | 23 | OG6_137524 | 0 | 228 | 687 | 25423 | 5.00 | 2 | | | GO:0016021;GO:0005787 | integral component of membrane;signal peptidase complex | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | | | | | | | | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_229030ORhypothetical proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_229030 OR hypothetical protein AND Toxoplasma gondii ME49 |
|
TGME49_229650 | TGME49_229650-t26_1 | 9 | 9 | 1 | 105 | | reverse | protein coding | No | 1344 | TGME49_229650 | josephin protein | josephin protein | 7900613 | B9PHR9 | VIII | TGME49_chrVIII:361,708..367,389(-) | TGME49_chrVIII:361813..367389(-) | TGME49_chrVIII | Toxoplasma gondii ME49 | 26 | OG6_104644 | 0 | 412 | 1239 | 46795 | 5.30 | 0 | | | | | GO:0008242;GO:0005515;GO:0004843 | omega peptidase activity;protein binding;thiol-dependent ubiquitin-specific protease activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_229650ORjosephin proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_229650 OR josephin protein AND Toxoplasma gondii ME49 |
|
TGME49_229710 | TGME49_229710-t26_1 | 1 | 1 | 1 | 558 | | reverse | protein coding | No | 3522 | TGME49_229710 | OTU family cysteine protease | OTU family cysteine protease | 7898912 | | VIII | TGME49_chrVIII:391,434..394,955(-) | TGME49_chrVIII:391992..394955(-) | TGME49_chrVIII | Toxoplasma gondii ME49 | 25 | OG6_104209 | 0 | 987 | 2964 | 106708 | 6.34 | 1 | HMM: MYAHLAFLLLGVLLLSLPLFLFSR, NN: MYAHLAFLLLGVLLLSLPLFLFSR | NN Sum: 4, NN D: .72, HMM Prob: .99 | | | | | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_229710OROTU family cysteine proteaseANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_229710 OR OTU family cysteine protease AND Toxoplasma gondii ME49 |
|
TGME49_229950 | TGME49_229950-t26_1 | 10 | 10 | 1 | 184 | 739 | forward | protein coding | No | 2153 | TGME49_229950 | 26S proteasome regulatory subunit 6b, putative | 26S proteasome regulatory subunit 6b, putative | 7900617 | B9PHK0 | VIII | TGME49_chrVIII:485,081..492,213(+) | TGME49_chrVIII:485820..492029(+) | TGME49_chrVIII | Toxoplasma gondii ME49 | 30 | OG6_101965 | 0 | 409 | 1230 | 46093 | 5.98 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016887;GO:0009378;GO:0016787;GO:0008568 | ATP binding;ATPase activity;four-way junction helicase activity;hydrolase activity;microtubule-severing ATPase activity | GO:0006310;GO:0006281;GO:0030163 | DNA recombination;DNA repair;protein catabolic process | | | | | | | 3.6.4.3 (Transferred entry: 5.6.1.1) | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_229950OR26S proteasome regulatory subunit 6b, putativeANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_229950 OR 26S proteasome regulatory subunit 6b, putative AND Toxoplasma gondii ME49 |
|
TGME49_231060 | TGME49_231060-t26_1 | 3 | 3 | 1 | 437 | 87 | reverse | protein coding | No | 1925 | TGME49_231060 | subtilisin SUB9 | subtilisin SUB9 | 7898848 | | VIII | TGME49_chrVIII:1,216,998..1,219,590(-) | TGME49_chrVIII:1217435..1219171(-) | TGME49_chrVIII | Toxoplasma gondii ME49 | 25 | OG6_105356 | 0 | 466 | 1401 | 49791 | 4.92 | 0 | | | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.21.66 (Thermitase) | 3.4.21.66 (Thermitase) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_231060ORsubtilisin SUB9ANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_231060 OR subtilisin SUB9 AND Toxoplasma gondii ME49 |
|
TGME49_231130 | TGME49_231130-t26_1 | 11 | 11 | 1 | | | forward | protein coding | No | 2136 | TGME49_231130 | hypothetical protein | hypothetical protein | 7898904 | | VIII | TGME49_chrVIII:1,255,324..1,261,984(+) | TGME49_chrVIII:1255324..1261984(+) | TGME49_chrVIII | Toxoplasma gondii ME49 | 32 | OG6_104880 | 0 | 711 | 2136 | 77124 | 8.35 | 3 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_231130ORhypothetical proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_231130 OR hypothetical protein AND Toxoplasma gondii ME49 |
|
TGME49_231900 | TGME49_231900-t26_1 | 8 | 8 | 1 | 642 | | reverse | protein coding | No | 2007 | TGME49_231900 | acyl-CoA dehydrogenase domain-containing protein | acyl-CoA dehydrogenase domain-containing protein | 7899813 | B6KJN8 | VIII | TGME49_chrVIII:1,623,217..1,627,854(-) | TGME49_chrVIII:1623859..1627854(-) | TGME49_chrVIII | Toxoplasma gondii ME49 | 29 | OG6_101810 | 0 | 454 | 1365 | 49571 | 8.26 | 0 | | | | | GO:0003995;GO:0050660;GO:0004361;GO:0016491;GO:0016627 | acyl-CoA dehydrogenase activity;flavin adenine dinucleotide binding;glutaryl-CoA dehydrogenase activity;oxidoreductase activity;oxidoreductase activity, acting on the CH-CH group of donors | GO:0055114 | oxidation-reduction process | | | | | | | 1.3.8.6 (Glutaryl-CoA dehydrogenase (ETF)) | 1.3.8.6 (Glutaryl-CoA dehydrogenase (ETF)) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_231900ORacyl-CoA dehydrogenase domain-containing proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_231900 OR acyl-CoA dehydrogenase domain-containing protein AND Toxoplasma gondii ME49 |
|
TGME49_232060 | TGME49_232060-t26_1 | 8 | 8 | 1 | 358 | | forward | protein coding | No | 1768 | TGME49_232060 | hypothetical protein | hypothetical protein | 7900633 | B6KJQ4 | VIII | TGME49_chrVIII:1,801,590..1,806,999(+) | TGME49_chrVIII:1801590..1806641(+) | TGME49_chrVIII | Toxoplasma gondii ME49 | 21 | OG6_123077 | 0 | 469 | 1410 | 48556 | 5.21 | 0 | | | | | | | | | | | | | | | | 3.4.11.- (Aminopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_232060ORhypothetical proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_232060 OR hypothetical protein AND Toxoplasma gondii ME49 |
|
TGME49_232360 | TGME49_232360-t26_1 | 12 | 12 | 1 | | | reverse | protein coding | No | 7782 | TGME49_232360 | exonuclease | exonuclease | 7894318 | | VIII | TGME49_chrVIII:2,033,578..2,047,651(-) | TGME49_chrVIII:2033578..2047651(-) | TGME49_chrVIII | Toxoplasma gondii ME49 | 37 | OG6_102772 | 0 | 2593 | 7782 | 274498 | 6.46 | 0 | | | | | GO:0004535 | poly(A)-specific ribonuclease activity | | | | | | | | | 3.1.13.4 (Poly(A)-specific ribonuclease) | 3.1.13.4 (Poly(A)-specific ribonuclease) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_232360ORexonucleaseANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_232360 OR exonuclease AND Toxoplasma gondii ME49 |
|
TGME49_233310 | TGME49_233310-t26_1 | 12 | 12 | 1 | | | reverse | protein coding | No | 1800 | TGME49_233310 | peptidase D, putative | peptidase D, putative | 7894338 | | VIII | TGME49_chrVIII:2,580,235..2,588,621(-) | TGME49_chrVIII:2580235..2588621(-) | TGME49_chrVIII | Toxoplasma gondii ME49 | 28 | OG6_102295 | 0 | 599 | 1800 | 67076 | 6.79 | 0 | | | | | GO:0004177;GO:0030145 | aminopeptidase activity;manganese ion binding | GO:0009987 | cellular process | | | | | | | 3.4.11.9 (Xaa-Pro aminopeptidase) | 3.4.11.9 (Xaa-Pro aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_233310ORpeptidase D, putativeANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_233310 OR peptidase D, putative AND Toxoplasma gondii ME49 |
|
TGME49_234220 | TGME49_234220-t26_1 | 7 | 7 | 1 | 1368 | 884 | forward | protein coding | No | 5471 | TGME49_234220 | hypothetical protein | hypothetical protein | 7900157 | S8F046 | X | TGME49_chrX:4,197,853..4,207,750(+) | TGME49_chrX:4198737..4206382(+) | TGME49_chrX | Toxoplasma gondii ME49 | 29 | OG6_124535 | 0 | 1072 | 3219 | 115840 | 6.28 | 1 | | | | | | | | | | | | | | | | 3.1.3.16 (Protein-serine/threonine phosphatase) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_234220ORhypothetical proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_234220 OR hypothetical protein AND Toxoplasma gondii ME49 |
|
TGME49_235450 | TGME49_235450-t26_1 | 5 | 5 | 1 | 823 | | reverse | protein coding | No | 1519 | TGME49_235450 | ubiquitin-conjugating enzyme subfamily protein | ubiquitin-conjugating enzyme subfamily protein | 7900152 | | X | TGME49_chrX:4,876,486..4,880,395(-) | TGME49_chrX:4877309..4880395(-) | TGME49_chrX | Toxoplasma gondii ME49 | 24 | OG6_103192 | 0 | 231 | 696 | 25923 | 9.10 | 0 | | | | | GO:0016881;GO:0004842 | acid-amino acid ligase activity;ubiquitin-protein transferase activity | | | | | | | | | 6.3.2.19 (Transferred entry: 2.3.2.23, 2.3.2.27 and 6.2.1.45) | 6.3.2.19 (Transferred entry: 2.3.2.23, 2.3.2.27 and 6.2.1.45) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_235450ORubiquitin-conjugating enzyme subfamily proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_235450 OR ubiquitin-conjugating enzyme subfamily protein AND Toxoplasma gondii ME49 |
|
TGME49_235680 | TGME49_235680-t26_1 | 21 | 21 | 1 | 948 | 1114 | reverse | protein coding | No | 7141 | TGME49_235680 | peptidase M16 inactive domain-containing protein | peptidase M16 inactive domain-containing protein | 7896897 | S8G4Z6 | X | TGME49_chrX:5,041,114..5,060,271(-) | TGME49_chrX:5042062..5059157(-) | TGME49_chrX | Toxoplasma gondii ME49 | 65 | OG6_110270 | 1 | 1692 | 5079 | 186527 | 5.48 | 1 | | | | | GO:0003824;GO:0046872;GO:0004222;GO:0008270 | catalytic activity;metal ion binding;metalloendopeptidase activity;zinc ion binding | GO:0006508 | proteolysis | | | | | | | 3.4.24.64 (Mitochondrial processing peptidase) | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_235680ORpeptidase M16 inactive domain-containing proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_235680 OR peptidase M16 inactive domain-containing protein AND Toxoplasma gondii ME49 |
|
TGME49_235860 | TGME49_235860-t26_1 | 6 | 6 | 1 | 869 | | forward | protein coding | No | 4511 | TGME49_235860 | subtilisin SUB11 | subtilisin SUB11 | 7899424 | | X | TGME49_chrX:5,103,265..5,110,222(+) | TGME49_chrX:5103265..5109353(+) | TGME49_chrX | Toxoplasma gondii ME49 | 56 | OG6_121085 | 1 | 1213 | 3642 | 130721 | 4.89 | 0 | | | | | GO:0005509;GO:0004252 | calcium ion binding;serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.21.66 (Thermitase) | 3.4.21.62 (Subtilisin) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_235860ORsubtilisin SUB11ANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_235860 OR subtilisin SUB11 AND Toxoplasma gondii ME49 |
|
TGME49_235950 | TGME49_235950-t26_1 | 4 | 4 | 1 | | | forward | protein coding | No | 4101 | TGME49_235950 | subtilisin SUB8 | subtilisin SUB8 | 7899433 | S8EZP3 | X | TGME49_chrX:5,196,900..5,202,258(+) | TGME49_chrX:5196900..5202258(+) | TGME49_chrX | Toxoplasma gondii ME49 | 21 | OG6_116777 | 0 | 1366 | 4101 | 147180 | 5.54 | 0 | | | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.21.66 (Thermitase) | 3.4.21.66 (Thermitase) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_235950ORsubtilisin SUB8ANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_235950 OR subtilisin SUB8 AND Toxoplasma gondii ME49 |
|
TGME49_236210 | TGME49_236210-t26_1 | 10 | 10 | 1 | 1089 | 450 | forward | protein coding | No | 3069 | TGME49_236210 | peptidase M16 family potein, putative | peptidase M16 family potein, putative | 7900133 | | X | TGME49_chrX:5,326,853..5,334,018(+) | TGME49_chrX:5327303..5332929(+) | TGME49_chrX | Toxoplasma gondii ME49 | 36 | OG6_100777 | 0 | 509 | 1530 | 56915 | 6.57 | 0 | HMM: MMFRFLPRVASGASSLSVSQRRLRASFSSSLQSRGFFSAAPAAATAGVSPLARSVDAA, NN: MMFRFLPRVASGA | NN Sum: 0, NN D: .31, HMM Prob: .94 | | | GO:0003824;GO:0046872;GO:0004222;GO:0008270 | catalytic activity;metal ion binding;metalloendopeptidase activity;zinc ion binding | GO:0006508 | proteolysis | | | | | | | 3.4.24.64 (Mitochondrial processing peptidase) | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_236210ORpeptidase M16 family potein, putativeANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_236210 OR peptidase M16 family potein, putative AND Toxoplasma gondii ME49 |
|
TGME49_237150 | TGME49_237150-t26_1 | 8 | 8 | 1 | 908 | 1218 | reverse | protein coding | No | 3380 | TGME49_237150 | minor histocompatibility antigen h13, putative | minor histocompatibility antigen h13, putative | 7899151 | S8GDV7 | X | TGME49_chrX:5,742,169..5,748,942(-) | TGME49_chrX:5743077..5747724(-) | TGME49_chrX | Toxoplasma gondii ME49 | 34 | OG6_102328 | 0 | 417 | 1254 | 46260 | 6.44 | 8 | | | GO:0016021 | integral component of membrane | GO:0004190 | aspartic-type endopeptidase activity | | | | | | | | | | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_237150ORminor histocompatibility antigen h13, putativeANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_237150 OR minor histocompatibility antigen h13, putative AND Toxoplasma gondii ME49 |
|
TGME49_237893 | TGME49_237893-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 693 | TGME49_237893 | hypothetical protein | hypothetical protein | | | IV | TGME49_chrIV:2,645,530..2,646,222(+) | TGME49_chrIV:2645530..2646222(+) | TGME49_chrIV | Toxoplasma gondii ME49 | 101 | OG6_124104 | 10 | 230 | 693 | 24759 | 3.68 | 0 | HMM: MVLSSGWRALIRCCQPVLATPNVSAS, NN: MVLSSGWRALIRCCQPVLAT | NN Sum: 3, NN D: .59, HMM Prob: .75 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_237893ORhypothetical proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_237893 OR hypothetical protein AND Toxoplasma gondii ME49 |
|
TGME49_237894 | TGME49_237894-t26_1 | 1 | 1 | 1 | 33 | | forward | protein coding | No | 693 | TGME49_237894 | OTU family cysteine protease | OTU family cysteine protease | | | IV | TGME49_chrIV:2,646,330..2,647,022(+) | TGME49_chrIV:2646330..2646989(+) | TGME49_chrIV | Toxoplasma gondii ME49 | 101 | OG6_124104 | 10 | 219 | 660 | 25564 | 7.54 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_237894OROTU family cysteine proteaseANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_237894 OR OTU family cysteine protease AND Toxoplasma gondii ME49 |
|
TGME49_237900 | TGME49_237900-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1461 | TGME49_237900 | OTU family cysteine protease | OTU family cysteine protease | 7898612 | | IV | TGME49_chrIV:2,683,892..2,685,352(-) | TGME49_chrIV:2683892..2685352(-) | TGME49_chrIV | Toxoplasma gondii ME49 | 101 | OG6_124104 | 10 | 486 | 1461 | 54446 | 4.31 | 0 | HMM: MVLSSGWRALIRCCQPVLATPNVSAS, NN: MVLSSGWRALIRCCQPVLAT | NN Sum: 3, NN D: .59, HMM Prob: .75 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_237900OROTU family cysteine proteaseANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_237900 OR OTU family cysteine protease AND Toxoplasma gondii ME49 |
|
TGME49_239500 | TGME49_239500-t26_1 | 4 | 4 | 1 | 594 | 567 | forward | protein coding | No | 1920 | TGME49_239500 | proteasome subunit alpha type, putative | proteasome subunit alpha type, putative | 7894922 | B9PNI2 | VI | TGME49_chrVI:720,752..724,843(+) | TGME49_chrVI:721319..724249(+) | TGME49_chrVI | Toxoplasma gondii ME49 | 28 | OG6_101968 | 0 | 252 | 759 | 27936 | 4.99 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_239500ORproteasome subunit alpha type, putativeANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_239500 OR proteasome subunit alpha type, putative AND Toxoplasma gondii ME49 |
|
TGME49_240240 | TGME49_240240-t26_1 | 9 | 9 | 1 | | | forward | protein coding | No | 3048 | TGME49_240240 | subtilisin SUB5 | subtilisin SUB5 | 7898294 | | VI | TGME49_chrVI:1,094,140..1,102,611(+) | TGME49_chrVI:1094140..1102611(+) | TGME49_chrVI | Toxoplasma gondii ME49 | 22 | OG6_490834 | 0 | 1015 | 3048 | 110311 | 5.46 | 0 | | | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.21.62 (Subtilisin) | 3.4.21.62 (Subtilisin) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_240240ORsubtilisin SUB5ANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_240240 OR subtilisin SUB5 AND Toxoplasma gondii ME49 |
|
TGME49_240830 | TGME49_240830-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1794 | TGME49_240830 | hydrolase, alpha/beta fold family protein | hydrolase, alpha/beta fold family protein | 7901188 | | VI | TGME49_chrVI:1,461,808..1,463,601(-) | TGME49_chrVI:1461808..1463601(-) | TGME49_chrVI | Toxoplasma gondii ME49 | 29 | OG6_101420 | 0 | 597 | 1794 | 65756 | 10.37 | 1 | HMM: MKQSPSFSHFARLLFAFLFLLFSPSCAS, NN: MKQSPSFSHFARLLFAFLFLLFSPSCAS | NN Sum: 4, NN D: .82, HMM Prob: 1 | GO:0031227 | intrinsic component of endoplasmic reticulum membrane | GO:0016788 | hydrolase activity, acting on ester bonds | GO:0006505;GO:0006886 | GPI anchor metabolic process;intracellular protein transport | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_240830ORhydrolase, alpha/beta fold family proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_240830 OR hydrolase, alpha/beta fold family protein AND Toxoplasma gondii ME49 |
|
TGME49_242290 | TGME49_242290-t26_1 | 8 | 8 | 1 | 547 | 748 | forward | protein coding | No | 2057 | TGME49_242290 | proteasome subunit alpha1, putative | proteasome subunit alpha1, putative | 7899680 | B9PPF2 | VI | TGME49_chrVI:1,941,221..1,947,816(+) | TGME49_chrVI:1941969..1947269(+) | TGME49_chrVI | Toxoplasma gondii ME49 | 23 | OG6_102240 | 0 | 253 | 762 | 28113 | 6.61 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_242290ORproteasome subunit alpha1, putativeANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_242290 OR proteasome subunit alpha1, putative AND Toxoplasma gondii ME49 |
|
TGME49_242720 | TGME49_242720-t26_1 | 10 | 10 | 1 | 1206 | 636 | reverse | protein coding | No | 4881 | TGME49_242720 | aspartyl protease ASP5 | aspartyl protease ASP5 | 7901156 | | VI | TGME49_chrVI:2,205,049..2,214,452(-) | TGME49_chrVI:2206255..2213816(-) | TGME49_chrVI | Toxoplasma gondii ME49 | 32 | OG6_107443 | 0 | 1012 | 3039 | 108041 | 7.36 | 1 | | | | | GO:0004190 | aspartic-type endopeptidase activity | GO:0006508 | proteolysis | GO:0005794 | Golgi apparatus | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_242720ORaspartyl protease ASP5ANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_242720 OR aspartyl protease ASP5 AND Toxoplasma gondii ME49 |
|
TGME49_243210 | TGME49_243210-t26_1 | 7 | 7 | 1 | 1272 | 2191 | reverse | protein coding | No | 6742 | TGME49_243210 | DUF862 domain-containing protein | DUF862 domain-containing protein | 7901117 | B6KFU0 | VI | TGME49_chrVI:2,442,597..2,451,319(-) | TGME49_chrVI:2443869..2449128(-) | TGME49_chrVI | Toxoplasma gondii ME49 | 20 | OG6_224208 | 0 | 1092 | 3279 | 120061 | 6.78 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_243210ORDUF862 domain-containing proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_243210 OR DUF862 domain-containing protein AND Toxoplasma gondii ME49 |
|
TGME49_243350 | TGME49_243350-t26_1 | 5 | 5 | 1 | 1073 | 669 | forward | protein coding | No | 3953 | TGME49_243350 | gamma-glutamyl hydrolase | gamma-glutamyl hydrolase | 7894693 | | VI | TGME49_chrVI:2,569,931..2,576,326(+) | TGME49_chrVI:2570600..2575253(+) | TGME49_chrVI | Toxoplasma gondii ME49 | 27 | OG6_101559 | 0 | 736 | 2211 | 81502 | 6.93 | 0 | | | | | GO:0034722;GO:0016787;GO:0008242 | gamma-glutamyl-peptidase activity;hydrolase activity;omega peptidase activity | GO:0006541 | glutamine metabolic process | | | | | | | 3.4.19.9 (Folate gamma-glutamyl hydrolase) | 3.4.19.9 (Folate gamma-glutamyl hydrolase) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_243350ORgamma-glutamyl hydrolaseANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_243350 OR gamma-glutamyl hydrolase AND Toxoplasma gondii ME49 |
|
TGME49_243430 | TGME49_243430-t26_1 | 5 | 5 | 1 | 1904 | 2749 | reverse | protein coding | No | 8841 | TGME49_243430 | OTU family cysteine protease | OTU family cysteine protease | 7899657 | | VI | TGME49_chrVI:2,618,862..2,629,456(-) | TGME49_chrVI:2620766..2626707(-) | TGME49_chrVI | Toxoplasma gondii ME49 | 20 | OG6_110771 | 0 | 1395 | 4188 | 147215 | 8.29 | 0 | HMM: MTCLPPSLLRVSRGSKACLEVTDALVVAFLVFSAMKNGTEVAAA, NN: MTCLPPSLLRVSRGSKACLEVTDALVVAFLVFSAMKNGT | NN Sum: 0, NN D: .25, HMM Prob: .5 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_243430OROTU family cysteine proteaseANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_243430 OR OTU family cysteine protease AND Toxoplasma gondii ME49 |
|
TGME49_243510 | TGME49_243510-t26_1 | 7 | 7 | 1 | 347 | 512 | reverse | protein coding | No | 1996 | TGME49_243510 | OTU family cysteine protease | OTU family cysteine protease | 7901143 | | VI | TGME49_chrVI:2,688,018..2,693,522(-) | TGME49_chrVI:2688365..2693010(-) | TGME49_chrVI | Toxoplasma gondii ME49 | 30 | OG6_102788 | 0 | 378 | 1137 | 41457 | 5.41 | 0 | | | | | | | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_243510OROTU family cysteine proteaseANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_243510 OR OTU family cysteine protease AND Toxoplasma gondii ME49 |
|
TGME49_244480 | TGME49_244480-t26_1 | 4 | 4 | 1 | | | forward | protein coding | No | 1074 | TGME49_244480 | peptidase M16 inactive domain-containing protein | peptidase M16 inactive domain-containing protein | 7901177 | | VI | TGME49_chrVI:3,303,680..3,305,410(+) | TGME49_chrVI:3303680..3305410(+) | TGME49_chrVI | Toxoplasma gondii ME49 | 86 | OG6_100422 | 2 | 357 | 1074 | 41280 | 6.56 | 0 | | | | | GO:0003824;GO:0046872;GO:0004222;GO:0008270 | catalytic activity;metal ion binding;metalloendopeptidase activity;zinc ion binding | GO:0006508 | proteolysis | | | | | | | 3.4.24.56 (Insulysin) | 3.4.24.56 (Insulysin) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_244480ORpeptidase M16 inactive domain-containing proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_244480 OR peptidase M16 inactive domain-containing protein AND Toxoplasma gondii ME49 |
|
TGME49_244490 | TGME49_244490-t26_1 | 1 | 1 | 1 | 178 | 307 | forward | protein coding | No | 2264 | TGME49_244490 | insulysin, putative | insulysin, putative | 7901178 | S8F755 | VI | TGME49_chrVI:3,305,742..3,308,005(+) | TGME49_chrVI:3306049..3307827(+) | TGME49_chrVI | Toxoplasma gondii ME49 | 14 | OG6_490308 | 0 | 592 | 1779 | 66552 | 6.60 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | 3.4.24.56 (Insulysin) | 3.4.24.56 (Insulysin) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_244490ORinsulysin, putativeANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_244490 OR insulysin, putative AND Toxoplasma gondii ME49 |
|
TGME49_245500 | TGME49_245500-t26_1 | 12 | 12 | 1 | 744 | 457 | reverse | protein coding | No | 6853 | TGME49_245500 | dipeptidyl peptidase iv (dpp iv) n-terminal region domain-containing protein | dipeptidyl peptidase iv (dpp iv) n-terminal region domain-containing protein | 7901406 | | XII | TGME49_chrXII:2,311,590..2,324,053(-) | TGME49_chrXII:2312334..2323596(-) | TGME49_chrXII | Toxoplasma gondii ME49 | 28 | OG6_164791 | 0 | 1883 | 5652 | 205657 | 6.48 | 0 | | | GO:0016020 | membrane | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.14.5 (Dipeptidyl-peptidase IV) | 3.4.14.5 (Dipeptidyl-peptidase IV) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_245500ORdipeptidyl peptidase iv (dpp iv) n-terminal region domain-containing proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_245500 OR dipeptidyl peptidase iv (dpp iv) n-terminal region domain-containing protein AND Toxoplasma gondii ME49 |
|
TGME49_245590 | TGME49_245590-t26_1 | 6 | 6 | 1 | 1314 | 959 | reverse | protein coding | No | 4040 | TGME49_245590 | rhomboid protease ROM6 | rhomboid protease ROM6 | 7897930 | | XII | TGME49_chrXII:2,410,452..2,417,653(-) | TGME49_chrXII:2411766..2416694(-) | TGME49_chrXII | Toxoplasma gondii ME49 | 23 | OG6_124366 | 0 | 588 | 1767 | 65357 | 10.91 | 0 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | 3.4.21.105 (Rhomboid protease) | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_245590ORrhomboid protease ROM6ANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_245590 OR rhomboid protease ROM6 AND Toxoplasma gondii ME49 |
|
TGME49_246020 | TGME49_246020-t26_1 | 7 | 7 | 1 | 717 | 2675 | forward | protein coding | No | 5912 | TGME49_246020 | SprT domain-containing protein | SprT domain-containing protein | 7901359 | B6KGN7 | XII | TGME49_chrXII:2,593,586..2,602,575(+) | TGME49_chrXII:2596261..2601858(+) | TGME49_chrXII | Toxoplasma gondii ME49 | 20 | OG6_104384 | 0 | 839 | 2520 | 89919 | 9.08 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_246020ORSprT domain-containing proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_246020 OR SprT domain-containing protein AND Toxoplasma gondii ME49 |
|
TGME49_246040 | TGME49_246040-t26_1 | 18 | 18 | 1 | 803 | 1056 | forward | protein coding | No | 6161 | TGME49_246040 | MIF4G domain-containing protein | MIF4G domain-containing protein | 7897946 | | XII | TGME49_chrXII:2,610,839..2,626,047(+) | TGME49_chrXII:2611895..2625244(+) | TGME49_chrXII | Toxoplasma gondii ME49 | 41 | OG6_103377 | 0 | 1433 | 4302 | 157105 | 5.12 | 0 | | | | | GO:0003723;GO:0005488;GO:0005515 | RNA binding;binding;protein binding | GO:0016070 | RNA metabolic process | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_246040ORMIF4G domain-containing proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_246040 OR MIF4G domain-containing protein AND Toxoplasma gondii ME49 |
|
TGME49_246550 | TGME49_246550-t26_1 | 9 | 9 | 1 | 236 | 473 | forward | protein coding | No | 2641 | TGME49_246550 | aspartyl protease ASP3 | aspartyl protease ASP3 | 7893969 | B6KGS0 | XII | TGME49_chrXII:2,845,768..2,851,758(+) | TGME49_chrXII:2846241..2851522(+) | TGME49_chrXII | Toxoplasma gondii ME49 | 24 | OG6_119797 | 0 | 643 | 1932 | 69155 | 5.37 | 1 | HMM: MEGRTTAGRATPAGFWLFSCCLASLLWSANAL, NN: MEGRTTAGRATPAGFWLFSCCLASLLWSANAL | NN Sum: 4, NN D: .72, HMM Prob: 1 | | | GO:0004190 | aspartic-type endopeptidase activity | GO:0006508 | proteolysis | GO:0005794 | Golgi apparatus | | | | | 3.4.23.1 (Pepsin A) | 3.4.23.1 (Pepsin A) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_246550ORaspartyl protease ASP3ANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_246550 OR aspartyl protease ASP3 AND Toxoplasma gondii ME49 |
|
TGME49_246600 | TGME49_246600-t26_1 | 2 | 2 | 1 | 1652 | 1973 | forward | protein coding | No | 9328 | TGME49_246600 | ABC1 family protein | ABC1 family protein | 7893974 | S8G9C3 | XII | TGME49_chrXII:2,873,571..2,883,189(+) | TGME49_chrXII:2875544..2881537(+) | TGME49_chrXII | Toxoplasma gondii ME49 | 31 | OG6_112296 | 0 | 1900 | 5703 | 205404 | 7.99 | 0 | | | | | | | | | | | | | | | 1.14.13.- (With NADH or NADPH as one donor, and incorporation of one atom of oxygen.) | 1.14.13.- (With NADH or NADPH as one donor, and incorporation of one atom of oxygen.) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_246600ORABC1 family proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_246600 OR ABC1 family protein AND Toxoplasma gondii ME49 |
|
TGME49_246800 | TGME49_246800-t26_1 | 16 | 16 | 1 | 535 | 659 | forward | protein coding | No | 3750 | TGME49_246800 | acylaminoacyl-peptidase, putative | acylaminoacyl-peptidase, putative | 7899237 | B6KGU4 | XII | TGME49_chrXII:3,000,954..3,013,684(+) | TGME49_chrXII:3001613..3013149(+) | TGME49_chrXII | Toxoplasma gondii ME49 | 33 | OG6_102438 | 0 | 851 | 2556 | 92718 | 6.51 | 0 | | | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.19.1 (Acylaminoacyl-peptidase) | 3.4.19.1 (Acylaminoacyl-peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_246800ORacylaminoacyl-peptidase, putativeANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_246800 OR acylaminoacyl-peptidase, putative AND Toxoplasma gondii ME49 |
|
TGME49_247240 | TGME49_247240-t26_1 | 9 | 9 | 1 | 814 | 1296 | forward | protein coding | No | 3334 | TGME49_247240 | ubiquitin carboxyl-terminal hydrolase, family 1 protein | ubiquitin carboxyl-terminal hydrolase, family 1 protein | 7897984 | B6KGW8 | XII | TGME49_chrXII:3,185,867..3,193,444(+) | TGME49_chrXII:3187163..3192630(+) | TGME49_chrXII | Toxoplasma gondii ME49 | 35 | OG6_102753 | 0 | 407 | 1224 | 45341 | 4.69 | 0 | | | GO:0005622 | intracellular | GO:0004221;GO:0004843 | obsolete ubiquitin thiolesterase activity;thiol-dependent ubiquitin-specific protease activity | GO:0006511 | ubiquitin-dependent protein catabolic process | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_247240ORubiquitin carboxyl-terminal hydrolase, family 1 proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_247240 OR ubiquitin carboxyl-terminal hydrolase, family 1 protein AND Toxoplasma gondii ME49 |
|
TGME49_248470 | TGME49_248470-t26_1 | 9 | 9 | 1 | 540 | | reverse | protein coding | No | 2796 | TGME49_248470 | subtilisin SUB6 | subtilisin SUB6 | 7897999 | | XII | TGME49_chrXII:3,874,315..3,881,332(-) | TGME49_chrXII:3874855..3881332(-) | TGME49_chrXII | Toxoplasma gondii ME49 | 34 | OG6_206249 | 0 | 751 | 2256 | 82569 | 6.10 | 0 | HMM: MYPWHSLVLLLFFIYPYVDLVVGR, NN: MYPWHSLVLLLFFIYPYVDLV | NN Sum: 4, NN D: .79, HMM Prob: .98 | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.21.66 (Thermitase) | 3.4.21.66 (Thermitase) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_248470ORsubtilisin SUB6ANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_248470 OR subtilisin SUB6 AND Toxoplasma gondii ME49 |
|
TGME49_248710 | TGME49_248710-t26_1 | 8 | 8 | 1 | 5578 | 1777 | forward | protein coding | No | 10370 | TGME49_248710 | hypothetical protein | hypothetical protein | 7897945 | | XII | TGME49_chrXII:4,103,933..4,117,215(+) | TGME49_chrXII:4105710..4111188(+) | TGME49_chrXII | Toxoplasma gondii ME49 | 16 | OG6_104646 | 0 | 1004 | 3015 | 109832 | 8.07 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_248710ORhypothetical proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_248710 OR hypothetical protein AND Toxoplasma gondii ME49 |
|
TGME49_248760 | TGME49_248760-t26_1 | 4 | 4 | 1 | 886 | 286 | forward | protein coding | No | 2927 | TGME49_248760 | subtilisin SUB7 | subtilisin SUB7 | 7897925 | | XII | TGME49_chrXII:4,159,319..4,163,077(+) | TGME49_chrXII:4159866..4162191(+) | TGME49_chrXII | Toxoplasma gondii ME49 | 30 | OG6_113449 | 0 | 584 | 1755 | 62548 | 4.59 | 1 | HMM: MAGCRERGRSLWLLSTLFLAFSGTPFRLPLIAFAA, NN: MAGCRERGRSLWLLSTLFLAFSG | NN Sum: 2, NN D: .59, HMM Prob: .97 | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.21.66 (Thermitase) | 3.4.21.66 (Thermitase) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_248760ORsubtilisin SUB7ANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_248760 OR subtilisin SUB7 AND Toxoplasma gondii ME49 |
|
TGME49_248850 | TGME49_248850-t26_1 | 7 | 7 | 1 | 198 | 682 | forward | protein coding | No | 2131 | TGME49_248850 | methionine aminopeptidase | methionine aminopeptidase | 7899516 | S7W953 | XII | TGME49_chrXII:4,221,055..4,227,146(+) | TGME49_chrXII:4221737..4226948(+) | TGME49_chrXII | Toxoplasma gondii ME49 | 64 | OG6_100342 | 1 | 416 | 1251 | 46804 | 6.66 | 0 | | | | | GO:0004177;GO:0008235;GO:0008270 | aminopeptidase activity;metalloexopeptidase activity;zinc ion binding | GO:0009987;GO:0006508 | cellular process;proteolysis | | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_248850ORmethionine aminopeptidaseANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_248850 OR methionine aminopeptidase AND Toxoplasma gondii ME49 |
|
TGME49_249350 | TGME49_249350-t26_1 | 8 | 8 | 1 | 770 | 2246 | reverse | protein coding | No | 4270 | TGME49_249350 | esterase/lipase/thioesterase domain-containing protein | esterase/lipase/thioesterase domain-containing protein | 7899508 | B6KHE6 | XII | TGME49_chrXII:4,475,183..4,482,800(-) | TGME49_chrXII:4475953..4480554(-) | TGME49_chrXII | Toxoplasma gondii ME49 | 29 | OG6_108842 | 0 | 417 | 1254 | 45134 | 7.04 | 0 | | | | | GO:0004177 | aminopeptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_249350OResterase/lipase/thioesterase domain-containing proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_249350 OR esterase/lipase/thioesterase domain-containing protein AND Toxoplasma gondii ME49 |
|
TGME49_249590 | TGME49_249590-t26_1 | 7 | 7 | 1 | 568 | 563 | forward | protein coding | No | 1908 | TGME49_249590 | proteasome subunit alpha type 5-2, putative | proteasome subunit alpha type 5-2, putative | 7899313 | B9PR77 | XII | TGME49_chrXII:4,666,650..4,671,501(+) | TGME49_chrXII:4667213..4670933(+) | TGME49_chrXII | Toxoplasma gondii ME49 | 25 | OG6_101621 | 0 | 258 | 777 | 28278 | 4.70 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_249590ORproteasome subunit alpha type 5-2, putativeANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_249590 OR proteasome subunit alpha type 5-2, putative AND Toxoplasma gondii ME49 |
|
TGME49_249670 | TGME49_249670-t26_1 | 7 | 7 | 1 | 1286 | 454 | reverse | protein coding | No | 3459 | TGME49_249670 | cathepsin B | cathepsin B | 7899477 | B6KHH7 | XII | TGME49_chrXII:4,720,754..4,728,123(-) | TGME49_chrXII:4722040..4727155(-) | TGME49_chrXII | Toxoplasma gondii ME49 | 29 | OG6_101151 | 0 | 572 | 1719 | 62476 | 5.31 | 1 | HMM: MEKMEGRKSFRVLGTPLPVAALAAILLLGCMYTRAAGT, NN: MEKMEGRKSFRVLGTPLPVAALAAILLLGCMYTRAAGT | NN Sum: 4, NN D: .67, HMM Prob: .97 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | GO:0045177;GO:0020003 | apical part of cell;symbiont-containing vacuole | | | | | 3.4.22.1 (Cathepsin B) | 3.4.22.1 (Cathepsin B) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_249670ORcathepsin BANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_249670 OR cathepsin B AND Toxoplasma gondii ME49 |
|
TGME49_251490 | TGME49_251490-t26_1 | 6 | 6 | 1 | 704 | 736 | reverse | protein coding | No | 2805 | TGME49_251490 | ACR, COG2135 domain-containing protein | ACR, COG2135 domain-containing protein | 7895980 | B6KHR7 | XII | TGME49_chrXII:5,425,272..5,431,370(-) | TGME49_chrXII:5425976..5430634(-) | TGME49_chrXII | Toxoplasma gondii ME49 | 31 | OG6_102318 | 0 | 454 | 1365 | 49160 | 9.53 | 0 | | | | | | | | | | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_251490ORACR, COG2135 domain-containing proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_251490 OR ACR, COG2135 domain-containing protein AND Toxoplasma gondii ME49 |
|
TGME49_251510 | TGME49_251510-t26_1 | 5 | 5 | 1 | 838 | 2792 | reverse | protein coding | No | 8913 | TGME49_251510 | Ulp1 protease family, C-terminal catalytic domain-containing protein | Ulp1 protease family, C-terminal catalytic domain-containing protein | 7895982 | | XII | TGME49_chrXII:5,435,446..5,446,198(-) | TGME49_chrXII:5436284..5443406(-) | TGME49_chrXII | Toxoplasma gondii ME49 | 15 | OG6_491482 | 0 | 1760 | 5283 | 191926 | 7.42 | 0 | HMM: MMGEAGKGGAATRGEPRHFLLLCASATDGVLCR, NN: MMGEAGKGGAATRGEPRHFLLLCASATDGVLCR | NN Sum: 0, NN D: .2, HMM Prob: .88 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_251510ORUlp1 protease family, C-terminal catalytic domain-containing proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_251510 OR Ulp1 protease family, C-terminal catalytic domain-containing protein AND Toxoplasma gondii ME49 |
|
TGME49_251570 | TGME49_251570-t26_1 | 3 | 3 | 1 | | | reverse | protein coding | No | 3792 | TGME49_251570 | CAAX amino terminal protease family protein | CAAX amino terminal protease family protein | 7899280 | S8ESE2 | XII | TGME49_chrXII:5,462,670..5,468,514(-) | TGME49_chrXII:5462670..5468514(-) | TGME49_chrXII | Toxoplasma gondii ME49 | 23 | OG6_112025 | 0 | 1263 | 3792 | 134884 | 9.82 | 6 | HMM: MICLLVIFSLLFSSARVSYAA, NN: MICLLVIFSLLFSSARVSYAA | NN Sum: 4, NN D: .86, HMM Prob: 1 | GO:0016020 | membrane | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_251570ORCAAX amino terminal protease family proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_251570 OR CAAX amino terminal protease family protein AND Toxoplasma gondii ME49 |
|
TGME49_252440 | TGME49_252440-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1815 | TGME49_252440 | peptidase c13 family protein | peptidase c13 family protein | 7894264 | Q8MPF3 | III | TGME49_chrIII:574,496..576,310(-) | TGME49_chrIII:574496..576310(-) | TGME49_chrIII | Toxoplasma gondii ME49 | 25 | OG6_101767 | 0 | 604 | 1815 | 66483 | 5.37 | 0 | HMM: MATSEPLAPAAASSSSSPSSFSSSSFSASLASLCAASASPVASGS, NN: MATSEPLAPAAASSSSSPSSFSSSSFSASLASLCAASASPVASGSSHISPRLRFFLFSLLSLCLSS | NN Sum: 0, NN D: .14, HMM Prob: .97 | | | GO:0004197;GO:0008233 | cysteine-type endopeptidase activity;peptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.22.34 (Legumain) | 3.-.-.- (Hydrolases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_252440ORpeptidase c13 family proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_252440 OR peptidase c13 family protein AND Toxoplasma gondii ME49 |
|
TGME49_253170 | TGME49_253170-t26_1 | 17 | 17 | 1 | 3971 | 1012 | forward | protein coding | No | 11598 | TGME49_253170 | zinc carboxypeptidase, putative | zinc carboxypeptidase, putative | 7894296 | S8FDR8 | III | TGME49_chrIII:799,569..820,724(+) | TGME49_chrIII:800581..816753(+) | TGME49_chrIII | Toxoplasma gondii ME49 | 34 | OG6_113993 | 0 | 2204 | 6615 | 238884 | 7.30 | 1 | | | | | GO:0004181;GO:0008270 | metallocarboxypeptidase activity;zinc ion binding | GO:0006508 | proteolysis | | | | | | | 3.4.17.12 (Carboxypeptidase M) | 3.4.17.12 (Carboxypeptidase M) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_253170ORzinc carboxypeptidase, putativeANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_253170 OR zinc carboxypeptidase, putative AND Toxoplasma gondii ME49 |
|
TGME49_253890 | TGME49_253890-t26_1 | 11 | 11 | 1 | | | reverse | protein coding | No | 4815 | TGME49_253890 | peptidase M16 inactive domain-containing protein | peptidase M16 inactive domain-containing protein | 7900025 | | III | TGME49_chrIII:1,273,563..1,282,930(-) | TGME49_chrIII:1273563..1282930(-) | TGME49_chrIII | Toxoplasma gondii ME49 | 65 | OG6_110270 | 1 | 1604 | 4815 | 176341 | 6.44 | 0 | HMM: MALFRFLVLRRGLRGI, NN: MALFRFLVLRRGLRGI | NN Sum: 4, NN D: .68, HMM Prob: .23 | | | GO:0003824;GO:0046872;GO:0004222;GO:0008270 | catalytic activity;metal ion binding;metalloendopeptidase activity;zinc ion binding | GO:0006508 | proteolysis | | | | | | | | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_253890ORpeptidase M16 inactive domain-containing proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_253890 OR peptidase M16 inactive domain-containing protein AND Toxoplasma gondii ME49 |
|
TGME49_254010 | TGME49_254010-t26_1 | 10 | 10 | 1 | 1404 | 810 | forward | protein coding | No | 4431 | TGME49_254010 | serine carboxypeptidase s28 protein | serine carboxypeptidase s28 protein | 7900037 | S8F7D5 | III | TGME49_chrIII:1,397,336..1,406,547(+) | TGME49_chrIII:1398146..1405143(+) | TGME49_chrIII | Toxoplasma gondii ME49 | 34 | OG6_100644 | 0 | 738 | 2217 | 81877 | 6.03 | 1 | HMM: MAVSRCRSASNPGRRSGVCRSARLPLRLLFTCTCVFASLFFAANPVEAT, NN: MAVSRCRSASNPGRRSGVCRSARLPLRLLFTCTCVFASLFFAANPVEAT | NN Sum: 1, NN D: .36, HMM Prob: .69 | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.16.2 (Lysosomal Pro-Xaa carboxypeptidase) | 3.4.16.2 (Lysosomal Pro-Xaa carboxypeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_254010ORserine carboxypeptidase s28 proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_254010 OR serine carboxypeptidase s28 protein AND Toxoplasma gondii ME49 |
|
TGME49_254120 | TGME49_254120-t26_1 | 3 | 3 | 1 | 491 | 592 | forward | protein coding | No | 1458 | TGME49_254120 | autophagy-related protein 8 atg8, putative | autophagy-related protein 8 atg8, putative | 7900047 | B9PWU8 | III | TGME49_chrIII:1,457,767..1,460,643(+) | TGME49_chrIII:1458359..1460152(+) | TGME49_chrIII | Toxoplasma gondii ME49 | 24 | OG6_100707 | 0 | 124 | 375 | 14236 | 7.62 | 0 | | | GO:0005737 | cytoplasm | | | GO:0000045 | autophagosome assembly | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_254120ORautophagy-related protein 8 atg8, putativeANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_254120 OR autophagy-related protein 8 atg8, putative AND Toxoplasma gondii ME49 |
|
TGME49_254690 | TGME49_254690-t26_1 | 6 | 6 | 1 | 812 | 669 | forward | protein coding | No | 2975 | TGME49_254690 | phospholipase/carboxylesterase | phospholipase/carboxylesterase | 7894221 | S8FDB7 | III | TGME49_chrIII:1,883,446..1,887,666(+) | TGME49_chrIII:1884115..1886854(+) | TGME49_chrIII | Toxoplasma gondii ME49 | 45 | OG6_101827 | 0 | 497 | 1494 | 54235 | 6.00 | 1 | | | | | GO:0047372;GO:0016787;GO:0008236 | acylglycerol lipase activity;hydrolase activity;serine-type peptidase activity | GO:0008152;GO:0006508 | metabolic process;proteolysis | | | | | | | 3.1.1.23 (Acylglycerol lipase) | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_254690ORphospholipase/carboxylesteraseANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_254690 OR phospholipase/carboxylesterase AND Toxoplasma gondii ME49 |
|
TGME49_254900 | TGME49_254900-t26_1 | 2 | 2 | 1 | | | forward | protein coding | No | 576 | TGME49_254900 | proteasome subunit beta type 2, putative | proteasome subunit beta type 2, putative | 7894242 | B9PX34 | III | TGME49_chrIII:2,017,451..2,018,370(+) | TGME49_chrIII:2017451..2018370(+) | TGME49_chrIII | Toxoplasma gondii ME49 | 23 | OG6_102061 | 0 | 191 | 576 | 22001 | 8.05 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_254900ORproteasome subunit beta type 2, putativeANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_254900 OR proteasome subunit beta type 2, putative AND Toxoplasma gondii ME49 |
|
TGME49_255180 | TGME49_255180-t26_1 | 13 | 13 | 1 | | | reverse | protein coding | No | 12657 | TGME49_255180 | ubiquitin carboxyl-terminal hydrolase | ubiquitin carboxyl-terminal hydrolase | 7899616 | | VIIb | TGME49_chrVIIb:5,028,130..5,047,504(-) | TGME49_chrVIIb:5028130..5047504(-) | TGME49_chrVIIb | Toxoplasma gondii ME49 | 33 | OG6_104835 | 0 | 4218 | 12657 | 454311 | 5.54 | 0 | | | | | GO:0004221;GO:0036459 | obsolete ubiquitin thiolesterase activity;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | 3.1.2.15 (Deleted entry) | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_255180ORubiquitin carboxyl-terminal hydrolaseANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_255180 OR ubiquitin carboxyl-terminal hydrolase AND Toxoplasma gondii ME49 |
|
TGME49_256780 | TGME49_256780-t26_1 | 6 | 6 | 1 | 147 | 206 | forward | protein coding | No | 1697 | TGME49_256780 | hypothetical protein | hypothetical protein | 7895473 | | VIIb | TGME49_chrVIIb:4,467,666..4,473,416(+) | TGME49_chrVIIb:4467872..4473269(+) | TGME49_chrVIIb | Toxoplasma gondii ME49 | 47 | OG6_101256 | 1 | 447 | 1344 | 46570 | 4.53 | 0 | | | | | | | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_256780ORhypothetical proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_256780 OR hypothetical protein AND Toxoplasma gondii ME49 |
|
TGME49_257010 | TGME49_257010-t26_1 | 10 | 10 | 1 | 238 | 800 | forward | protein coding | No | 4110 | TGME49_257010 | sporozoite developmental protein | sporozoite developmental protein | 7899593 | | VIIb | TGME49_chrVIIb:4,282,553..4,287,188(+) | TGME49_chrVIIb:4283353..4286880(+) | TGME49_chrVIIb | Toxoplasma gondii ME49 | 86 | OG6_100422 | 2 | 1023 | 3072 | 114763 | 6.11 | 0 | HMM: MCRFSKMIKKLLLVLCSCVLAVGCVCGE, NN: MCRFSKMIKKLLLVLCSCVLAVGCVCGE | NN Sum: 4, NN D: .86, HMM Prob: .99 | | | GO:0003824;GO:0046872;GO:0004222;GO:0008270 | catalytic activity;metal ion binding;metalloendopeptidase activity;zinc ion binding | GO:0006508 | proteolysis | | | | | | | 3.4.24.56 (Insulysin) | 3.4.24.56 (Insulysin) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_257010ORsporozoite developmental proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_257010 OR sporozoite developmental protein AND Toxoplasma gondii ME49 |
|
TGME49_257110 | TGME49_257110-t26_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 1857 | TGME49_257110 | hypothetical protein | hypothetical protein | 7901095 | | VIIb | TGME49_chrVIIb:4,216,961..4,219,478(-) | TGME49_chrVIIb:4216961..4219478(-) | TGME49_chrVIIb | Toxoplasma gondii ME49 | 23 | OG6_102968 | 0 | 618 | 1857 | 67577 | 8.57 | 0 | | | | | GO:0004222 | metalloendopeptidase activity | | | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_257110ORhypothetical proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_257110 OR hypothetical protein AND Toxoplasma gondii ME49 |
|
TGME49_257500 | TGME49_257500-t26_1 | 2 | 2 | 1 | | | forward | protein coding | No | 3708 | TGME49_257500 | hypothetical protein | hypothetical protein | 7894844 | | VIIb | TGME49_chrVIIb:4,011,217..4,015,277(+) | TGME49_chrVIIb:4011217..4015277(+) | TGME49_chrVIIb | Toxoplasma gondii ME49 | 16 | OG6_491023 | 0 | 1235 | 3708 | 132994 | 8.54 | 0 | HMM: MRRLPGAALHALGGAAPAPPGLLLPLLFLPSFSPDNGHMRKPLLLIGSLLSETHAF, NN: MRRLPGAALHALGGAAPAPPGLLLPLLFLPSFSP | NN Sum: 0, NN D: .32, HMM Prob: 1 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_257500ORhypothetical proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_257500 OR hypothetical protein AND Toxoplasma gondii ME49 |
|
TGME49_257730 | TGME49_257730-t26_1 | 10 | 10 | 1 | | | forward | protein coding | No | 1455 | TGME49_257730 | methionine aminopeptidase, type i, putative | methionine aminopeptidase, type i, putative | 7895493 | | VIIb | TGME49_chrVIIb:3,863,945..3,870,881(+) | TGME49_chrVIIb:3863945..3870881(+) | TGME49_chrVIIb | Toxoplasma gondii ME49 | 29 | OG6_124490 | 0 | 484 | 1455 | 52230 | 8.99 | 0 | HMM: MWSFTRASGRSVRSSLSESFHRSSVAEPRANPSLRLLSAWSASLSSAS, NN: MWSFTRASGRSVRSSLSE | NN Sum: 0, NN D: .13, HMM Prob: .72 | | | GO:0004177;GO:0008235 | aminopeptidase activity;metalloexopeptidase activity | GO:0009987;GO:0006508 | cellular process;proteolysis | | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_257730ORmethionine aminopeptidase, type i, putativeANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_257730 OR methionine aminopeptidase, type i, putative AND Toxoplasma gondii ME49 |
|
TGME49_257990 | TGME49_257990-t26_1 | 11 | 11 | 1 | 729 | | forward | protein coding | No | 3513 | TGME49_257990 | heat shock protein 101, putative | heat shock protein 101, putative | 7901082 | | VIIb | TGME49_chrVIIb:3,670,754..3,680,274(+) | TGME49_chrVIIb:3670754..3679545(+) | TGME49_chrVIIb | Toxoplasma gondii ME49 | 120 | OG6_100223 | 3 | 927 | 2784 | 104296 | 6.46 | 0 | | | GO:0005622 | intracellular | GO:0005524;GO:0016887;GO:0008134 | ATP binding;ATPase activity;transcription factor binding | GO:0019538;GO:0006355 | protein metabolic process;regulation of transcription, DNA-templated | | | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_257990ORheat shock protein 101, putativeANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_257990 OR heat shock protein 101, putative AND Toxoplasma gondii ME49 |
|
TGME49_258150 | TGME49_258150-t26_1 | 6 | 6 | 1 | 427 | 779 | reverse | protein coding | No | 1944 | TGME49_258150 | proteasome subunit alpha type 7, putative | proteasome subunit alpha type 7, putative | 7895514 | | VIIb | TGME49_chrVIIb:3,547,577..3,552,695(-) | TGME49_chrVIIb:3548004..3551916(-) | TGME49_chrVIIb | Toxoplasma gondii ME49 | 27 | OG6_101207 | 0 | 245 | 738 | 27080 | 6.63 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_258150ORproteasome subunit alpha type 7, putativeANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_258150 OR proteasome subunit alpha type 7, putative AND Toxoplasma gondii ME49 |
|
TGME49_258780 | TGME49_258780-t26_1 | 1 | 1 | 1 | 348 | | reverse | protein coding | No | 1440 | TGME49_258780 | OTU family cysteine protease | OTU family cysteine protease | 7894836 | B6KBA8 | VIIb | TGME49_chrVIIb:3,187,689..3,189,128(-) | TGME49_chrVIIb:3188037..3189128(-) | TGME49_chrVIIb | Toxoplasma gondii ME49 | 26 | OG6_110278 | 0 | 363 | 1092 | 40701 | 9.38 | 0 | | | | | | | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_258780OROTU family cysteine proteaseANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_258780 OR OTU family cysteine protease AND Toxoplasma gondii ME49 |
|
TGME49_259260 | TGME49_259260-t26_1 | 8 | 8 | 1 | 445 | 370 | reverse | protein coding | No | 4568 | TGME49_259260 | membrane protein FtsH1 | membrane protein FtsH1 | 7896659 | | VIIb | TGME49_chrVIIb:2,827,391..2,835,054(-) | TGME49_chrVIIb:2827836..2834684(-) | TGME49_chrVIIb | Toxoplasma gondii ME49 | 26 | OG6_134869 | 0 | 1250 | 3753 | 136919 | 7.16 | 1 | | | | | GO:0005524;GO:0016887;GO:0004222;GO:0008568 | ATP binding;ATPase activity;metalloendopeptidase activity;microtubule-severing ATPase activity | GO:0006508 | proteolysis | GO:0020011 | apicoplast | | | | | 3.6.4.3 (Transferred entry: 5.6.1.1) | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_259260ORmembrane protein FtsH1ANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_259260 OR membrane protein FtsH1 AND Toxoplasma gondii ME49 |
|
TGME49_260510 | TGME49_260510-t26_1 | 9 | 9 | 1 | 244 | | reverse | protein coding | No | 1726 | TGME49_260510 | ubiquitin thioesterase otubain-like family protein | ubiquitin thioesterase otubain-like family protein | 7901103 | | VIIb | TGME49_chrVIIb:2,194,902..2,200,394(-) | TGME49_chrVIIb:2195146..2200394(-) | TGME49_chrVIIb | Toxoplasma gondii ME49 | 27 | OG6_102549 | 0 | 493 | 1482 | 55389 | 6.42 | 0 | | | | | | | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_260510ORubiquitin thioesterase otubain-like family proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_260510 OR ubiquitin thioesterase otubain-like family protein AND Toxoplasma gondii ME49 |
|
TGME49_261010 | TGME49_261010-t26_1 | 8 | 8 | 1 | 296 | | reverse | protein coding | No | 1526 | TGME49_261010 | tat-binding family protein, putative | tat-binding family protein, putative | 7899600 | B9PKJ6 | VIIb | TGME49_chrVIIb:1,973,639..1,979,166(-) | TGME49_chrVIIb:1973935..1979166(-) | TGME49_chrVIIb | Toxoplasma gondii ME49 | 37 | OG6_101513 | 0 | 409 | 1230 | 46073 | 7.90 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016887;GO:0009378;GO:0016787;GO:0008568 | ATP binding;ATPase activity;four-way junction helicase activity;hydrolase activity;microtubule-severing ATPase activity | GO:0006310;GO:0006281;GO:0030163 | DNA recombination;DNA repair;protein catabolic process | | | | | | | 3.6.4.3 (Transferred entry: 5.6.1.1) | 3.6.4.3 (Transferred entry: 5.6.1.1) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_261010ORtat-binding family protein, putativeANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_261010 OR tat-binding family protein, putative AND Toxoplasma gondii ME49 |
|
TGME49_261500 | TGME49_261500-t26_1 | 7 | 7 | 1 | 201 | | reverse | protein coding | No | 1707 | TGME49_261500 | hydrolase | hydrolase | 7894889 | S8GCN5 | VIIb | TGME49_chrVIIb:1,690,395..1,695,251(-) | TGME49_chrVIIb:1690596..1695251(-) | TGME49_chrVIIb | Toxoplasma gondii ME49 | 57 | OG6_110414 | 1 | 501 | 1506 | 53135 | 5.05 | 0 | | | | | | | | | | | | | | | | 3.-.-.- (Hydrolases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_261500ORhydrolaseANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_261500 OR hydrolase AND Toxoplasma gondii ME49 |
|
TGME49_261530 | TGME49_261530-t26_1 | 4 | 4 | 1 | 470 | 262 | reverse | protein coding | No | 3498 | TGME49_261530 | eukaryotic aspartyl protease superfamily protein | eukaryotic aspartyl protease superfamily protein | 7895463 | | VIIb | TGME49_chrVIIb:1,664,245..1,670,425(-) | TGME49_chrVIIb:1664715..1670163(-) | TGME49_chrVIIb | Toxoplasma gondii ME49 | 23 | OG6_158722 | 0 | 921 | 2766 | 100703 | 7.48 | 0 | | | | | GO:0004190 | aspartic-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_261530OReukaryotic aspartyl protease superfamily proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_261530 OR eukaryotic aspartyl protease superfamily protein AND Toxoplasma gondii ME49 |
|
TGME49_261600 | TGME49_261600-t26_1 | 13 | 13 | 1 | 143 | | forward | protein coding | No | 2804 | TGME49_261600 | creatinase domain-containing protein | creatinase domain-containing protein | 7894848 | | VIIb | TGME49_chrVIIb:1,635,885..1,643,851(+) | TGME49_chrVIIb:1635885..1643708(+) | TGME49_chrVIIb | Toxoplasma gondii ME49 | 30 | OG6_100896 | 0 | 886 | 2661 | 96142 | 7.80 | 0 | | | | | GO:0016787 | hydrolase activity | GO:0009987 | cellular process | | | | | | | 3.4.11.9 (Xaa-Pro aminopeptidase) | 3.4.11.9 (Xaa-Pro aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_261600ORcreatinase domain-containing proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_261600 OR creatinase domain-containing protein AND Toxoplasma gondii ME49 |
|
TGME49_261940 | TGME49_261940-t26_1 | 7 | 7 | 1 | | | forward | protein coding | No | 2535 | TGME49_261940 | hydrolase, alpha/beta fold family protein | hydrolase, alpha/beta fold family protein | 7901041 | S8GM19 | VIIb | TGME49_chrVIIb:1,489,416..1,495,084(+) | TGME49_chrVIIb:1489416..1495084(+) | TGME49_chrVIIb | Toxoplasma gondii ME49 | 25 | OG6_129556 | 0 | 844 | 2535 | 92823 | 6.63 | 0 | | | | | | | | | | | | | | | | 3.4.11.- (Aminopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_261940ORhydrolase, alpha/beta fold family proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_261940 OR hydrolase, alpha/beta fold family protein AND Toxoplasma gondii ME49 |
|
TGME49_262490 | TGME49_262490-t26_1 | 5 | 5 | 1 | 271 | 694 | reverse | protein coding | No | 1748 | TGME49_262490 | alpha/beta hydrolase, putative | alpha/beta hydrolase, putative | 7899070 | S8F1M9 | VIIb | TGME49_chrVIIb:1,209,726..1,213,358(-) | TGME49_chrVIIb:1209997..1212664(-) | TGME49_chrVIIb | Toxoplasma gondii ME49 | 62 | OG6_100915 | 1 | 260 | 783 | 29098 | 8.77 | 0 | | | | | GO:0047372 | acylglycerol lipase activity | | | | | | | | | 3.1.1.23 (Acylglycerol lipase) | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_262490ORalpha/beta hydrolase, putativeANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_262490 OR alpha/beta hydrolase, putative AND Toxoplasma gondii ME49 |
|
TGME49_262575 | TGME49_262575-t26_1 | 5 | 5 | 1 | 183 | | reverse | protein coding | No | 1056 | TGME49_262575 | hypothetical protein | hypothetical protein | | | VIIb | TGME49_chrVIIb:1,152,553..1,155,831(-) | TGME49_chrVIIb:1152736..1155831(-) | TGME49_chrVIIb | Toxoplasma gondii ME49 | 21 | OG6_100948 | 0 | 290 | 873 | 31515 | 7.14 | 1 | | | | | | | | | | | | | | | | 3.4.11.- (Aminopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_262575ORhypothetical proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_262575 OR hypothetical protein AND Toxoplasma gondii ME49 |
|
TGME49_262920 | TGME49_262920-t26_1 | 11 | 11 | 1 | 790 | | forward | protein coding | No | 3709 | TGME49_262920 | trypsin domain-containing protein | trypsin domain-containing protein | 7896674 | | VIIb | TGME49_chrVIIb:922,803..932,353(+) | TGME49_chrVIIb:922803..931563(+) | TGME49_chrVIIb | Toxoplasma gondii ME49 | 111 | OG6_105727 | 2 | 972 | 2919 | 104524 | 6.57 | 1 | HMM: MAAFHRSRRPRARTGVMLLLLSLFVALEVSSW, NN: MAAFHRSRRPRARTGVMLLLLSLFVALEVSSW | NN Sum: 3, NN D: .61, HMM Prob: .98 | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.21.108 (HtrA2 peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_262920ORtrypsin domain-containing proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_262920 OR trypsin domain-containing protein AND Toxoplasma gondii ME49 |
|
TGME49_262940 | TGME49_262940-t26_1 | 19 | 19 | 1 | 204 | 71 | forward | protein coding | No | 1685 | TGME49_262940 | aspartyl proteinase (eimepsin), putative | aspartyl proteinase (eimepsin), putative | 7897238 | Q6PS96 | VIIb | TGME49_chrVIIb:907,367..910,110(+) | TGME49_chrVIIb:907438..909844(+) | TGME49_chrVIIb | Toxoplasma gondii ME49 | 50 | OG6_100536 | 1 | 469 | 1410 | 51306 | 7.53 | 0 | HMM: MRLFHTIACLAVCCCPAFAA, NN: MRLFHTIACLAVCCCPAFAA | NN Sum: 4, NN D: .71, HMM Prob: 1 | | | GO:0004190 | aspartic-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.23.34 (Cathepsin E) | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_262940ORaspartyl proteinase (eimepsin), putativeANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_262940 OR aspartyl proteinase (eimepsin), putative AND Toxoplasma gondii ME49 |
|
TGME49_263290 | TGME49_263290-t26_1 | 9 | 9 | 1 | 69 | 604 | reverse | protein coding | No | 1525 | TGME49_263290 | rhomboid protease ROM2 | rhomboid protease ROM2 | 7896672 | S8GD47 | VIIb | TGME49_chrVIIb:650,740..656,081(-) | TGME49_chrVIIb:650809..655477(-) | TGME49_chrVIIb | Toxoplasma gondii ME49 | 22 | OG6_183612 | 0 | 283 | 852 | 30692 | 7.39 | 7 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | GO:0005794;GO:0005886 | Golgi apparatus;plasma membrane | | | | | 3.4.21.105 (Rhomboid protease) | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_263290ORrhomboid protease ROM2ANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_263290 OR rhomboid protease ROM2 AND Toxoplasma gondii ME49 |
|
TGME49_263420 | TGME49_263420-t26_1 | 21 | 21 | 1 | | | forward | protein coding | No | 3516 | TGME49_263420 | ubiquitin-specific protease USP4 | ubiquitin-specific protease USP4 | 7901056 | | VIIb | TGME49_chrVIIb:563,366..573,403(+) | TGME49_chrVIIb:563366..573403(+) | TGME49_chrVIIb | Toxoplasma gondii ME49 | 39 | OG6_101021 | 0 | 1171 | 3516 | 129786 | 5.13 | 0 | | | | | GO:0004221;GO:0036459 | obsolete ubiquitin thiolesterase activity;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | 3.1.2.15 (Deleted entry) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_263420ORubiquitin-specific protease USP4ANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_263420 OR ubiquitin-specific protease USP4 AND Toxoplasma gondii ME49 |
|
TGME49_263470 | TGME49_263470-t26_1 | 3 | 3 | 1 | | 715 | reverse | protein coding | No | 1510 | TGME49_263470 | ubiquitin carboxyl-terminal hydrolase UCHL3 | ubiquitin carboxyl-terminal hydrolase UCHL3 | 7897234 | S8GD68 | VIIb | TGME49_chrVIIb:540,094..542,627(-) | TGME49_chrVIIb:540094..541912(-) | TGME49_chrVIIb | Toxoplasma gondii ME49 | 30 | OG6_101218 | 0 | 264 | 795 | 29033 | 5.38 | 0 | | | GO:0005622 | intracellular | GO:0004221;GO:0004843 | obsolete ubiquitin thiolesterase activity;thiol-dependent ubiquitin-specific protease activity | GO:0006511 | ubiquitin-dependent protein catabolic process | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_263470ORubiquitin carboxyl-terminal hydrolase UCHL3ANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_263470 OR ubiquitin carboxyl-terminal hydrolase UCHL3 AND Toxoplasma gondii ME49 |
|
TGME49_265190 | TGME49_265190-t26_1 | 9 | 9 | 1 | 472 | | forward | protein coding | No | 9556 | TGME49_265190 | Ulp1 protease family, C-terminal catalytic domain-containing protein | Ulp1 protease family, C-terminal catalytic domain-containing protein | 7900698 | S8EZB2 | IX | TGME49_chrIX:1,711,745..1,725,511(+) | TGME49_chrIX:1711745..1725039(+) | TGME49_chrIX | Toxoplasma gondii ME49 | 14 | OG6_490190 | 0 | 3027 | 9084 | 329625 | 4.74 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.22.68 (Ulp1 peptidase) | 3.4.22.68 (Ulp1 peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_265190ORUlp1 protease family, C-terminal catalytic domain-containing proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_265190 OR Ulp1 protease family, C-terminal catalytic domain-containing protein AND Toxoplasma gondii ME49 |
|
TGME49_265205 | TGME49_265205-t26_1 | 13 | 13 | 1 | | | reverse | protein coding | No | 4320 | TGME49_265205 | WD domain, G-beta repeat-containing protein | WD domain, G-beta repeat-containing protein | 7,90,06,99,79,00,700 | | IX | TGME49_chrIX:1,695,191..1,704,879(-) | TGME49_chrIX:1695191..1704879(-) | TGME49_chrIX | Toxoplasma gondii ME49 | 26 | OG6_102663 | 0 | 1439 | 4320 | 163509 | 5.45 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_265205ORWD domain, G-beta repeat-containing proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_265205 OR WD domain, G-beta repeat-containing protein AND Toxoplasma gondii ME49 |
|
TGME49_265780 | TGME49_265780-t26_1 | 8 | 8 | 1 | 1526 | 411 | forward | protein coding | No | 10349 | TGME49_265780 | flagellar/basal body protein | flagellar/basal body protein | 7898122 | | IX | TGME49_chrIX:1,453,596..1,467,919(+) | TGME49_chrIX:1454007..1466393(+) | TGME49_chrIX | Toxoplasma gondii ME49 | 18 | OG6_132969 | 0 | 2803 | 8412 | 298036 | 9.49 | 0 | HMM: MPAFFREAKLHHFGSAVCSCSRSLLVSAG, NN: MPAFFREAKLHHFGSAVCSCSRSLLVSAGGSSE | NN Sum: 0, NN D: .17, HMM Prob: .5 | | | GO:0004181;GO:0008270 | metallocarboxypeptidase activity;zinc ion binding | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_265780ORflagellar/basal body proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_265780 OR flagellar/basal body protein AND Toxoplasma gondii ME49 |
|
TGME49_266140 | TGME49_266140-t26_1 | 9 | 9 | 1 | 600 | 1051 | reverse | protein coding | No | 2788 | TGME49_266140 | peptidase, M50 family protein | peptidase, M50 family protein | 7893824 | S8G7G4 | IX | TGME49_chrIX:1,271,228..1,279,358(-) | TGME49_chrIX:1271828..1278307(-) | TGME49_chrIX | Toxoplasma gondii ME49 | 24 | OG6_107106 | 0 | 378 | 1137 | 41656 | 7.55 | 6 | | | | | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_266140ORpeptidase, M50 family proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_266140 OR peptidase, M50 family protein AND Toxoplasma gondii ME49 |
|
TGME49_267050 | TGME49_267050-t26_1 | 4 | 4 | 1 | 960 | 174 | forward | protein coding | No | 2061 | TGME49_267050 | hydrolase, alpha/beta fold family protein | hydrolase, alpha/beta fold family protein | 7900897 | B9Q1S8 | IX | TGME49_chrIX:801,690..805,452(+) | TGME49_chrIX:801864..804492(+) | TGME49_chrIX | Toxoplasma gondii ME49 | 18 | OG6_106560 | 0 | 308 | 927 | 34048 | 7.03 | 0 | | | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_267050ORhydrolase, alpha/beta fold family proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_267050 OR hydrolase, alpha/beta fold family protein AND Toxoplasma gondii ME49 |
|
TGME49_267080 | TGME49_267080-t26_1 | 11 | 11 | 1 | 1361 | 404 | forward | protein coding | No | 3091 | TGME49_267080 | 26S protease regulatory subunit 4, putative | 26S protease regulatory subunit 4, putative | 7900900 | S8G794 | IX | TGME49_chrIX:788,255..795,439(+) | TGME49_chrIX:788659..794078(+) | TGME49_chrIX | Toxoplasma gondii ME49 | 32 | OG6_101477 | 0 | 441 | 1326 | 49120 | 6.35 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016887;GO:0009378;GO:0016787;GO:0008568 | ATP binding;ATPase activity;four-way junction helicase activity;hydrolase activity;microtubule-severing ATPase activity | GO:0006310;GO:0006281;GO:0030163 | DNA recombination;DNA repair;protein catabolic process | | | | | | | 3.6.4.3 (Transferred entry: 5.6.1.1) | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_267080OR26S protease regulatory subunit 4, putativeANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_267080 OR 26S protease regulatory subunit 4, putative AND Toxoplasma gondii ME49 |
|
TGME49_267490 | TGME49_267490-t26_1 | 19 | 19 | 1 | 634 | 31 | forward | protein coding | No | 2477 | TGME49_267490 | preprocathepsin c precursor, putative | preprocathepsin c precursor, putative | 7900929 | | IX | TGME49_chrIX:613,017..616,554(+) | TGME49_chrIX:613048..615855(+) | TGME49_chrIX | Toxoplasma gondii ME49 | 50 | OG6_103622 | 1 | 603 | 1812 | 67625 | 7.49 | 0 | HMM: MKLVGIGIVTVGGLGVARAD, NN: MKLVGIGIVTVGGLGVARAD | NN Sum: 4, NN D: .69, HMM Prob: .97 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.14.1 (Dipeptidyl-peptidase I) | 3.4.14.1 (Dipeptidyl-peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_267490ORpreprocathepsin c precursor, putativeANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_267490 OR preprocathepsin c precursor, putative AND Toxoplasma gondii ME49 |
|
TGME49_268280 | TGME49_268280-t26_1 | 11 | 11 | 1 | 31 | 179 | reverse | protein coding | No | 4428 | TGME49_268280 | 'chromo' (CHRromatin Organization MOdifier) domain-containing protein | 'chromo' (CHRromatin Organization MOdifier) domain-containing protein | 7897030 | | VIII | TGME49_chrVIII:6,574,875..6,586,353(-) | TGME49_chrVIII:6574906..6586174(-) | TGME49_chrVIII | Toxoplasma gondii ME49 | 26 | OG6_101530 | 0 | 1405 | 4218 | 154316 | 5.56 | 0 | | | | | | | GO:0006508 | proteolysis | | | | | | | 3.4.19.3 (Pyroglutamyl-peptidase I) | 3.4.19.3 (Pyroglutamyl-peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_268280OR'chromo' (CHRromatin Organization MOdifier) domain-containing proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_268280 OR 'chromo' (CHRromatin Organization MOdifier) domain-containing protein AND Toxoplasma gondii ME49 |
|
TGME49_268590 | TGME49_268590-t26_1 | 9 | 9 | 1 | | | reverse | protein coding | No | 1998 | TGME49_268590 | rhomboid protease ROM4 | rhomboid protease ROM4 | 7899208 | | VIII | TGME49_chrVIII:6,406,304..6,411,004(-) | TGME49_chrVIII:6406304..6411004(-) | TGME49_chrVIII | Toxoplasma gondii ME49 | 29 | OG6_126349 | 0 | 665 | 1998 | 72362 | 9.19 | 6 | HMM: MHEASEGEIYFPVLVLTLRVVLVQVWTSAVVMAS, NN: MHEASEGEIYFPVLVLTLRVVLVQVWTSAVVMAS | NN Sum: 4, NN D: .63, HMM Prob: .61 | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | GO:0005886 | plasma membrane | | | | | 3.4.21.105 (Rhomboid protease) | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_268590ORrhomboid protease ROM4ANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_268590 OR rhomboid protease ROM4 AND Toxoplasma gondii ME49 |
|
TGME49_268650 | TGME49_268650-t26_1 | 2 | 2 | 1 | | | forward | protein coding | No | 3063 | TGME49_268650 | chaperone clpB protein, putative | chaperone clpB protein, putative | 7899160 | | VIII | TGME49_chrVIII:6,375,106..6,378,379(+) | TGME49_chrVIII:6375106..6378379(+) | TGME49_chrVIII | Toxoplasma gondii ME49 | 120 | OG6_100223 | 3 | 1020 | 3063 | 113343 | 6.49 | 0 | | | | | GO:0005524;GO:0016887 | ATP binding;ATPase activity | GO:0019538 | protein metabolic process | | | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_268650ORchaperone clpB protein, putativeANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_268650 OR chaperone clpB protein, putative AND Toxoplasma gondii ME49 |
|
TGME49_268910 | TGME49_268910-t26_1 | 4 | 4 | 1 | 560 | 149 | forward | protein coding | No | 1357 | TGME49_268910 | signal peptidase I protein | signal peptidase I protein | 7899218 | B6KCL1 | VIII | TGME49_chrVIII:6,204,902..6,208,528(+) | TGME49_chrVIII:6206043..6207968(+) | TGME49_chrVIII | Toxoplasma gondii ME49 | 19 | OG6_100609 | 0 | 215 | 648 | 23729 | 9.77 | 0 | | | | | | | | | | | | | | | | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_268910ORsignal peptidase I proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_268910 OR signal peptidase I protein AND Toxoplasma gondii ME49 |
|
TGME49_269250 | TGME49_269250-t26_1 | 10 | 10 | 1 | 150 | 17 | reverse | protein coding | No | 1199 | TGME49_269250 | Mov34/MPN/PAD-1 family protein | Mov34/MPN/PAD-1 family protein | 7901108 | B9PHD3 | VIII | TGME49_chrVIII:5,963,011..5,968,006(-) | TGME49_chrVIII:5963161..5967989(-) | TGME49_chrVIII | Toxoplasma gondii ME49 | 28 | OG6_102054 | 0 | 343 | 1032 | 38438 | 6.20 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 3.1.3.16 (Protein-serine/threonine phosphatase) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_269250ORMov34/MPN/PAD-1 family proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_269250 OR Mov34/MPN/PAD-1 family protein AND Toxoplasma gondii ME49 |
|
TGME49_269840 | TGME49_269840-t26_1 | 6 | 6 | 1 | 470 | 708 | reverse | protein coding | No | 2123 | TGME49_269840 | proteasome regulatory subunit | proteasome regulatory subunit | 7899171 | B9PHM3 | VIII | TGME49_chrVIII:5,581,096..5,585,453(-) | TGME49_chrVIII:5581566..5584745(-) | TGME49_chrVIII | Toxoplasma gondii ME49 | 26 | OG6_101835 | 0 | 314 | 945 | 35261 | 6.52 | 0 | | | | | GO:0004221;GO:0005515 | obsolete ubiquitin thiolesterase activity;protein binding | | | | | | | | | 3.1.2.15 (Deleted entry) | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_269840ORproteasome regulatory subunitANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_269840 OR proteasome regulatory subunit AND Toxoplasma gondii ME49 |
|
TGME49_269885 | TGME49_269885-t26_1 | 12 | 12 | 1 | 198 | | forward | protein coding | No | 5136 | TGME49_269885 | rhoptry metalloprotease toxolysin TLN1 | rhoptry metalloprotease toxolysin TLN1 | 7,89,45,81,78,95,374 | | VIII | TGME49_chrVIII:5,564,529..5,572,853(+) | TGME49_chrVIII:5564529..5572655(+) | TGME49_chrVIII | Toxoplasma gondii ME49 | 86 | OG6_100422 | 2 | 1645 | 4938 | 182007 | 7.28 | 1 | HMM: MKQGTTRPRVGLTGAVLLLVVWTVAILIDCSSGS, NN: MKQGTTRPRVGLTGAVLLLVVWTVAILIDCSSGS | NN Sum: 4, NN D: .72, HMM Prob: .68 | | | GO:0003824;GO:0046872;GO:0004222;GO:0008270 | catalytic activity;metal ion binding;metalloendopeptidase activity;zinc ion binding | GO:0006508 | proteolysis | | | | | | | 3.4.24.56 (Insulysin) | 3.4.24.56 (Insulysin) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_269885ORrhoptry metalloprotease toxolysin TLN1ANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_269885 OR rhoptry metalloprotease toxolysin TLN1 AND Toxoplasma gondii ME49 |
|
TGME49_269930 | TGME49_269930-t26_1 | 13 | 13 | 1 | | | forward | protein coding | No | 9318 | TGME49_269930 | calcium binding egf domain-containing protein | calcium binding egf domain-containing protein | 7899222 | | VIII | TGME49_chrVIII:5,520,480..5,534,937(+) | TGME49_chrVIII:5520480..5534937(+) | TGME49_chrVIII | Toxoplasma gondii ME49 | 35 | OG6_155864 | 0 | 3105 | 9318 | 337847 | 6.74 | 4 | | | | | GO:0005509 | calcium ion binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_269930ORcalcium binding egf domain-containing proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_269930 OR calcium binding egf domain-containing protein AND Toxoplasma gondii ME49 |
|
TGME49_271070 | TGME49_271070-t26_1 | 4 | 4 | 1 | | | reverse | protein coding | No | 1044 | TGME49_271070 | hypothetical protein | hypothetical protein | 7893466 | | VIII | TGME49_chrVIII:4,741,317..4,742,918(-) | TGME49_chrVIII:4741317..4742918(-) | TGME49_chrVIII | Toxoplasma gondii ME49 | 24 | OG6_154459 | 0 | 347 | 1044 | 38259 | 6.17 | 0 | HMM: MAGVPEPRILCDTMRYLVTVLAIFFFQKCAAL, NN: MAGVPEPRILCDTMRYLVTVLAIFFFQKCAAL | NN Sum: 4, NN D: .6, HMM Prob: .91 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_271070ORhypothetical proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_271070 OR hypothetical protein AND Toxoplasma gondii ME49 |
|
TGME49_271460 | TGME49_271460-t26_1 | 12 | 12 | 1 | | | forward | protein coding | No | 2655 | TGME49_271460 | protein c14orf29, putative | protein c14orf29, putative | 7894592 | | VIII | TGME49_chrVIII:4,478,793..4,487,785(+) | TGME49_chrVIII:4478793..4487785(+) | TGME49_chrVIII | Toxoplasma gondii ME49 | 26 | OG6_105308 | 0 | 884 | 2655 | 97594 | 7.67 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_271460ORprotein c14orf29, putativeANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_271460 OR protein c14orf29, putative AND Toxoplasma gondii ME49 |
|
TGME49_271870 | TGME49_271870-t26_1 | 13 | 13 | 1 | | 546 | reverse | protein coding | No | 4512 | TGME49_271870 | zinc carboxypeptidase superfamily protein | zinc carboxypeptidase superfamily protein | 7893485 | | VIII | TGME49_chrVIII:4,317,745..4,328,668(-) | TGME49_chrVIII:4317745..4328122(-) | TGME49_chrVIII | Toxoplasma gondii ME49 | 27 | OG6_100142 | 0 | 1321 | 3966 | 143153 | 7.11 | 2 | HMM: MTGDAVPSIARRFRAWRPTAFLLLACPYLNLLLSSFSWAS, NN: MTGDAVPSIARRFRAWRPTAFLLLACPYLNLLLSSFSWAS | NN Sum: 2, NN D: .4, HMM Prob: 1 | | | GO:0004181;GO:0008270 | metallocarboxypeptidase activity;zinc ion binding | GO:0006508 | proteolysis | | | | | | | | 3.4.17.- (Metallocarboxypeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_271870ORzinc carboxypeptidase superfamily proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_271870 OR zinc carboxypeptidase superfamily protein AND Toxoplasma gondii ME49 |
|
TGME49_272230 | TGME49_272230-t26_1 | 7 | 7 | 1 | | | reverse | protein coding | No | 1017 | TGME49_272230 | heat shock protein hslv, putative | heat shock protein hslv, putative | 7895044 | S8GJ86 | VIII | TGME49_chrVIII:4,128,570..4,131,896(-) | TGME49_chrVIII:4128570..4131896(-) | TGME49_chrVIII | Toxoplasma gondii ME49 | 29 | OG6_107204 | 0 | 338 | 1017 | 36260 | 8.76 | 0 | | | GO:0009376;GO:0005839 | HslUV protease complex;proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0006508;GO:0051603 | proteolysis;proteolysis involved in cellular protein catabolic process | | | | | | | | 3.4.25.2 (HslU--HslV peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_272230ORheat shock protein hslv, putativeANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_272230 OR heat shock protein hslv, putative AND Toxoplasma gondii ME49 |
|
TGME49_272420 | TGME49_272420-t26_1 | 7 | 7 | 1 | | 470 | reverse | protein coding | No | 2762 | TGME49_272420 | phosphatidylcholine-sterol O-acyltransferase, putative | phosphatidylcholine-sterol O-acyltransferase, putative | 7897022 | S8GJB1 | VIII | TGME49_chrVIII:3,980,388..3,986,026(-) | TGME49_chrVIII:3980388..3985556(-) | TGME49_chrVIII | Toxoplasma gondii ME49 | 29 | OG6_101376 | 0 | 763 | 2292 | 83906 | 5.12 | 0 | HMM: MDFLSGGRKGRVCAKRFRLSPILWFASALVLIPLGCSPF, NN: MDFLSGGRKGRVCAKRFRLSPILWFASAL | NN Sum: 2, NN D: .42, HMM Prob: .76 | | | GO:0008374;GO:0004607 | O-acyltransferase activity;phosphatidylcholine-sterol O-acyltransferase activity | GO:0006629 | lipid metabolic process | | | | | | | 2.3.1.43 (Phosphatidylcholine--sterol O-acyltransferase) | 2.3.1.43 (Phosphatidylcholine--sterol O-acyltransferase) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_272420ORphosphatidylcholine-sterol O-acyltransferase, putativeANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_272420 OR phosphatidylcholine-sterol O-acyltransferase, putative AND Toxoplasma gondii ME49 |
|
TGME49_272510 | TGME49_272510-t26_1 | 17 | 17 | 1 | 198 | | reverse | protein coding | No | 1527 | TGME49_272510 | aspartyl protease | aspartyl protease | 7895038 | | VIII | TGME49_chrVIII:3,927,889..3,930,340(-) | TGME49_chrVIII:3928087..3930340(-) | TGME49_chrVIII | Toxoplasma gondii ME49 | 18 | OG6_139465 | 0 | 442 | 1329 | 49231 | 5.70 | 0 | HMM: MKVWQLTVLASLWGTALHSTAAK, NN: MKVWQLTVLASLWGTALHSTAAK | NN Sum: 4, NN D: .69, HMM Prob: 1 | | | GO:0004190 | aspartic-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.23.1 (Pepsin A) | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_272510ORaspartyl proteaseANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_272510 OR aspartyl protease AND Toxoplasma gondii ME49 |
|
TGME49_272670 | TGME49_272670-t26_1 | 13 | 13 | 1 | | | reverse | protein coding | No | 3285 | TGME49_272670 | peptidase family M3 protein | peptidase family M3 protein | 7893474 | S8GJE2 | VIII | TGME49_chrVIII:3,798,379..3,809,166(-) | TGME49_chrVIII:3798379..3809166(-) | TGME49_chrVIII | Toxoplasma gondii ME49 | 44 | OG6_102110 | 0 | 1094 | 3285 | 118222 | 8.10 | 0 | HMM: MHARSGLLLRGVQAAGGRAH, NN: MHARSGLLLRGVQAAGGRAH | NN Sum: 0, NN D: .18, HMM Prob: .67 | | | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.24.59 (Mitochondrial intermediate peptidase) | 3.4.24.59 (Mitochondrial intermediate peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_272670ORpeptidase family M3 proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_272670 OR peptidase family M3 protein AND Toxoplasma gondii ME49 |
|
TGME49_275690 | TGME49_275690-t26_1 | 17 | 17 | 1 | 797 | 643 | forward | protein coding | No | 4509 | TGME49_275690 | ClpB, putative | ClpB, putative | 7893716 | | III | TGME49_chrIII:267,834..280,795(+) | TGME49_chrIII:268477..279998(+) | TGME49_chrIII | Toxoplasma gondii ME49 | 120 | OG6_100223 | 3 | 1022 | 3069 | 114549 | 8.24 | 0 | HMM: MQRSCLQISGCSALYLPMAWPRGLSGPPRGRSRRLTPRGRLLFLRGALLVALVQQTVGH, NN: MQRSCLQISGCSALYLPMAWPRGLSGPPRGRSRRLTPRGRLLFLRGALLVALVQQTVGH | NN Sum: 1, NN D: .28, HMM Prob: .73 | GO:0005737;GO:0005622 | cytoplasm;intracellular | GO:0005524;GO:0016887;GO:0008134 | ATP binding;ATPase activity;transcription factor binding | GO:0019538;GO:0042026;GO:0006355;GO:0009408 | protein metabolic process;protein refolding;regulation of transcription, DNA-templated;response to heat | | | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_275690ORClpB, putativeANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_275690 OR ClpB, putative AND Toxoplasma gondii ME49 |
|
TGME49_276130 | TGME49_276130-t26_1 | 10 | 10 | 1 | 406 | 1232 | reverse | protein coding | No | 3900 | TGME49_276130 | cathepsin CPC2 | cathepsin CPC2 | 7893739 | Q1AMF2 | III | TGME49_chrIII:125,876..135,979(-) | TGME49_chrIII:126282..134747(-) | TGME49_chrIII | Toxoplasma gondii ME49 | 23 | OG6_148524 | 0 | 753 | 2262 | 82982 | 5.28 | 0 | HMM: MSAAVEPRGRLSDGCCRRRLTPAAVLFLCRVLVLFWVNEAE, NN: MSAAVEPRGRLSDGCCRRRLTPAAVLFLCRVLVLFWVNEAE | NN Sum: 2, NN D: .42, HMM Prob: .99 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | GO:0045177 | apical part of cell | | | | | 3.4.14.1 (Dipeptidyl-peptidase I) | 3.4.14.1 (Dipeptidyl-peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_276130ORcathepsin CPC2ANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_276130 OR cathepsin CPC2 AND Toxoplasma gondii ME49 |
|
TGME49_277500 | TGME49_277500-t26_1 | 8 | 8 | 1 | 1302 | 1031 | forward | protein coding | No | 3764 | TGME49_277500 | 26S proteasome regulatory subunit 7, putative | 26S proteasome regulatory subunit 7, putative | 7898753 | B6KRJ2 | XII | TGME49_chrXII:6,659,663..6,666,666(+) | TGME49_chrXII:6660694..6665364(+) | TGME49_chrXII | Toxoplasma gondii ME49 | 30 | OG6_101899 | 0 | 476 | 1431 | 52367 | 7.18 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016887;GO:0016787 | ATP binding;ATPase activity;hydrolase activity | GO:0030163 | protein catabolic process | | | | | | | 3.6.1.3 (Adenosinetriphosphatase) | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_277500OR26S proteasome regulatory subunit 7, putativeANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_277500 OR 26S proteasome regulatory subunit 7, putative AND Toxoplasma gondii ME49 |
|
TGME49_277850 | TGME49_277850-t26_1 | 10 | 10 | 1 | 425 | 567 | forward | protein coding | No | 3239 | TGME49_277850 | trypsin domain-containing protein | trypsin domain-containing protein | 7900348 | | XII | TGME49_chrXII:6,474,968..6,482,993(+) | TGME49_chrXII:6475535..6482568(+) | TGME49_chrXII | Toxoplasma gondii ME49 | 111 | OG6_105727 | 2 | 748 | 2247 | 81695 | 9.98 | 0 | | | | | GO:0005515;GO:0004252 | protein binding;serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.21.108 (HtrA2 peptidase) | 3.4.21.108 (HtrA2 peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_277850ORtrypsin domain-containing proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_277850 OR trypsin domain-containing protein AND Toxoplasma gondii ME49 |
|
TGME49_277990 | TGME49_277990-t26_1 | 2 | 2 | 1 | 490 | 1033 | reverse | protein coding | No | 3044 | TGME49_277990 | OTU family cysteine protease | OTU family cysteine protease | 7900361 | S8ESW9 | XII | TGME49_chrXII:6,368,924..6,372,127(-) | TGME49_chrXII:6369414..6371094(-) | TGME49_chrXII | Toxoplasma gondii ME49 | 22 | OG6_102949 | 0 | 506 | 1521 | 55508 | 7.32 | 0 | | | | | | | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_277990OROTU family cysteine proteaseANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_277990 OR OTU family cysteine protease AND Toxoplasma gondii ME49 |
|
TGME49_278050 | TGME49_278050-t26_1 | 9 | 9 | 1 | 313 | 620 | reverse | protein coding | No | 1677 | TGME49_278050 | proteasome subunit alpha type 1, putative | proteasome subunit alpha type 1, putative | 7900367 | S8ESW5 | XII | TGME49_chrXII:6,331,009..6,337,086(-) | TGME49_chrXII:6331322..6336466(-) | TGME49_chrXII | Toxoplasma gondii ME49 | 31 | OG6_102143 | 0 | 247 | 744 | 27240 | 6.30 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_278050ORproteasome subunit alpha type 1, putativeANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_278050 OR proteasome subunit alpha type 1, putative AND Toxoplasma gondii ME49 |
|
TGME49_278975 | TGME49_278975-t26_1 | 10 | 10 | 1 | 705 | 1145 | reverse | protein coding | No | 5885 | TGME49_278975 | ICE family protease (caspase) p20 domain-containing protein | ICE family protease (caspase) p20 domain-containing protein | 7,90,15,53,79,01,554 | | XII | TGME49_chrXII:5,711,668..5,720,571(-) | TGME49_chrXII:5712373..5719426(-) | TGME49_chrXII | Toxoplasma gondii ME49 | 32 | OG6_119794 | 0 | 1344 | 4035 | 145022 | 9.11 | 0 | | | | | GO:0004197 | cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_278975ORICE family protease (caspase) p20 domain-containing proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_278975 OR ICE family protease (caspase) p20 domain-containing protein AND Toxoplasma gondii ME49 |
|
TGME49_279390 | TGME49_279390-t26_1 | 9 | 9 | 1 | 1302 | 866 | reverse | protein coding | No | 3557 | TGME49_279390 | proliferation-associated protein 2G4, putative | proliferation-associated protein 2G4, putative | 7895894 | S8GGC0 | IX | TGME49_chrIX:206,905..213,689(-) | TGME49_chrIX:208207..212823(-) | TGME49_chrIX | Toxoplasma gondii ME49 | 28 | OG6_101895 | 0 | 462 | 1389 | 50341 | 6.66 | 0 | | | | | | | GO:0009987 | cellular process | | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_279390ORproliferation-associated protein 2G4, putativeANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_279390 OR proliferation-associated protein 2G4, putative AND Toxoplasma gondii ME49 |
|
TGME49_280710 | TGME49_280710-t26_1 | 7 | 7 | 1 | 347 | | reverse | protein coding | No | 1148 | TGME49_280710 | 20S proteasome subunit beta 7, putative | 20S proteasome subunit beta 7, putative | 7899776 | S7UUN4 | VIIa | TGME49_chrVIIa:156,049..160,728(-) | TGME49_chrVIIa:156396..160728(-) | TGME49_chrVIIa | Toxoplasma gondii ME49 | 26 | OG6_101718 | 0 | 266 | 801 | 30266 | 5.91 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_280710OR20S proteasome subunit beta 7, putativeANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_280710 OR 20S proteasome subunit beta 7, putative AND Toxoplasma gondii ME49 |
|
TGME49_280720 | TGME49_280720-t26_1 | 1 | 1 | 1 | 820 | 201 | forward | protein coding | No | 2692 | TGME49_280720 | hypothetical protein | hypothetical protein | 7899777 | | VIIa | TGME49_chrVIIa:152,212..154,903(+) | TGME49_chrVIIa:152413..154083(+) | TGME49_chrVIIa | Toxoplasma gondii ME49 | 16 | OG6_490508 | 0 | 556 | 1671 | 60794 | 11.80 | 1 | HMM: MRRTVSTPVLCASVCVVLVSVALLHAT, NN: MRRTVSTPVLCASVCVVLVSVALLHAT | NN Sum: 4, NN D: .73, HMM Prob: .99 | GO:0016020 | membrane | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_280720ORhypothetical proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_280720 OR hypothetical protein AND Toxoplasma gondii ME49 |
|
TGME49_280740 | TGME49_280740-t26_1 | 4 | 4 | 1 | 524 | 736 | reverse | protein coding | No | 1932 | TGME49_280740 | signal peptidase | signal peptidase | 7899779 | B9Q1Z7 | VIIa | TGME49_chrVIIa:129,953..134,063(-) | TGME49_chrVIIa:130477..133327(-) | TGME49_chrVIIa | Toxoplasma gondii ME49 | 33 | OG6_100807 | 0 | 223 | 672 | 24663 | 8.46 | 1 | | | GO:0016020 | membrane | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | | | | | | | | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_280740ORsignal peptidaseANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_280740 OR signal peptidase AND Toxoplasma gondii ME49 |
|
TGME49_281490 | TGME49_281490-t26_1 | 7 | 7 | 1 | 691 | 643 | forward | protein coding | No | 2189 | TGME49_281490 | glutamine amidotransferase subunit pdxt, putative | glutamine amidotransferase subunit pdxt, putative | 7898586 | S8GP52 | VIIa | TGME49_chrVIIa:4,148,104..4,153,219(+) | TGME49_chrVIIa:4148747..4152528(+) | TGME49_chrVIIa | Toxoplasma gondii ME49 | 19 | OG6_103407 | 0 | 284 | 855 | 30485 | 7.15 | 0 | | | | | GO:0003824;GO:0004359 | catalytic activity;glutaminase activity | GO:0009236;GO:0042823;GO:0042819 | cobalamin biosynthetic process;pyridoxal phosphate biosynthetic process;vitamin B6 biosynthetic process | | | | | | | | 3.5.1.2 (Glutaminase) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_281490ORglutamine amidotransferase subunit pdxt, putativeANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_281490 OR glutamine amidotransferase subunit pdxt, putative AND Toxoplasma gondii ME49 |
|
TGME49_282200 | TGME49_282200-t26_1 | 17 | 17 | 1 | 746 | 115 | forward | protein coding | No | 3549 | TGME49_282200 | ATPase, AAA family protein | ATPase, AAA family protein | 7899734 | | VIIa | TGME49_chrVIIa:4,441,908..4,450,248(+) | TGME49_chrVIIa:4442652..4449502(+) | TGME49_chrVIIa | Toxoplasma gondii ME49 | 120 | OG6_100223 | 3 | 895 | 2688 | 99478 | 7.72 | 0 | HMM: MYMRHRQITPVHFLTVLLEVQGE, NN: MYMRHRQITPVHFLTVLLEVQGE | NN Sum: 3, NN D: .49, HMM Prob: .43 | GO:0005622 | intracellular | GO:0005524;GO:0016887;GO:0008134 | ATP binding;ATPase activity;transcription factor binding | GO:0019538;GO:0006355 | protein metabolic process;regulation of transcription, DNA-templated | | | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_282200ORATPase, AAA family proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_282200 OR ATPase, AAA family protein AND Toxoplasma gondii ME49 |
|
TGME49_285670 | TGME49_285670-t26_1 | 2 | 2 | 1 | 1302 | 1283 | reverse | protein coding | No | 3368 | TGME49_285670 | hypothetical protein | hypothetical protein | 7896941 | B6KMY2 | V | TGME49_chrV:2,294,198..2,298,292(-) | TGME49_chrV:2295500..2297009(-) | TGME49_chrV | Toxoplasma gondii ME49 | 21 | OG6_110253 | 0 | 260 | 783 | 28981 | 6.60 | 6 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_285670ORhypothetical proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_285670 OR hypothetical protein AND Toxoplasma gondii ME49 |
|
TGME49_286120 | TGME49_286120-t26_1 | 16 | 16 | 1 | 432 | 109 | reverse | protein coding | No | 3019 | TGME49_286120 | prolyl endopeptidase | prolyl endopeptidase | 7898165 | S8F5F2 | V | TGME49_chrV:1,975,509..1,985,105(-) | TGME49_chrV:1975941..1984996(-) | TGME49_chrV | Toxoplasma gondii ME49 | 29 | OG6_101804 | 0 | 825 | 2478 | 93070 | 6.91 | 0 | HMM: MLTSWLSVRCCSLIHIGGGR, NN: MLTSWLSVRCCSLIHIGGGR | NN Sum: 0, NN D: .35, HMM Prob: .57 | | | GO:0004252;GO:0070008;GO:0008236 | serine-type endopeptidase activity;serine-type exopeptidase activity;serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.21.26 (Prolyl oligopeptidase) | 3.4.21.26 (Prolyl oligopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_286120ORprolyl endopeptidaseANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_286120 OR prolyl endopeptidase AND Toxoplasma gondii ME49 |
|
TGME49_286580 | TGME49_286580-t26_1 | 1 | 1 | 1 | 1901 | 1196 | reverse | protein coding | No | 5965 | TGME49_286580 | hypothetical protein | hypothetical protein | 7898200 | S8F5C0 | V | TGME49_chrV:1,774,348..1,780,312(-) | TGME49_chrV:1776249..1779116(-) | TGME49_chrV | Toxoplasma gondii ME49 | 19 | OG6_223134 | 0 | 955 | 2868 | 107244 | 5.36 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_286580ORhypothetical proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_286580 OR hypothetical protein AND Toxoplasma gondii ME49 |
|
TGME49_287210 | TGME49_287210-t26_1 | 4 | 4 | 1 | 812 | 2712 | reverse | protein coding | No | 4235 | TGME49_287210 | proteasome subunit alpha2, protease of the acylase family and NTN hydrolase fold, putative | proteasome subunit alpha2, protease of the acylase family and NTN hydrolase fold, putative | 7896203 | B9PSG2 | V | TGME49_chrV:1,523,431..1,529,796(-) | TGME49_chrV:1524243..1527084(-) | TGME49_chrV | Toxoplasma gondii ME49 | 28 | OG6_101969 | 0 | 236 | 711 | 25867 | 4.99 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_287210ORproteasome subunit alpha2, protease of the acylase family and NTN hydrolase fold, putativeANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_287210 OR proteasome subunit alpha2, protease of the acylase family and NTN hydrolase fold, putative AND Toxoplasma gondii ME49 |
|
TGME49_288510 | TGME49_288510-t26_1 | 4 | 4 | 1 | 910 | 1345 | reverse | protein coding | No | 6242 | TGME49_288510 | ubiquitin carboxyl-terminal hydrolase | ubiquitin carboxyl-terminal hydrolase | 7896408 | | IX | TGME49_chrIX:2,586,763..2,594,266(-) | TGME49_chrIX:2587673..2592921(-) | TGME49_chrIX | Toxoplasma gondii ME49 | 17 | OG6_179549 | 0 | 1328 | 3987 | 145759 | 6.87 | 0 | | | | | GO:0004221;GO:0036459 | obsolete ubiquitin thiolesterase activity;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_288510ORubiquitin carboxyl-terminal hydrolaseANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_288510 OR ubiquitin carboxyl-terminal hydrolase AND Toxoplasma gondii ME49 |
|
TGME49_289330 | TGME49_289330-t26_1 | 15 | 15 | 1 | 966 | 1381 | forward | protein coding | No | 9241 | TGME49_289330 | ubiquitin carboxyl-terminal hydrolase family 2 protein | ubiquitin carboxyl-terminal hydrolase family 2 protein | 7896419 | | IX | TGME49_chrIX:3,194,819..3,209,265(+) | TGME49_chrIX:3196200..3208299(+) | TGME49_chrIX | Toxoplasma gondii ME49 | 33 | OG6_101317 | 0 | 2297 | 6894 | 248335 | 5.91 | 0 | | | | | GO:0004221;GO:0036459 | obsolete ubiquitin thiolesterase activity;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | 3.1.2.15 (Deleted entry) | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_289330ORubiquitin carboxyl-terminal hydrolase family 2 proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_289330 OR ubiquitin carboxyl-terminal hydrolase family 2 protein AND Toxoplasma gondii ME49 |
|
TGME49_289620 | TGME49_289620-t26_1 | 9 | 9 | 1 | 461 | 574 | reverse | protein coding | No | 3237 | TGME49_289620 | cathepsin CPC1 | cathepsin CPC1 | 7899372 | S7UPV8 | IX | TGME49_chrIX:3,350,849..3,357,154(-) | TGME49_chrIX:3351310..3356580(-) | TGME49_chrIX | Toxoplasma gondii ME49 | 50 | OG6_103622 | 1 | 733 | 2202 | 79233 | 5.64 | 1 | HMM: MEGMGSLRRRCAALPLVAGFLVFLGSIGVKAD, NN: MEGMGSLRRRCAALPLVAGFLVFLGSIGVKAD | NN Sum: 3, NN D: .67, HMM Prob: .68 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | GO:0045177 | apical part of cell | | | | | 3.4.14.1 (Dipeptidyl-peptidase I) | 3.4.14.1 (Dipeptidyl-peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_289620ORcathepsin CPC1ANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_289620 OR cathepsin CPC1 AND Toxoplasma gondii ME49 |
|
TGME49_289780 | TGME49_289780-t26_1 | 14 | 14 | 1 | 1067 | 1708 | reverse | protein coding | No | 5589 | TGME49_289780 | ATP-dependent hsl protease ATP-binding subunit hslU, putative | ATP-dependent hsl protease ATP-binding subunit hslU, putative | 7897781 | | IX | TGME49_chrIX:3,440,675..3,453,918(-) | TGME49_chrIX:3441742..3452210(-) | TGME49_chrIX | Toxoplasma gondii ME49 | 28 | OG6_106348 | 0 | 937 | 2814 | 101617 | 9.20 | 0 | | | GO:0009376;GO:0005737 | HslUV protease complex;cytoplasm | GO:0005524;GO:0016887;GO:0070011 | ATP binding;ATPase activity;peptidase activity, acting on L-amino acid peptides | | | | | | | | | | 2.7.1.71 (Shikimate kinase) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_289780ORATP-dependent hsl protease ATP-binding subunit hslU, putativeANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_289780 OR ATP-dependent hsl protease ATP-binding subunit hslU, putative AND Toxoplasma gondii ME49 |
|
TGME49_289880 | TGME49_289880-t26_1 | 16 | 16 | 1 | 733 | 1236 | reverse | protein coding | No | 5950 | TGME49_289880 | hypothetical protein | hypothetical protein | 7897804 | | IX | TGME49_chrIX:3,492,699..3,506,481(-) | TGME49_chrIX:3493432..3505245(-) | TGME49_chrIX | Toxoplasma gondii ME49 | 37 | OG6_113142 | 0 | 1326 | 3981 | 148656 | 7.87 | 2 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_289880ORhypothetical proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_289880 OR hypothetical protein AND Toxoplasma gondii ME49 |
|
TGME49_290005 | TGME49_290005-t26_1 | 8 | 8 | 1 | 1770 | | reverse | protein coding | No | 2850 | TGME49_290005 | proteasome subunit beta type 1, putative | proteasome subunit beta type 1, putative | | | IX | TGME49_chrIX:3,577,414..3,584,012(-) | TGME49_chrIX:3579184..3584012(-) | TGME49_chrIX | Toxoplasma gondii ME49 | 27 | OG6_101631 | 0 | 359 | 1080 | 39915 | 9.38 | 1 | HMM: MHALRTQAHTWKKTRRTRLSRQRKRSNFVTLCFFVLLEIRPSELI, NN: MHALRTQAHTWKKTRRTRLSRQRKRSNFVTLCFFVLLEIRPSELI | NN Sum: 0, NN D: .24, HMM Prob: .84 | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_290005ORproteasome subunit beta type 1, putativeANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_290005 OR proteasome subunit beta type 1, putative AND Toxoplasma gondii ME49 |
|
TGME49_290670 | TGME49_290670-t26_1 | 9 | 9 | 1 | 2464 | 1262 | forward | protein coding | No | 6072 | TGME49_290670 | leucyl aminopeptidase LAP | leucyl aminopeptidase LAP | 7896543 | | IX | TGME49_chrIX:3,828,049..3,836,902(+) | TGME49_chrIX:3829311..3834438(+) | TGME49_chrIX | Toxoplasma gondii ME49 | 27 | OG6_100682 | 0 | 781 | 2346 | 83236 | 9.25 | 0 | HMM: MVPPSPGASCLLSRTRQRNVLPLACSLCLYTVTVCSAL, NN: MVPPSPGASCLLSRTRQRNVLPLACSLCLYTVTVCSAL | NN Sum: 1, NN D: .39, HMM Prob: .88 | GO:0005622 | intracellular | GO:0004177 | aminopeptidase activity | GO:0006508 | proteolysis | GO:0005737 | cytoplasm | | | | | 3.4.11.1 (Leucyl aminopeptidase) | 3.4.11.1 (Leucyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_290670ORleucyl aminopeptidase LAPANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_290670 OR leucyl aminopeptidase LAP AND Toxoplasma gondii ME49 |
|
TGME49_290840 | TGME49_290840-t26_1 | 9 | 9 | 1 | 503 | | forward | protein coding | No | 3386 | TGME49_290840 | serine protease | serine protease | 7896550 | S8F082 | IX | TGME49_chrIX:3,878,405..3,885,241(+) | TGME49_chrIX:3878405..3884738(+) | TGME49_chrIX | Toxoplasma gondii ME49 | 111 | OG6_105727 | 2 | 960 | 2883 | 102738 | 8.71 | 1 | HMM: MVGGVCSPFAVADFSSLLALKSPFFAALGLSRLFCMQPVETHSH, NN: MVGGVCSPFAVADFSSLLALKSPFFAALGLSRLFCM | NN Sum: 0, NN D: .31, HMM Prob: .53 | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.21.108 (HtrA2 peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_290840ORserine proteaseANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_290840 OR serine protease AND Toxoplasma gondii ME49 |
|
TGME49_293820 | TGME49_293820-t26_1 | 10 | 10 | 1 | 1095 | | reverse | protein coding | No | 7905 | TGME49_293820 | calpain family cysteine protease domain-containing protein | calpain family cysteine protease domain-containing protein | 7900202 | | Ia | TGME49_chrIa:574,090..586,420(-) | TGME49_chrIa:575185..586420(-) | TGME49_chrIa | Toxoplasma gondii ME49 | 27 | OG6_103851 | 0 | 2269 | 6810 | 243929 | 8.49 | 0 | HMM: MKGFASSFSLLPPTFPVSSAS, NN: MKGFASSFSLLPPTFPVSSAS | NN Sum: 0, NN D: .35, HMM Prob: .96 | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_293820ORcalpain family cysteine protease domain-containing proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_293820 OR calpain family cysteine protease domain-containing protein AND Toxoplasma gondii ME49 |
|
TGME49_294190 | TGME49_294190-t26_1 | 14 | 14 | 1 | 34 | | forward | protein coding | No | 2185 | TGME49_294190 | enoyl-CoA hydratase/isomerase family protein | enoyl-CoA hydratase/isomerase family protein | 7900217 | | Ia | TGME49_chrIa:685,834..696,063(+) | TGME49_chrIa:685834..696029(+) | TGME49_chrIa | Toxoplasma gondii ME49 | 42 | OG6_134153 | 0 | 716 | 2151 | 80236 | 8.54 | 0 | | | | | GO:0003860;GO:0003824 | 3-hydroxyisobutyryl-CoA hydrolase activity;catalytic activity | GO:0008152 | metabolic process | | | | | | | 3.1.2.4 (3-hydroxyisobutyryl-CoA hydrolase) | 3.1.2.4 (3-hydroxyisobutyryl-CoA hydrolase) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_294190ORenoyl-CoA hydratase/isomerase family proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_294190 OR enoyl-CoA hydratase/isomerase family protein AND Toxoplasma gondii ME49 |
|
TGME49_294290 | TGME49_294290-t26_1 | 3 | 3 | 1 | 197 | 549 | reverse | protein coding | No | 1628 | TGME49_294290 | Der1ER1 | Der1ER1 | 7900227 | B9PY98 | Ia | TGME49_chrIa:784,188..786,093(-) | TGME49_chrIa:784385..785544(-) | TGME49_chrIa | Toxoplasma gondii ME49 | 23 | OG6_113960 | 0 | 293 | 882 | 32058 | 8.82 | 5 | | | | | | | | | GO:0005783 | endoplasmic reticulum | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_294290ORDer1ER1ANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_294290 OR Der1ER1 AND Toxoplasma gondii ME49 |
|
TGME49_294360 | TGME49_294360-t26_1 | 12 | 12 | 1 | 1201 | 1484 | forward | protein coding | No | 4401 | TGME49_294360 | ubiquitin specific protease 39 isoform 2, putative | ubiquitin specific protease 39 isoform 2, putative | 7900234 | B6KQU2 | Ia | TGME49_chrIa:839,422..850,058(+) | TGME49_chrIa:840906..848857(+) | TGME49_chrIa | Toxoplasma gondii ME49 | 31 | OG6_102786 | 0 | 571 | 1716 | 64189 | 6.17 | 0 | | | | | GO:0004221;GO:0036459;GO:0008270 | obsolete ubiquitin thiolesterase activity;thiol-dependent ubiquitinyl hydrolase activity;zinc ion binding | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | 3.1.2.15 (Deleted entry) | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_294360ORubiquitin specific protease 39 isoform 2, putativeANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_294360 OR ubiquitin specific protease 39 isoform 2, putative AND Toxoplasma gondii ME49 |
|
TGME49_294630 | TGME49_294630-t26_1 | 14 | 14 | 1 | 1594 | 1590 | forward | protein coding | No | 5827 | TGME49_294630 | hypothetical protein | hypothetical protein | 7900251 | | Ia | TGME49_chrIa:1,013,379..1,025,958(+) | TGME49_chrIa:1015457..1024364(+) | TGME49_chrIa | Toxoplasma gondii ME49 | 25 | OG6_129725 | 0 | 880 | 2643 | 95708 | 7.10 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_294630ORhypothetical proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_294630 OR hypothetical protein AND Toxoplasma gondii ME49 |
|
TGME49_294690 | TGME49_294690-t26_1 | 11 | 11 | 1 | 1072 | 1043 | forward | protein coding | No | 4641 | TGME49_294690 | rhomboid protease ROM5 | rhomboid protease ROM5 | 7900257 | Q1JTC9 | Ia | TGME49_chrIa:1,060,612..1,071,510(+) | TGME49_chrIa:1062382..1070438(+) | TGME49_chrIa | Toxoplasma gondii ME49 | 33 | OG6_127785 | 0 | 841 | 2526 | 92101 | 10.21 | 6 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | GO:0005886 | plasma membrane | | | | | 3.4.21.105 (Rhomboid protease) | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_294690ORrhomboid protease ROM5ANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_294690 OR rhomboid protease ROM5 AND Toxoplasma gondii ME49 |
|
TGME49_295400 | TGME49_295400-t26_1 | 5 | 5 | 1 | 1059 | 1839 | reverse | protein coding | No | 5229 | TGME49_295400 | hypothetical protein | hypothetical protein | 7897836 | | Ia | TGME49_chrIa:1,777,660..1,784,461(-) | TGME49_chrIa:1778719..1782622(-) | TGME49_chrIa | Toxoplasma gondii ME49 | 24 | OG6_102202 | 0 | 776 | 2331 | 83986 | 6.05 | 0 | | | | | GO:1990380;GO:0004843 | Lys48-specific deubiquitinase activity;thiol-dependent ubiquitin-specific protease activity | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_295400ORhypothetical proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_295400 OR hypothetical protein AND Toxoplasma gondii ME49 |
|
TGME49_295640 | TGME49_295640-t26_1 | 1 | 1 | 1 | 1112 | 929 | forward | protein coding | No | 5158 | TGME49_295640 | peptidase family M13 protein | peptidase family M13 protein | 7897850 | B9Q266 | Ia | TGME49_chrIa:1,659,797..1,664,954(+) | TGME49_chrIa:1660726..1663842(+) | TGME49_chrIa | Toxoplasma gondii ME49 | 18 | OG6_100162 | 0 | 1038 | 3117 | 117476 | 5.06 | 0 | HMM: MDSLRCPQRFFTPKLLLYLWSGSFLASLLRAT, NN: MDSLRCPQRFFTPKLLLYLWSGSFLASLLRAT | NN Sum: 4, NN D: .64, HMM Prob: .95 | | | GO:0004222;GO:0008237 | metalloendopeptidase activity;metallopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.24.71 (Endothelin-converting enzyme 1) | 3.4.24.71 (Endothelin-converting enzyme 1) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_295640ORpeptidase family M13 proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_295640 OR peptidase family M13 protein AND Toxoplasma gondii ME49 |
|
TGME49_297970 | TGME49_297970-t26_1 | 14 | 14 | 1 | 753 | | forward | protein coding | No | 2280 | TGME49_297970 | aspartyl aminopeptidase | aspartyl aminopeptidase | 7901480 | | II | TGME49_chrII:2,146,242..2,155,633(+) | TGME49_chrII:2146242..2154880(+) | TGME49_chrII | Toxoplasma gondii ME49 | 34 | OG6_102047 | 0 | 508 | 1527 | 55896 | 6.16 | 0 | | | | | GO:0004177;GO:0008270 | aminopeptidase activity;zinc ion binding | GO:0006508 | proteolysis | | | | | | | 3.4.11.21 (Aspartyl aminopeptidase) | 3.4.11.21 (Aspartyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_297970ORaspartyl aminopeptidaseANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_297970 OR aspartyl aminopeptidase AND Toxoplasma gondii ME49 |
|
TGME49_300020 | TGME49_300020-t26_1 | 10 | 10 | 1 | 743 | 1013 | forward | protein coding | No | 4822 | TGME49_300020 | ATP-dependent metallopeptidase HflB subfamily protein | ATP-dependent metallopeptidase HflB subfamily protein | 7895158 | | XII | TGME49_chrXII:270,098..279,523(+) | TGME49_chrXII:271111..278780(+) | TGME49_chrXII | Toxoplasma gondii ME49 | 44 | OG6_101196 | 0 | 1021 | 3066 | 109677 | 8.91 | 2 | HMM: MRSLLAQAPLGPRGTPAQAAALQGTLSTVAVRRIQIGDRRLPTFLSSSLSLASSCASAR, NN: MRSLLAQAPLGPRGTPAQAA | NN Sum: 0, NN D: .16, HMM Prob: .89 | GO:0016020 | membrane | GO:0005524;GO:0009378;GO:0004222;GO:0008568 | ATP binding;four-way junction helicase activity;metalloendopeptidase activity;microtubule-severing ATPase activity | GO:0006310;GO:0006281;GO:0006508 | DNA recombination;DNA repair;proteolysis | | | | | | | 3.6.4.3 (Transferred entry: 5.6.1.1) | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_300020ORATP-dependent metallopeptidase HflB subfamily proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_300020 OR ATP-dependent metallopeptidase HflB subfamily protein AND Toxoplasma gondii ME49 |
|
TGME49_300060 | TGME49_300060-t26_1 | 2 | 2 | 1 | 515 | 1337 | reverse | protein coding | No | 2380 | TGME49_300060 | signal peptidase subunit protein | signal peptidase subunit protein | 7895162 | B9Q2U1 | XII | TGME49_chrXII:233,603..236,395(-) | TGME49_chrXII:234118..235058(-) | TGME49_chrXII | Toxoplasma gondii ME49 | 28 | OG6_102447 | 0 | 175 | 528 | 19499 | 6.25 | 1 | HMM: MDTYLNRGNAVVCTLLAALALAA, NN: MDTYLNRGNAVVCTLLAALALAA | NN Sum: 3, NN D: .58, HMM Prob: .88 | GO:0016021;GO:0005787 | integral component of membrane;signal peptidase complex | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_300060ORsignal peptidase subunit proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_300060 OR signal peptidase subunit protein AND Toxoplasma gondii ME49 |
|
TGME49_300130 | TGME49_300130-t26_1 | 5 | 5 | 1 | 572 | 2148 | reverse | protein coding | No | 4382 | TGME49_300130 | apical membrane antigen 1 domain-containing protein | apical membrane antigen 1 domain-containing protein | 7895169 | | XII | TGME49_chrXII:189,278..195,382(-) | TGME49_chrXII:189850..193234(-) | TGME49_chrXII | Toxoplasma gondii ME49 | 51 | OG6_130922 | 1 | 553 | 1662 | 60674 | 6.60 | 1 | HMM: MTTQTTTKGSSRISRCTVALVFALSACATDAL, NN: MTTQTTTKGSSRISRCTVALVFALSACATDAL | NN Sum: 4, NN D: .65, HMM Prob: .99 | GO:0016020 | membrane | | | GO:0009405 | pathogenesis | GO:0020009 | microneme | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_300130ORapical membrane antigen 1 domain-containing proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_300130 OR apical membrane antigen 1 domain-containing protein AND Toxoplasma gondii ME49 |
|
TGME49_300310 | TGME49_300310-t26_1 | 11 | 11 | 1 | 437 | 1501 | reverse | protein coding | No | 3222 | TGME49_300310 | 26S proteasome regulatory subunit, S6a family AAA ATpase | 26S proteasome regulatory subunit, S6a family AAA ATpase | 7895187 | | XII | TGME49_chrXII:93,484..102,509(-) | TGME49_chrXII:93921..101008(-) | TGME49_chrXII | Toxoplasma gondii ME49 | 42 | OG6_101915 | 0 | 427 | 1284 | 47787 | 4.93 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016887;GO:0009378;GO:0016787;GO:0008568 | ATP binding;ATPase activity;four-way junction helicase activity;hydrolase activity;microtubule-severing ATPase activity | GO:0006310;GO:0006281;GO:0030163 | DNA recombination;DNA repair;protein catabolic process | | | | | | | 3.6.4.3 (Transferred entry: 5.6.1.1) | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_300310OR26S proteasome regulatory subunit, S6a family AAA ATpaseANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_300310 OR 26S proteasome regulatory subunit, S6a family AAA ATpase AND Toxoplasma gondii ME49 |
|
TGME49_301222 | TGME49_301222-t26_1 | 7 | 7 | 1 | 818 | 175 | forward | protein coding | No | 6732 | TGME49_301222 | DNA repair protein Rad4 domain-containing protein | DNA repair protein Rad4 domain-containing protein | 7896736 | | IV | TGME49_chrIV:2,324,788..2,334,642(+) | TGME49_chrIV:2324963..2333824(+) | TGME49_chrIV | Toxoplasma gondii ME49 | 27 | OG6_102113 | 0 | 1912 | 5739 | 207475 | 8.48 | 0 | | | GO:0005634 | nucleus | GO:0003677;GO:0003684 | DNA binding;damaged DNA binding | GO:0006289 | nucleotide-excision repair | | | | | | | | 2.1.1.201 (2-methoxy-6-polyprenyl-1,4-benzoquinol methylase) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_301222ORDNA repair protein Rad4 domain-containing proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_301222 OR DNA repair protein Rad4 domain-containing protein AND Toxoplasma gondii ME49 |
|
TGME49_304680 | TGME49_304680-t26_1 | 7 | 7 | 1 | 701 | 251 | reverse | protein coding | No | 2536 | TGME49_304680 | ubiquitin family protein | ubiquitin family protein | 7893859 | S7W9N7 | VIIa | TGME49_chrVIIa:620,078..625,322(-) | TGME49_chrVIIa:620779..625071(-) | TGME49_chrVIIa | Toxoplasma gondii ME49 | 33 | OG6_101685 | 0 | 527 | 1584 | 56733 | 5.09 | 0 | | | | | GO:0004190;GO:0005515 | aspartic-type endopeptidase activity;protein binding | GO:0006508 | proteolysis | | | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_304680ORubiquitin family proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_304680 OR ubiquitin family protein AND Toxoplasma gondii ME49 |
|
TGME49_305260 | TGME49_305260-t26_1 | 4 | 4 | 1 | 603 | 754 | forward | protein coding | No | 3142 | TGME49_305260 | hypothetical protein | hypothetical protein | 7894140 | B6KR46 | IX | TGME49_chrIX:5,320,040..5,324,297(+) | TGME49_chrIX:5320794..5323694(+) | TGME49_chrIX | Toxoplasma gondii ME49 | 62 | OG6_100231 | 1 | 594 | 1785 | 64078 | 6.51 | 0 | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_305260ORhypothetical proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_305260 OR hypothetical protein AND Toxoplasma gondii ME49 |
|
TGME49_305460 | TGME49_305460-t26_1 | 8 | 8 | 1 | 1167 | 1085 | reverse | protein coding | No | 3695 | TGME49_305460 | methionine aminopeptidase 2, putative | methionine aminopeptidase 2, putative | 7901280 | S7UI71 | IX | TGME49_chrIX:5,398,171..5,406,018(-) | TGME49_chrIX:5399338..5404933(-) | TGME49_chrIX | Toxoplasma gondii ME49 | 33 | OG6_100815 | 0 | 480 | 1443 | 52400 | 5.92 | 0 | | | | | GO:0004177;GO:0008235 | aminopeptidase activity;metalloexopeptidase activity | GO:0009987;GO:0006508 | cellular process;proteolysis | | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_305460ORmethionine aminopeptidase 2, putativeANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_305460 OR methionine aminopeptidase 2, putative AND Toxoplasma gondii ME49 |
|
TGME49_306330 | TGME49_306330-t26_1 | 4 | 4 | 1 | 566 | 672 | forward | protein coding | No | 2987 | TGME49_306330 | phospholipase | phospholipase | 7901346 | S8EYN1 | IX | TGME49_chrIX:5,968,046..5,972,065(+) | TGME49_chrIX:5968718..5971499(+) | TGME49_chrIX | Toxoplasma gondii ME49 | 62 | OG6_100231 | 1 | 582 | 1749 | 63255 | 5.51 | 0 | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_306330ORphospholipaseANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_306330 OR phospholipase AND Toxoplasma gondii ME49 |
|
TGME49_306930 | TGME49_306930-t26_1 | 4 | 4 | 1 | 616 | 258 | reverse | protein coding | No | 1981 | TGME49_306930 | proteasome subunit beta type 7 precursor, putative | proteasome subunit beta type 7 precursor, putative | 7893832 | B6KVJ3 | XI | TGME49_chrXI:177,237..181,365(-) | TGME49_chrXI:177853..181107(-) | TGME49_chrXI | Toxoplasma gondii ME49 | 28 | OG6_101382 | 0 | 368 | 1107 | 39587 | 8.60 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_306930ORproteasome subunit beta type 7 precursor, putativeANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_306930 OR proteasome subunit beta type 7 precursor, putative AND Toxoplasma gondii ME49 |
|
TGME49_307780 | TGME49_307780-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1989 | TGME49_307780 | hypothetical protein | hypothetical protein | 7893871 | S8G8F8 | XII | TGME49_chrXII:401,541..403,529(+) | TGME49_chrXII:401541..403529(+) | TGME49_chrXII | Toxoplasma gondii ME49 | 19 | OG6_490204 | 0 | 662 | 1989 | 72349 | 7.12 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_307780ORhypothetical proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_307780 OR hypothetical protein AND Toxoplasma gondii ME49 |
|
TGME49_307790 | TGME49_307790-t26_1 | 2 | 2 | 1 | | | forward | protein coding | No | 4707 | TGME49_307790 | hypothetical protein | hypothetical protein | 7893872 | S8FZ95 | XII | TGME49_chrXII:403,744..408,953(+) | TGME49_chrXII:403744..408953(+) | TGME49_chrXII | Toxoplasma gondii ME49 | 14 | OG6_490801 | 0 | 1568 | 4707 | 174216 | 6.99 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_307790ORhypothetical proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_307790 OR hypothetical protein AND Toxoplasma gondii ME49 |
|
TGME49_308580 | TGME49_308580-t26_1 | 16 | 16 | 1 | 785 | 515 | forward | protein coding | No | 5797 | TGME49_308580 | Lon protease family protein | Lon protease family protein | 7897706 | B6K9X1 | XI | TGME49_chrXI:254,186..268,044(+) | TGME49_chrXI:254701..267259(+) | TGME49_chrXI | Toxoplasma gondii ME49 | 39 | OG6_100411 | 0 | 1498 | 4497 | 164125 | 7.90 | 0 | | | | | GO:0005524;GO:0004176;GO:0016887;GO:0004252 | ATP binding;ATP-dependent peptidase activity;ATPase activity;serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.21.53 (Endopeptidase La) | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_308580ORLon protease family proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_308580 OR Lon protease family protein AND Toxoplasma gondii ME49 |
|
TGME49_309060 | TGME49_309060-t26_1 | 8 | 8 | 1 | 129 | 474 | forward | protein coding | No | 4383 | TGME49_309060 | ubiquitin carboxyl-terminal hydrolase | ubiquitin carboxyl-terminal hydrolase | 7897685 | | XI | TGME49_chrXI:463,949..472,239(+) | TGME49_chrXI:464423..472110(+) | TGME49_chrXI | Toxoplasma gondii ME49 | 15 | OG6_490658 | 0 | 1259 | 3780 | 138004 | 7.61 | 0 | | | | | GO:0004221;GO:0036459 | obsolete ubiquitin thiolesterase activity;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_309060ORubiquitin carboxyl-terminal hydrolaseANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_309060 OR ubiquitin carboxyl-terminal hydrolase AND Toxoplasma gondii ME49 |
|
TGME49_311090 | TGME49_311090-t26_1 | 7 | 7 | 1 | 1538 | 843 | forward | protein coding | No | 4205 | TGME49_311090 | ubiquitin carboxyl-terminal hydrolase | ubiquitin carboxyl-terminal hydrolase | 7900446 | B9PJX3 | XI | TGME49_chrXI:1,798,744..1,806,403(+) | TGME49_chrXI:1799587..1804865(+) | TGME49_chrXI | Toxoplasma gondii ME49 | 35 | OG6_101892 | 0 | 607 | 1824 | 67166 | 6.08 | 0 | | | | | GO:0004221;GO:0005515;GO:0036459 | obsolete ubiquitin thiolesterase activity;protein binding;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | 3.1.2.15 (Deleted entry) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_311090ORubiquitin carboxyl-terminal hydrolaseANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_311090 OR ubiquitin carboxyl-terminal hydrolase AND Toxoplasma gondii ME49 |
|
TGME49_311690 | TGME49_311690-t26_1 | 6 | 6 | 1 | 820 | 682 | reverse | protein coding | No | 2756 | TGME49_311690 | UBA/TS-N domain-containing protein | UBA/TS-N domain-containing protein | 7895733 | S8GCG0 | XI | TGME49_chrXI:2,206,313..2,211,271(-) | TGME49_chrXI:2207133..2210589(-) | TGME49_chrXI | Toxoplasma gondii ME49 | 33 | OG6_102579 | 0 | 417 | 1254 | 45974 | 4.88 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_311690ORUBA/TS-N domain-containing proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_311690 OR UBA/TS-N domain-containing protein AND Toxoplasma gondii ME49 |
|
TGME49_314090 | TGME49_314090-t26_1 | 6 | 6 | 1 | 266 | 464 | reverse | protein coding | No | 1348 | TGME49_314090 | proteasome beta subunit | proteasome beta subunit | 7900510 | B9PIS8 | XI | TGME49_chrXI:3,912,299..3,917,554(-) | TGME49_chrXI:3912565..3917090(-) | TGME49_chrXI | Toxoplasma gondii ME49 | 21 | OG6_101970 | 0 | 205 | 618 | 22482 | 5.00 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_314090ORproteasome beta subunitANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_314090 OR proteasome beta subunit AND Toxoplasma gondii ME49 |
|
TGME49_314500 | TGME49_314500-t26_1 | 15 | 15 | 1 | 2380 | 2080 | reverse | protein coding | No | 8363 | TGME49_314500 | subtilisin SUB2 | subtilisin SUB2 | 7896011 | B6K9C6 | XI | TGME49_chrXI:4,146,820..4,161,622(-) | TGME49_chrXI:4149200..4159542(-) | TGME49_chrXI | Toxoplasma gondii ME49 | 72 | OG6_100121 | 1 | 1300 | 3903 | 141581 | 5.34 | 2 | HMM: MARRRPSAIATCFRMILAFFLSFTFSSGADSLLAPSTTQAR, NN: MARRRPSAIATCFRMILAFFLSFTFSSGA | NN Sum: 4, NN D: .72, HMM Prob: 1 | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0045177 | apical part of cell | | | | | 3.4.21.66 (Thermitase) | 3.4.21.66 (Thermitase) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_314500ORsubtilisin SUB2ANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_314500 OR subtilisin SUB2 AND Toxoplasma gondii ME49 |
|
TGME49_314840 | TGME49_314840-t26_1 | 2 | 2 | 1 | 1933 | 1946 | reverse | protein coding | No | 8973 | TGME49_314840 | ubiquitin carboxyl-terminal hydrolase | ubiquitin carboxyl-terminal hydrolase | 7896074 | B6K9F0 | XI | TGME49_chrXI:4,322,598..4,331,912(-) | TGME49_chrXI:4324531..4329624(-) | TGME49_chrXI | Toxoplasma gondii ME49 | 18 | OG6_492032 | 0 | 1697 | 5094 | 180637 | 9.35 | 0 | | | | | GO:0004221;GO:0036459 | obsolete ubiquitin thiolesterase activity;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_314840ORubiquitin carboxyl-terminal hydrolaseANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_314840 OR ubiquitin carboxyl-terminal hydrolase AND Toxoplasma gondii ME49 |
|
TGME49_314850 | TGME49_314850-t26_1 | 13 | 13 | 1 | 532 | 433 | reverse | protein coding | No | 7490 | TGME49_314850 | hypothetical protein | hypothetical protein | 7896056 | | XI | TGME49_chrXI:4,333,994..4,348,026(-) | TGME49_chrXI:4334526..4347593(-) | TGME49_chrXI | Toxoplasma gondii ME49 | 28 | OG6_491105 | 0 | 2174 | 6525 | 236091 | 6.21 | 1 | HMM: MFLAERKTPLAGVSPLASGRVLVVLVIGTVTGVSLW, NN: MFLAERKTPLAGVSPLASGRVLVVLVIGTVTGVSLW | NN Sum: 4, NN D: .49, HMM Prob: .53 | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_314850ORhypothetical proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_314850 OR hypothetical protein AND Toxoplasma gondii ME49 |
|
TGME49_315980 | TGME49_315980-t26_1 | 4 | 4 | 1 | 655 | 1035 | forward | protein coding | No | 2593 | TGME49_315980 | EREBP-4 family protein | EREBP-4 family protein | 7900507 | | XI | TGME49_chrXI:5,116,446..5,120,897(+) | TGME49_chrXI:5117481..5120242(+) | TGME49_chrXI | Toxoplasma gondii ME49 | 47 | OG6_101256 | 1 | 300 | 903 | 33227 | 6.88 | 0 | | | | | | | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_315980OREREBP-4 family proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_315980 OR EREBP-4 family protein AND Toxoplasma gondii ME49 |
|
TGME49_318290 | TGME49_318290-t26_1 | 13 | 13 | 1 | | 1 | reverse | protein coding | No | 2089 | TGME49_318290 | hypothetical protein | hypothetical protein | 7896635 | | IV | TGME49_chrIV:1,434,909..1,443,576(-) | TGME49_chrIV:1434909..1443575(-) | TGME49_chrIV | Toxoplasma gondii ME49 | 17 | OG6_152072 | 0 | 695 | 2088 | 73380 | 9.53 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 3.4.21.107 (Peptidase Do) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_318290ORhypothetical proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_318290 OR hypothetical protein AND Toxoplasma gondii ME49 |
|
TGME49_318320 | TGME49_318320-t26_1 | 4 | 4 | 1 | 388 | 506 | forward | protein coding | No | 2355 | TGME49_318320 | ATP-dependent Clp endopeptidase, proteolytic subunit ClpP domain-containing protein | ATP-dependent Clp endopeptidase, proteolytic subunit ClpP domain-containing protein | 7896638 | | IV | TGME49_chrIV:1,418,593..1,422,726(+) | TGME49_chrIV:1419099..1422338(+) | TGME49_chrIV | Toxoplasma gondii ME49 | 38 | OG6_100939 | 1 | 486 | 1461 | 53958 | 7.33 | 0 | | | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.21.92 (Endopeptidase Clp) | 3.4.21.92 (Endopeptidase Clp) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_318320ORATP-dependent Clp endopeptidase, proteolytic subunit ClpP domain-containing proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_318320 OR ATP-dependent Clp endopeptidase, proteolytic subunit ClpP domain-containing protein AND Toxoplasma gondii ME49 |
|
TGME49_319970 | TGME49_319970-t26_1 | 7 | 7 | 1 | | | forward | protein coding | No | 2121 | TGME49_319970 | subtilisin SUB10 | subtilisin SUB10 | 7900809 | | IV | TGME49_chrIV:621,245..627,338(+) | TGME49_chrIV:621245..627338(+) | TGME49_chrIV | Toxoplasma gondii ME49 | 19 | OG6_222981 | 0 | 706 | 2121 | 77880 | 6.65 | 1 | | | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_319970ORsubtilisin SUB10ANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_319970 OR subtilisin SUB10 AND Toxoplasma gondii ME49 |
|
TGME49_321400 | TGME49_321400-t26_1 | 1 | 1 | 1 | 144 | 744 | forward | protein coding | No | 1275 | TGME49_321400 | microsomal signal peptidase (spc12) domain-containing protein | microsomal signal peptidase (spc12) domain-containing protein | 7896774 | S8FBK0 | Ib | TGME49_chrIb:1,839,814..1,841,088(+) | TGME49_chrIb:1840558..1840944(+) | TGME49_chrIb | Toxoplasma gondii ME49 | 20 | OG6_103297 | 0 | 128 | 387 | 14205 | 9.03 | 2 | | | GO:0016021;GO:0005787 | integral component of membrane;signal peptidase complex | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_321400ORmicrosomal signal peptidase (spc12) domain-containing proteinANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_321400 OR microsomal signal peptidase (spc12) domain-containing protein AND Toxoplasma gondii ME49 |
|
TGME49_321530 | TGME49_321530-t26_1 | 4 | 4 | 1 | 1810 | 688 | reverse | protein coding | No | 3767 | TGME49_321530 | cathepsin CPL | cathepsin CPL | 7896787 | Q6DMN0 | Ib | TGME49_chrIb:1,751,620..1,757,365(-) | TGME49_chrIb:1753430..1756677(-) | TGME49_chrIb | Toxoplasma gondii ME49 | 24 | OG6_100116 | 0 | 422 | 1269 | 47550 | 6.45 | 1 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | GO:0045177 | apical part of cell | | | | | 3.4.22.15 (Cathepsin L) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_321530ORcathepsin CPLANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_321530 OR cathepsin CPL AND Toxoplasma gondii ME49 |
|
TGME49_323200 | TGME49_323200-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1650 | TGME49_323200 | OTU family cysteine protease | OTU family cysteine protease | | | Not Assigned | KE139136:1,201..2,850(-) | KE139136:1201..2850(-) | KE139136 | Toxoplasma gondii ME49 | 101 | OG6_124104 | 10 | 549 | 1650 | 61305 | 4.42 | 0 | HMM: MVLSSGWRALIRCCQPVLATPNVSAS, NN: MVLSSGWRALIRCCQPVLAT | NN Sum: 3, NN D: .59, HMM Prob: .75 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_323200OROTU family cysteine proteaseANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_323200 OR OTU family cysteine protease AND Toxoplasma gondii ME49 |
|
TGME49_323600 | TGME49_323600-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1461 | TGME49_323600 | OTU family cysteine protease | OTU family cysteine protease | | | Not Assigned | KE139194:1,254..2,714(+) | KE139194:1254..2714(+) | KE139194 | Toxoplasma gondii ME49 | 101 | OG6_124104 | 10 | 486 | 1461 | 54446 | 4.31 | 0 | HMM: MVLSSGWRALIRCCQPVLATPNVSAS, NN: MVLSSGWRALIRCCQPVLAT | NN Sum: 3, NN D: .59, HMM Prob: .75 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_323600OROTU family cysteine proteaseANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_323600 OR OTU family cysteine protease AND Toxoplasma gondii ME49 |
|
TGME49_323700 | TGME49_323700-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1461 | TGME49_323700 | OTU family cysteine protease | OTU family cysteine protease | | | Not Assigned | KE139200:1,254..2,714(+) | KE139200:1254..2714(+) | KE139200 | Toxoplasma gondii ME49 | 101 | OG6_124104 | 10 | 486 | 1461 | 54446 | 4.31 | 0 | HMM: MVLSSGWRALIRCCQPVLATPNVSAS, NN: MVLSSGWRALIRCCQPVLAT | NN Sum: 3, NN D: .59, HMM Prob: .75 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_323700OROTU family cysteine proteaseANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_323700 OR OTU family cysteine protease AND Toxoplasma gondii ME49 |
|
TGME49_323800 | TGME49_323800-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1461 | TGME49_323800 | OTU family cysteine protease | OTU family cysteine protease | | | Not Assigned | KE139279:1,254..2,714(+) | KE139279:1254..2714(+) | KE139279 | Toxoplasma gondii ME49 | 101 | OG6_124104 | 10 | 486 | 1461 | 54446 | 4.31 | 0 | HMM: MVLSSGWRALIRCCQPVLATPNVSAS, NN: MVLSSGWRALIRCCQPVLAT | NN Sum: 3, NN D: .59, HMM Prob: .75 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_323800OROTU family cysteine proteaseANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_323800 OR OTU family cysteine protease AND Toxoplasma gondii ME49 |
|
TGME49_325300 | TGME49_325300-t26_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 174 | TGME49_325300 | proteasome subunit alpha type, putative | proteasome subunit alpha type, putative | | | Not Assigned | KE139545:137..830(-) | KE139545:137..830(-) | KE139545 | Toxoplasma gondii ME49 | 1 | OG6_489514 | 0 | 57 | 174 | 6204 | 8.50 | 0 | | | GO:0019773 | proteasome core complex, alpha-subunit complex | GO:0004175 | endopeptidase activity | GO:0006511 | ubiquitin-dependent protein catabolic process | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TGME49_325300ORproteasome subunit alpha type, putativeANDToxoplasma gondii ME49 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TGME49_325300 OR proteasome subunit alpha type, putative AND Toxoplasma gondii ME49 |