|
NCLIV_000790 | NCLIV_000790-t26_1 | 10 | 10 | 1 | | | reverse | protein coding | No | 5094 | NCLIV_000790 | hypothetical protein | hypothetical protein | 13445765 | F0V794 | Ia | FR823380:656,365..664,993(-) | FR823380:656365..664993(-) | FR823380 | Neospora caninum Liverpool | 27 | OG6_103851 | 0 | 1697 | 5094 | 183032 | 7.24 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_000790ORhypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_000790 OR hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_000930 | NCLIV_000930-t26_1 | 14 | 14 | 1 | | | forward | protein coding | No | 1359 | NCLIV_000930 | 3-hydroxyisobutyryl-CoA hydrolase/ catalytic | 3-hydroxyisobutyryl-CoA hydrolase/ catalytic | 13445791 | F0V7A8 | Ia | FR823380:766,855..774,793(+) | FR823380:766855..774793(+) | FR823380 | Neospora caninum Liverpool | 42 | OG6_134153 | 0 | 452 | 1359 | 49696 | 6.70 | 0 | | | | | GO:0003860 | 3-hydroxyisobutyryl-CoA hydrolase activity | | | | | | | | | 3.1.2.4 (3-hydroxyisobutyryl-CoA hydrolase) | 3.1.2.4 (3-hydroxyisobutyryl-CoA hydrolase) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_000930OR3-hydroxyisobutyryl-CoA hydrolase/ catalyticANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_000930 OR 3-hydroxyisobutyryl-CoA hydrolase/ catalytic AND Neospora caninum Liverpool |
|
NCLIV_001040 | NCLIV_001040-t26_1 | 3 | 3 | 1 | | | reverse | protein coding | No | 885 | NCLIV_001040 | putative der1-like family domain-containing protein,conserved | putative der1-like family domain-containing protein,conserved | 13445790 | F0V7B9 | Ia | FR823380:874,147..875,354(-) | FR823380:874147..875354(-) | FR823380 | Neospora caninum Liverpool | 23 | OG6_113960 | 0 | 294 | 885 | 32189 | 8.98 | 4 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_001040ORputative der1-like family domain-containing protein,conservedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_001040 OR putative der1-like family domain-containing protein,conserved AND Neospora caninum Liverpool |
|
NCLIV_001135 | NCLIV_001135-t26_1 | 4 | 4 | 1 | | | forward | protein coding | No | 1830 | NCLIV_001135 | hypothetical protein | hypothetical protein | 13440513 | F0V7D0 | Ia | FR823380:968,241..971,318(+) | FR823380:968241..971318(+) | FR823380 | Neospora caninum Liverpool | 62 | OG6_100231 | 1 | 609 | 1830 | 65377 | 7.47 | 0 | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_001135ORhypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_001135 OR hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_001380 | NCLIV_001380-t26_1 | 12 | 12 | 1 | | | forward | protein coding | No | 1689 | NCLIV_001380 | ubiquitin carboxyl-terminal hydrolase, related | ubiquitin carboxyl-terminal hydrolase, related | 13440627 | F0V7F7 | Ia | FR823380:1,259,789..1,266,398(+) | FR823380:1259789..1266398(+) | FR823380 | Neospora caninum Liverpool | 31 | OG6_102786 | 0 | 562 | 1689 | 63381 | 6.04 | 0 | | | | | GO:0036459;GO:0008270 | thiol-dependent ubiquitinyl hydrolase activity;zinc ion binding | GO:0016579 | protein deubiquitination | | | | | | | 3.1.2.15 (Deleted entry) | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_001380ORubiquitin carboxyl-terminal hydrolase, relatedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_001380 OR ubiquitin carboxyl-terminal hydrolase, related AND Neospora caninum Liverpool |
|
NCLIV_001540 | NCLIV_001540-t26_1 | 13 | 13 | 1 | | | forward | protein coding | No | 1629 | NCLIV_001540 | putative PH domain-containing protein | putative PH domain-containing protein | 13445717 | F0V7H5 | Ia | FR823380:1,420,709..1,426,783(+) | FR823380:1420709..1426783(+) | FR823380 | Neospora caninum Liverpool | 25 | OG6_129725 | 0 | 542 | 1629 | 61322 | 6.44 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_001540ORputative PH domain-containing proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_001540 OR putative PH domain-containing protein AND Neospora caninum Liverpool |
|
NCLIV_001580 | NCLIV_001580-t26_1 | 10 | 10 | 1 | | | forward | protein coding | No | 2814 | NCLIV_001580 | putative rhomboid-like protease 5 | putative rhomboid-like protease 5 | 13440543 | F0V7H9 | Ia | FR823380:1,461,291..1,467,532(+) | FR823380:1461291..1467532(+) | FR823380 | Neospora caninum Liverpool | 33 | OG6_127785 | 0 | 937 | 2814 | 101638 | 8.13 | 6 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_001580ORputative rhomboid-like protease 5ANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_001580 OR putative rhomboid-like protease 5 AND Neospora caninum Liverpool |
|
NCLIV_002180 | NCLIV_002180-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 2484 | NCLIV_002180 | hypothetical protein | hypothetical protein | 13440630 | F0V7P0 | Ia | FR823380:2,049,336..2,051,819(+) | FR823380:2049336..2051819(+) | FR823380 | Neospora caninum Liverpool | 18 | OG6_100162 | 0 | 827 | 2484 | 94161 | 5.19 | 0 | | | | | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.24.71 (Endothelin-converting enzyme 1) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_002180ORhypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_002180 OR hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_002350 | NCLIV_002350-t26_1 | 5 | 5 | 1 | | | reverse | protein coding | No | 3255 | NCLIV_002350 | hypothetical protein | hypothetical protein | 13440653 | F0V7Q7 | Ia | FR823380:2,178,407..2,183,080(-) | FR823380:2178407..2183080(-) | FR823380 | Neospora caninum Liverpool | 24 | OG6_102202 | 0 | 1084 | 3255 | 115132 | 7.05 | 0 | | | | | GO:1990380;GO:0004843 | Lys48-specific deubiquitinase activity;thiol-dependent ubiquitin-specific protease activity | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_002350ORhypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_002350 OR hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_003830 | NCLIV_003830-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1113 | NCLIV_003830 | conserved hypothetical protein | conserved hypothetical protein | 13445947 | F0V857 | Ib | FR823381:1,249,312..1,250,424(+) | FR823381:1249312..1250424(+) | FR823381 | Neospora caninum Liverpool | 0 | OG6r1_321850 | 0 | 370 | 1113 | 39243 | 11.28 | 1 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_003830ORconserved hypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_003830 OR conserved hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_003910 | NCLIV_003910-t26_1 | 8 | 8 | 1 | | | reverse | protein coding | No | 1317 | NCLIV_003910 | cathepsin D enzyme, related | cathepsin D enzyme, related | 13445956 | F0V866 | Ib | FR823381:1,302,186..1,303,929(-) | FR823381:1302186..1303929(-) | FR823381 | Neospora caninum Liverpool | 16 | OG6_491673 | 0 | 438 | 1317 | 48577 | 8.93 | 0 | HMM: MGLSKAIAVILLTLPFAGVGY, NN: MGLSKAIAVILLTLPFAGVGY | NN Sum: 3, NN D: .67, HMM Prob: .93 | | | | | | | | | | | | | 3.4.23.5 (Cathepsin D) | 3.4.23.34 (Cathepsin E) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_003910ORcathepsin D enzyme, relatedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_003910 OR cathepsin D enzyme, related AND Neospora caninum Liverpool |
|
NCLIV_004380 | NCLIV_004380-t26_1 | 4 | 4 | 1 | | | reverse | protein coding | No | 1248 | NCLIV_004380 | cathepsin L, related | cathepsin L, related | 13446003 | F0V8B3 | Ib | FR823381:1,666,633..1,669,425(-) | FR823381:1666633..1669425(-) | FR823381 | Neospora caninum Liverpool | 24 | OG6_100116 | 0 | 415 | 1248 | 46460 | 6.24 | 1 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_004380ORcathepsin L, relatedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_004380 OR cathepsin L, related AND Neospora caninum Liverpool |
|
NCLIV_004530 | NCLIV_004530-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 399 | NCLIV_004530 | putative microsomal signal peptidase subunit SPCS1 domain-containing protein | putative microsomal signal peptidase subunit SPCS1 domain-containing protein | 13446025 | F0V8D5 | Ib | FR823381:1,788,962..1,789,360(+) | FR823381:1788962..1789360(+) | FR823381 | Neospora caninum Liverpool | 20 | OG6_103297 | 0 | 132 | 399 | 14617 | 8.33 | 2 | | | GO:0016021;GO:0005787 | integral component of membrane;signal peptidase complex | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_004530ORputative microsomal signal peptidase subunit SPCS1 domain-containing proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_004530 OR putative microsomal signal peptidase subunit SPCS1 domain-containing protein AND Neospora caninum Liverpool |
|
NCLIV_004750 | NCLIV_004750-t26_1 | 6 | 6 | 1 | | | forward | protein coding | No | 1290 | NCLIV_004750 | putative peptidase family M48 domain-containing protein | putative peptidase family M48 domain-containing protein | 13446075 | F0V8F7 | II | FR823382:133,186..136,835(+) | FR823382:133186..136835(+) | FR823382 | Neospora caninum Liverpool | 37 | OG6_101632 | 0 | 429 | 1290 | 48954 | 7.16 | 5 | HMM: MGLLTLPHWFSNVPWLHVYLGFSLSVECF, NN: MGLLTLPHWFSNVPWLHVYLGFSLSVECF | NN Sum: 4, NN D: .5, HMM Prob: .44 | | | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.24.84 (Ste24 endopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_004750ORputative peptidase family M48 domain-containing proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_004750 OR putative peptidase family M48 domain-containing protein AND Neospora caninum Liverpool |
|
NCLIV_004860 | NCLIV_004860-t26_1 | 16 | 16 | 1 | | | reverse | protein coding | No | 7680 | NCLIV_004860 | hypothetical protein | hypothetical protein | 13446056 | F0V8G9 | II | FR823382:253,429..267,884(-) | FR823382:253429..267884(-) | FR823382 | Neospora caninum Liverpool | 85 | OG6_101052 | 0 | 2559 | 7680 | 282190 | 8.17 | 1 | HMM: MTEDAVRQTPPRVVAVCGKSRRRNGAFFALLAFFVVFSPFASSAR, NN: MTEDAVRQTPPRVVAVCGKSRRRNGAFFALLAFFVVFSPFASSA | NN Sum: 3, NN D: .49, HMM Prob: .94 | | | GO:0005524;GO:0003989;GO:0016874;GO:0046872 | ATP binding;acetyl-CoA carboxylase activity;ligase activity;metal ion binding | GO:0006633 | fatty acid biosynthetic process | | | | | | | 6.3.4.14 (Biotin carboxylase);6.4.1.2 (Acetyl-CoA carboxylase) | 6.4.1.2 (Acetyl-CoA carboxylase) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_004860ORhypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_004860 OR hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_004990 | NCLIV_004990-t26_1 | 7 | 7 | 1 | | | forward | protein coding | No | 789 | NCLIV_004990 | spry domain containing protein, related | spry domain containing protein, related | 13446081 | F0V8I2 | II | FR823382:367,821..371,142(+) | FR823382:367821..371142(+) | FR823382 | Neospora caninum Liverpool | 82 | OG6_102272 | 2 | 262 | 789 | 29205 | 7.45 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_004990ORspry domain containing protein, relatedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_004990 OR spry domain containing protein, related AND Neospora caninum Liverpool |
|
NCLIV_005140 | NCLIV_005140-t26_1 | 6 | 6 | 1 | | | forward | protein coding | No | 3312 | NCLIV_005140 | putative ubiquitin carboxyl-terminal hydrolase | putative ubiquitin carboxyl-terminal hydrolase | 13446096 | F0V8J7 | II | FR823382:475,813..480,787(+) | FR823382:475813..480787(+) | FR823382 | Neospora caninum Liverpool | 18 | OG6_103260 | 0 | 1103 | 3312 | 120103 | 7.84 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_005140ORputative ubiquitin carboxyl-terminal hydrolaseANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_005140 OR putative ubiquitin carboxyl-terminal hydrolase AND Neospora caninum Liverpool |
|
NCLIV_005190 | NCLIV_005190-t26_1 | 14 | 14 | 1 | | | reverse | protein coding | No | 2436 | NCLIV_005190 | putative transcription elongation factor FACT 140 kDa | putative transcription elongation factor FACT 140 kDa | 13446101 | F0V8K2 | II | FR823382:531,254..538,739(-) | FR823382:531254..538739(-) | FR823382 | Neospora caninum Liverpool | 31 | OG6_102309 | 0 | 811 | 2436 | 91970 | 4.85 | 0 | | | | | | | | | | | | | | | | 1.1.1.27 (L-lactate dehydrogenase) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_005190ORputative transcription elongation factor FACT 140 kDaANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_005190 OR putative transcription elongation factor FACT 140 kDa AND Neospora caninum Liverpool |
|
NCLIV_005250 | NCLIV_005250-t26_1 | 12 | 12 | 1 | | | reverse | protein coding | No | 5769 | NCLIV_005250 | putative subtilisin-like serine protease | putative subtilisin-like serine protease | 13446107 | F0V8K8 | II | FR823382:626,158..638,849(-) | FR823382:626158..638849(-) | FR823382 | Neospora caninum Liverpool | 72 | OG6_100121 | 1 | 1922 | 5769 | 209209 | 5.05 | 0 | | | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.21.66 (Thermitase) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_005250ORputative subtilisin-like serine proteaseANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_005250 OR putative subtilisin-like serine protease AND Neospora caninum Liverpool |
|
NCLIV_005900 | NCLIV_005900-t26_1 | 18 | 18 | 1 | | | reverse | protein coding | No | 2280 | NCLIV_005900 | translation INITIATION FACTOR 3 SUBUNIT 9-like protein, related | translation INITIATION FACTOR 3 SUBUNIT 9-like protein, related | 13446172 | F0V8S3 | II | FR823382:1,224,956..1,234,747(-) | FR823382:1224956..1234747(-) | FR823382 | Neospora caninum Liverpool | 35 | OG6_101924 | 0 | 759 | 2280 | 88751 | 5.17 | 0 | | | GO:0005852 | eukaryotic translation initiation factor 3 complex | GO:0003723;GO:0003676;GO:0003743;GO:0031369 | RNA binding;nucleic acid binding;translation initiation factor activity;translation initiation factor binding | GO:0006413 | translational initiation | | | | | | | | 3.6.3.14 (Transferred entry: 7.1.2.2) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_005900ORtranslation INITIATION FACTOR 3 SUBUNIT 9-like protein, relatedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_005900 OR translation INITIATION FACTOR 3 SUBUNIT 9-like protein, related AND Neospora caninum Liverpool |
|
NCLIV_006860 | NCLIV_006860-t26_1 | 13 | 13 | 1 | | | forward | protein coding | No | 1491 | NCLIV_006860 | hypothetical protein | hypothetical protein | 13446269 | F0V920 | II | FR823382:2,079,858..2,085,433(+) | FR823382:2079858..2085433(+) | FR823382 | Neospora caninum Liverpool | 34 | OG6_102047 | 0 | 496 | 1491 | 54386 | 6.25 | 0 | | | | | GO:0004177;GO:0008270 | aminopeptidase activity;zinc ion binding | GO:0006508 | proteolysis | | | | | | | | 3.4.11.21 (Aspartyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_006860ORhypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_006860 OR hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_007010 | NCLIV_007010-t26_1 | 10 | 10 | 1 | | | reverse | protein coding | No | 2250 | NCLIV_007010 | putative cathepsin C2 (TgCPC2) | putative cathepsin C2 (TgCPC2) | 13446283 | F0V9R5 | III | FR823383:117,044..121,811(-) | FR823383:117044..121811(-) | FR823383 | Neospora caninum Liverpool | 23 | OG6_148524 | 0 | 749 | 2250 | 82891 | 6.81 | 0 | HMM: MSPAGHLVATGTAQHGTSVGHSRLPRASFLAALLLVCRALGL, NN: MSPAGHLVATGTAQHGTSVGHSRLPRASFLAALLLVCRAL | NN Sum: 3, NN D: .51, HMM Prob: 1 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.14.1 (Dipeptidyl-peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_007010ORputative cathepsin C2 (TgCPC2)ANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_007010 OR putative cathepsin C2 (TgCPC2) AND Neospora caninum Liverpool |
|
NCLIV_007520 | NCLIV_007520-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1068 | NCLIV_007520 | hypothetical protein | hypothetical protein | 13441304 | F0V953 | III | FR823383:503,662..504,729(-) | FR823383:503662..504729(-) | FR823383 | Neospora caninum Liverpool | 25 | OG6_101767 | 0 | 355 | 1068 | 38810 | 5.60 | 0 | | | | | GO:0008233 | peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.-.-.- (Hydrolases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_007520ORhypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_007520 OR hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_007710 | NCLIV_007710-t26_1 | 16 | 16 | 1 | | | forward | protein coding | No | 4761 | NCLIV_007710 | f14o23.7 protein, related | f14o23.7 protein, related | 13441323 | F0V972 | III | FR823383:660,050..672,311(+) | FR823383:660050..672311(+) | FR823383 | Neospora caninum Liverpool | 34 | OG6_113993 | 0 | 1586 | 4761 | 172365 | 5.39 | 1 | | | | | GO:0004181;GO:0008270 | metallocarboxypeptidase activity;zinc ion binding | GO:0006508 | proteolysis | | | | | | | | 3.4.17.12 (Carboxypeptidase M) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_007710ORf14o23.7 protein, relatedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_007710 OR f14o23.7 protein, related AND Neospora caninum Liverpool |
|
NCLIV_008220 | NCLIV_008220-t26_1 | 11 | 11 | 1 | | | reverse | protein coding | No | 3849 | NCLIV_008220 | putative M16 family peptidase | putative M16 family peptidase | 13441377 | F0V9C6 | III | FR823383:1,126,755..1,134,940(-) | FR823383:1126755..1134940(-) | FR823383 | Neospora caninum Liverpool | 65 | OG6_110270 | 1 | 1282 | 3849 | 141393 | 5.81 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_008220ORputative M16 family peptidaseANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_008220 OR putative M16 family peptidase AND Neospora caninum Liverpool |
|
NCLIV_008320 | NCLIV_008320-t26_1 | 10 | 10 | 1 | | | forward | protein coding | No | 2055 | NCLIV_008320 | protein F23B2.12, partially confirmed by transcript evidence, related | protein F23B2.12, partially confirmed by transcript evidence, related | 13441388 | F0V9D7 | III | FR823383:1,248,704..1,255,202(+) | FR823383:1248704..1255202(+) | FR823383 | Neospora caninum Liverpool | 34 | OG6_100644 | 0 | 684 | 2055 | 76161 | 6.82 | 0 | | | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.16.2 (Lysosomal Pro-Xaa carboxypeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_008320ORprotein F23B2.12, partially confirmed by transcript evidence, relatedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_008320 OR protein F23B2.12, partially confirmed by transcript evidence, related AND Neospora caninum Liverpool |
|
NCLIV_008410 | NCLIV_008410-t26_1 | 3 | 3 | 1 | | | forward | protein coding | No | 375 | NCLIV_008410 | gamma-aminobutyric acid receptor-associated protein-like 1, related | gamma-aminobutyric acid receptor-associated protein-like 1, related | 13441397 | F0V9E6 | III | FR823383:1,309,163..1,310,941(+) | FR823383:1309163..1310941(+) | FR823383 | Neospora caninum Liverpool | 24 | OG6_100707 | 0 | 124 | 375 | 14236 | 7.62 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_008410ORgamma-aminobutyric acid receptor-associated protein-like 1, relatedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_008410 OR gamma-aminobutyric acid receptor-associated protein-like 1, related AND Neospora caninum Liverpool |
|
NCLIV_008960 | NCLIV_008960-t26_1 | 6 | 6 | 1 | | | forward | protein coding | No | 1500 | NCLIV_008960 | hypothetical protein | hypothetical protein | 13441453 | F0V9K1 | III | FR823383:1,719,704..1,722,420(+) | FR823383:1719704..1722420(+) | FR823383 | Neospora caninum Liverpool | 45 | OG6_101827 | 0 | 499 | 1500 | 53745 | 6.36 | 1 | | | | | | | | | | | | | | | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_008960ORhypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_008960 OR hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_009170 | NCLIV_009170-t26_1 | 2 | 2 | 1 | | | forward | protein coding | No | 576 | NCLIV_009170 | proteasome (Prosome, macropain) subunit, beta type, 1, related | proteasome (Prosome, macropain) subunit, beta type, 1, related | 13441474 | F0V9M2 | III | FR823383:1,844,607..1,845,564(+) | FR823383:1844607..1845564(+) | FR823383 | Neospora caninum Liverpool | 23 | OG6_102061 | 0 | 191 | 576 | 21961 | 8.71 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_009170ORproteasome (Prosome, macropain) subunit, beta type, 1, relatedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_009170 OR proteasome (Prosome, macropain) subunit, beta type, 1, related AND Neospora caninum Liverpool |
|
NCLIV_010280 | NCLIV_010280-t26_1 | 8 | 8 | 1 | | | forward | protein coding | No | 2373 | NCLIV_010280 | putative serine protease/subtilase | putative serine protease/subtilase | 13441592 | F0VA70 | IV | FR823384:574,640..581,047(+) | FR823384:574640..581047(+) | FR823384 | Neospora caninum Liverpool | 19 | OG6_222981 | 0 | 790 | 2373 | 85894 | 7.17 | 0 | | | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_010280ORputative serine protease/subtilaseANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_010280 OR putative serine protease/subtilase AND Neospora caninum Liverpool |
|
NCLIV_011200 | NCLIV_011200-t26_1 | 3 | 3 | 1 | | | forward | protein coding | No | 876 | NCLIV_011200 | atp-dependent Clp protease proteolytic subunit | atp-dependent Clp protease proteolytic subunit | 13441682 | F0VAG4 | IV | FR823384:1,363,175..1,364,961(+) | FR823384:1363175..1364961(+) | FR823384 | Neospora caninum Liverpool | 38 | OG6_100939 | 1 | 291 | 876 | 32612 | 5.79 | 0 | | | | | | | | | | | | | | | | 3.4.21.92 (Endopeptidase Clp) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_011200ORatp-dependent Clp protease proteolytic subunitANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_011200 OR atp-dependent Clp protease proteolytic subunit AND Neospora caninum Liverpool |
|
NCLIV_011220 | NCLIV_011220-t26_1 | 12 | 12 | 1 | | | reverse | protein coding | No | 1038 | NCLIV_011220 | protease Do (Precursor), related | protease Do (Precursor), related | 13441684 | F0VAG6 | IV | FR823384:1,376,666..1,381,723(-) | FR823384:1376666..1381723(-) | FR823384 | Neospora caninum Liverpool | 17 | OG6_152072 | 0 | 345 | 1038 | 36376 | 6.78 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | 3.4.21.107 (Peptidase Do) | 3.4.21.107 (Peptidase Do) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_011220ORprotease Do (Precursor), relatedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_011220 OR protease Do (Precursor), related AND Neospora caninum Liverpool |
|
NCLIV_011650 | NCLIV_011650-t26_1 | 7 | 7 | 1 | | | forward | protein coding | No | 1146 | NCLIV_011650 | putative methionine aminopeptidase | putative methionine aminopeptidase | 13441727 | F0VAK9 | IV | FR823384:1,745,118..1,748,931(+) | FR823384:1745118..1748931(+) | FR823384 | Neospora caninum Liverpool | 64 | OG6_100342 | 1 | 381 | 1146 | 41639 | 6.35 | 0 | | | | | GO:0004177;GO:0008235 | aminopeptidase activity;metalloexopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_011650ORputative methionine aminopeptidaseANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_011650 OR putative methionine aminopeptidase AND Neospora caninum Liverpool |
|
NCLIV_012050 | NCLIV_012050-t26_1 | 14 | 14 | 1 | | | forward | protein coding | No | 12453 | NCLIV_012050 | putative ubiquitin carboxyl-terminal hydrolase | putative ubiquitin carboxyl-terminal hydrolase | 13441767 | F0V9X6 | IV | FR823384:2,085,130..2,104,320(+) | FR823384:2085130..2104320(+) | FR823384 | Neospora caninum Liverpool | 16 | OG6_490656 | 0 | 4150 | 12453 | 432748 | 7.42 | 0 | | | | | GO:0003677;GO:0036459 | DNA binding;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_012050ORputative ubiquitin carboxyl-terminal hydrolaseANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_012050 OR putative ubiquitin carboxyl-terminal hydrolase AND Neospora caninum Liverpool |
|
NCLIV_012070 | NCLIV_012070-t26_1 | 3 | 3 | 1 | | | forward | protein coding | No | 1029 | NCLIV_012070 | peptidase C26, related | peptidase C26, related | 13441769 | F0V9X8 | IV | FR823384:2,107,875..2,110,323(+) | FR823384:2107875..2110323(+) | FR823384 | Neospora caninum Liverpool | 18 | OG6_107498 | 0 | 342 | 1029 | 37358 | 5.00 | 0 | | | | | GO:0016787 | hydrolase activity | | | | | | | | | | 2.4.2.- (Pentosyltransferases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_012070ORpeptidase C26, relatedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_012070 OR peptidase C26, related AND Neospora caninum Liverpool |
|
NCLIV_012110 | NCLIV_012110-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1221 | NCLIV_012110 | hypothetical protein | hypothetical protein | 13441773 | F0V9Y2 | IV | FR823384:2,174,034..2,175,254(+) | FR823384:2174034..2175254(+) | FR823384 | Neospora caninum Liverpool | 111 | OG6_124104 | 0 | 406 | 1221 | 45626 | 5.25 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_012110ORhypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_012110 OR hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_012740 | NCLIV_012740-t26_1 | 4 | 4 | 1 | | | forward | protein coding | No | 1689 | NCLIV_012740 | putative DNA repair protein | putative DNA repair protein | 13440479 | F0VCW5 | V | FR823386:454,481..457,874(+) | FR823386:454481..457874(+) | FR823386 | Neospora caninum Liverpool | 27 | OG6_102113 | 0 | 562 | 1689 | 62448 | 7.92 | 0 | | | | | GO:0003677 | DNA binding | | | | | | | | | | 2.1.1.201 (2-methoxy-6-polyprenyl-1,4-benzoquinol methylase) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_012740ORputative DNA repair proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_012740 OR putative DNA repair protein AND Neospora caninum Liverpool |
|
NCLIV_013010 | NCLIV_013010-t26_1 | 12 | 12 | 1 | | | reverse | protein coding | No | 795 | NCLIV_013010 | Rhomboid family 1 (Predicted), related | Rhomboid family 1 (Predicted), related | 13443818 | F0VCZ3 | V | FR823386:757,751..759,179(-) | FR823386:757751..759179(-) | FR823386 | Neospora caninum Liverpool | 52 | OG6_100562 | 1 | 264 | 795 | 29154 | 7.41 | 8 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | | 3.4.21.- (Serine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_013010ORRhomboid family 1 (Predicted), relatedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_013010 OR Rhomboid family 1 (Predicted), related AND Neospora caninum Liverpool |
|
NCLIV_013230 | NCLIV_013230-t26_1 | 6 | 6 | 1 | | | forward | protein coding | No | 837 | NCLIV_013230 | conserved hypothetical protein | conserved hypothetical protein | 13443839 | F0VD15 | V | FR823386:934,239..939,161(+) | FR823386:934239..939161(+) | FR823386 | Neospora caninum Liverpool | 18 | OG6_222901 | 0 | 278 | 837 | 29275 | 5.75 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_013230ORconserved hypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_013230 OR conserved hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_013610 | NCLIV_013610-t26_1 | 6 | 6 | 1 | | | reverse | protein coding | No | 1908 | NCLIV_013610 | Ubiquitin carboxyl-terminal hydrolase, related | Ubiquitin carboxyl-terminal hydrolase, related | 13443877 | F0VD53 | V | FR823386:1,258,919..1,263,221(-) | FR823386:1258919..1263221(-) | FR823386 | Neospora caninum Liverpool | 31 | OG6_101380 | 1 | 635 | 1908 | 69575 | 4.81 | 0 | HMM: MQTVLSVPFGPQVVTSLPLVREKYVALLPALLVSLSASAGM, NN: MQTVLSVPFGPQVVTSLPLVREKYVALLPALLVSLSASAGM | NN Sum: 2, NN D: .35, HMM Prob: .97 | | | GO:0005515;GO:0036459 | protein binding;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | 3.1.2.15 (Deleted entry) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_013610ORUbiquitin carboxyl-terminal hydrolase, relatedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_013610 OR Ubiquitin carboxyl-terminal hydrolase, related AND Neospora caninum Liverpool |
|
NCLIV_013620 | NCLIV_013620-t26_1 | 6 | 6 | 1 | | | reverse | protein coding | No | 1245 | NCLIV_013620 | Ubiquitin carboxyl-terminal hydrolase, related | Ubiquitin carboxyl-terminal hydrolase, related | 13443878 | F0VD54 | V | FR823386:1,264,413..1,267,995(-) | FR823386:1264413..1267995(-) | FR823386 | Neospora caninum Liverpool | 31 | OG6_101380 | 1 | 414 | 1245 | 44380 | 4.70 | 0 | | | | | GO:0008270 | zinc ion binding | | | | | | | | | 3.1.2.15 (Deleted entry) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_013620ORUbiquitin carboxyl-terminal hydrolase, relatedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_013620 OR Ubiquitin carboxyl-terminal hydrolase, related AND Neospora caninum Liverpool |
|
NCLIV_013780 | NCLIV_013780-t26_1 | 4 | 4 | 1 | | | reverse | protein coding | No | 711 | NCLIV_013780 | hypothetical protein | hypothetical protein | 13443893 | F0VD69 | V | FR823386:1,376,572..1,379,004(-) | FR823386:1376572..1379004(-) | FR823386 | Neospora caninum Liverpool | 28 | OG6_101969 | 0 | 236 | 711 | 25863 | 5.16 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_013780ORhypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_013780 OR hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_014060 | NCLIV_014060-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2850 | NCLIV_014060 | putative lysophospholipase | putative lysophospholipase | 13444000 | F0VD97 | V | FR823386:1,605,594..1,608,443(-) | FR823386:1605594..1608443(-) | FR823386 | Neospora caninum Liverpool | 19 | OG6_223134 | 0 | 949 | 2850 | 106064 | 5.36 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_014060ORputative lysophospholipaseANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_014060 OR putative lysophospholipase AND Neospora caninum Liverpool |
|
NCLIV_014330 | NCLIV_014330-t26_1 | 16 | 16 | 1 | | | reverse | protein coding | No | 2202 | NCLIV_014330 | Prolyl oligopeptidase (Precursor) | Prolyl oligopeptidase (Precursor) | 13444027 | F0VDC4 | V | FR823386:1,803,449..1,811,449(-) | FR823386:1803449..1811449(-) | FR823386 | Neospora caninum Liverpool | 29 | OG6_101804 | 0 | 733 | 2202 | 83025 | 5.85 | 0 | | | | | GO:0004252;GO:0070008;GO:0008236 | serine-type endopeptidase activity;serine-type exopeptidase activity;serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.21.26 (Prolyl oligopeptidase) | 3.4.21.26 (Prolyl oligopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_014330ORProlyl oligopeptidase (Precursor)ANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_014330 OR Prolyl oligopeptidase (Precursor) AND Neospora caninum Liverpool |
|
NCLIV_014700 | NCLIV_014700-t26_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 783 | NCLIV_014700 | conserved hypothetical protein | conserved hypothetical protein | 13444143 | F0VCI7 | V | FR823386:2,097,112..2,098,308(-) | FR823386:2097112..2098308(-) | FR823386 | Neospora caninum Liverpool | 21 | OG6_110253 | 0 | 260 | 783 | 29452 | 6.61 | 6 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_014700ORconserved hypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_014700 OR conserved hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_015220 | NCLIV_015220-t26_1 | 6 | 6 | 1 | | | reverse | protein coding | No | 1266 | NCLIV_015220 | hypothetical protein | hypothetical protein | 13444195 | F0VCN9 | V | FR823386:2,555,020..2,559,835(-) | FR823386:2555020..2559835(-) | FR823386 | Neospora caninum Liverpool | 47 | OG6_101256 | 1 | 421 | 1266 | 43949 | 4.41 | 0 | HMM: MALGGGPGGGSPLLVSAADILAA, NN: MALGGGPGGGSPLLVSAADILAAAV | NN Sum: 0, NN D: .2, HMM Prob: .69 | | | | | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_015220ORhypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_015220 OR hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_016120 | NCLIV_016120-t26_1 | 4 | 4 | 1 | | | forward | protein coding | No | 759 | NCLIV_016120 | putative proteasome subunit alpha type 4, subunit | putative proteasome subunit alpha type 4, subunit | 13444451 | F0VDM7 | VI | FR823387:658,723..661,020(+) | FR823387:658723..661020(+) | FR823387 | Neospora caninum Liverpool | 28 | OG6_101968 | 0 | 252 | 759 | 27978 | 4.99 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_016120ORputative proteasome subunit alpha type 4, subunitANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_016120 OR putative proteasome subunit alpha type 4, subunit AND Neospora caninum Liverpool |
|
NCLIV_016510 | NCLIV_016510-t26_1 | 7 | 7 | 1 | | | forward | protein coding | No | 2583 | NCLIV_016510 | putative subtilase family serine protease | putative subtilase family serine protease | 13444489 | F0VDR6 | VI | FR823387:926,524..932,864(+) | FR823387:926524..932864(+) | FR823387 | Neospora caninum Liverpool | 22 | OG6_490834 | 0 | 860 | 2583 | 92355 | 5.09 | 0 | | | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.21.62 (Subtilisin) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_016510ORputative subtilase family serine proteaseANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_016510 OR putative subtilase family serine protease AND Neospora caninum Liverpool |
|
NCLIV_0169 | NCLIV_0169-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1284 | NCLIV_0169 | hydrolase, alpha/beta fold family domain-containing protein | hydrolase, alpha/beta fold family domain-containing protein | 13444616 | F0VDW3 | VI | FR823387:1,255,181..1,256,464(-) | FR823387:1255181..1256464(-) | FR823387 | Neospora caninum Liverpool | 29 | OG6_101420 | 0 | 427 | 1284 | 46203 | 7.71 | 0 | HMM: MQASSVSPSLSSVSLRSLSTSAS, NN: MQASSVSPSLSSVSLRSLSTSASS | NN Sum: 0, NN D: .12, HMM Prob: .64 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_0169ORhydrolase, alpha/beta fold family domain-containing proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_0169 OR hydrolase, alpha/beta fold family domain-containing protein AND Neospora caninum Liverpool |
|
NCLIV_017470 | NCLIV_017470-t26_1 | 8 | 8 | 1 | | | forward | protein coding | No | 891 | NCLIV_017470 | Proteasome subunit alpha type | Proteasome subunit alpha type | 13444664 | F0VE12 | VI | FR823387:1,676,132..1,680,697(+) | FR823387:1676132..1680697(+) | FR823387 | Neospora caninum Liverpool | 23 | OG6_102240 | 0 | 296 | 891 | 32860 | 7.94 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_017470ORProteasome subunit alpha typeANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_017470 OR Proteasome subunit alpha type AND Neospora caninum Liverpool |
|
NCLIV_017720 | NCLIV_017720-t26_1 | 10 | 10 | 1 | | | reverse | protein coding | No | 2223 | NCLIV_017720 | hypothetical protein | hypothetical protein | 13444767 | F0VE37 | VI | FR823387:1,935,450..1,941,555(-) | FR823387:1935450..1941555(-) | FR823387 | Neospora caninum Liverpool | 32 | OG6_107443 | 0 | 740 | 2223 | 79496 | 4.82 | 1 | HMM: MLFVFAVFSPPLSDRLFSGALPAQASSS, NN: MLFVFAVFSPPLSDRLFSG | NN Sum: 0, NN D: .31, HMM Prob: .65 | | | | | | | | | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_017720ORhypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_017720 OR hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_018000 | NCLIV_018000-t26_1 | 6 | 6 | 1 | | | reverse | protein coding | No | 2829 | NCLIV_018000 | YALI0F09812p, related | YALI0F09812p, related | 13444797 | F0VE66 | VI | FR823387:2,164,807..2,169,574(-) | FR823387:2164807..2169574(-) | FR823387 | Neospora caninum Liverpool | 20 | OG6_224208 | 0 | 942 | 2829 | 102550 | 5.85 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_018000ORYALI0F09812p, relatedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_018000 OR YALI0F09812p, related AND Neospora caninum Liverpool |
|
NCLIV_0181 | NCLIV_0181-t26_1 | 5 | 5 | 1 | | | reverse | protein coding | No | 4077 | NCLIV_0181 | OTU-like cysteine protease domain-containing protein | OTU-like cysteine protease domain-containing protein | 13444814 | F0VE82 | VI | FR823387:2,328,543..2,333,928(-) | FR823387:2328543..2333928(-) | FR823387 | Neospora caninum Liverpool | 20 | OG6_110771 | 0 | 1358 | 4077 | 141491 | 9.44 | 0 | HMM: MKNGTEVAASCAVVAESSRVEAA, NN: MKNGTEVAASCAVVAESSRVEAA | NN Sum: 0, NN D: .1, HMM Prob: .58 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_0181OROTU-like cysteine protease domain-containing proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_0181 OR OTU-like cysteine protease domain-containing protein AND Neospora caninum Liverpool |
|
NCLIV_018100 | NCLIV_018100-t26_1 | 7 | 7 | 1 | | | forward | protein coding | No | 1737 | NCLIV_018100 | hypothetical protein | hypothetical protein | 13444798 | F0VE76 | VI | FR823387:2,279,883..2,285,050(+) | FR823387:2279883..2285050(+) | FR823387 | Neospora caninum Liverpool | 27 | OG6_101559 | 0 | 578 | 1737 | 63614 | 5.41 | 0 | HMM: MVFRALLLLCLLWPPGMQF, NN: MVFRALLLLCLLWPPGMQF | NN Sum: 4, NN D: .87, HMM Prob: 1 | | | GO:0016787;GO:0008242 | hydrolase activity;omega peptidase activity | | | | | | | | | 3.4.19.9 (Folate gamma-glutamyl hydrolase) | 3.4.19.9 (Folate gamma-glutamyl hydrolase) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_018100ORhypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_018100 OR hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_018240 | NCLIV_018240-t26_1 | 7 | 7 | 1 | | | reverse | protein coding | No | 1128 | NCLIV_018240 | Similar to uniprot|P38747 Saccharomyces cerevisiae YHL013c, related | Similar to uniprot|P38747 Saccharomyces cerevisiae YHL013c, related | 13444821 | F0VE90 | VI | FR823387:2,393,384..2,397,339(-) | FR823387:2393384..2397339(-) | FR823387 | Neospora caninum Liverpool | 30 | OG6_102788 | 0 | 375 | 1128 | 40561 | 5.25 | 0 | | | | | | | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_018240ORSimilar to uniprot|P38747 Saccharomyces cerevisiae YHL013c, relatedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_018240 OR Similar to uniprot|P38747 Saccharomyces cerevisiae YHL013c, related AND Neospora caninum Liverpool |
|
NCLIV_019040 | NCLIV_019040-t26_1 | 3 | 3 | 1 | | | forward | protein coding | No | 3345 | NCLIV_019040 | Peptidase M16 domain protein, related | Peptidase M16 domain protein, related | 13444981 | F0VEH1 | VI | FR823387:3,024,131..3,028,223(+) | FR823387:3024131..3028223(+) | FR823387 | Neospora caninum Liverpool | 14 | OG6_490308 | 0 | 1114 | 3345 | 125376 | 5.81 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.56 (Insulysin) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_019040ORPeptidase M16 domain protein, relatedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_019040 OR Peptidase M16 domain protein, related AND Neospora caninum Liverpool |
|
NCLIV_019450 | NCLIV_019450-t26_1 | 4 | 4 | 1 | | | reverse | protein coding | No | 672 | NCLIV_019450 | hypothetical protein | hypothetical protein | 13443921 | F0VEL2 | VIIa | FR823388:110,664..112,639(-) | FR823388:110664..112639(-) | FR823388 | Neospora caninum Liverpool | 33 | OG6_100807 | 0 | 223 | 672 | 24700 | 8.20 | 2 | | | GO:0016020 | membrane | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | | | | | | | | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_019450ORhypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_019450 OR hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_019470 | NCLIV_019470-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1584 | NCLIV_019470 | conserved hypothetical protein | conserved hypothetical protein | 13443923 | F0VEL4 | VIIa | FR823388:128,717..130,300(+) | FR823388:128717..130300(+) | FR823388 | Neospora caninum Liverpool | 16 | OG6_490508 | 0 | 527 | 1584 | 57897 | 11.43 | 0 | HMM: MSRHPALGSPASRHFFLCVFLFFALSHVTPISSS, NN: MSRHPALGSPASRHFFLCVFLFFALSH | NN Sum: 4, NN D: .64, HMM Prob: 1 | GO:0016020 | membrane | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_019470ORconserved hypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_019470 OR conserved hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_019480 | NCLIV_019480-t26_1 | 7 | 7 | 1 | | | reverse | protein coding | No | 804 | NCLIV_019480 | proteasome A-type and B-type domain-containing protein | proteasome A-type and B-type domain-containing protein | 13443924 | F0VEL5 | VIIa | FR823388:131,943..135,160(-) | FR823388:131943..135160(-) | FR823388 | Neospora caninum Liverpool | 26 | OG6_101718 | 0 | 267 | 804 | 30356 | 6.51 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_019480ORproteasome A-type and B-type domain-containing proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_019480 OR proteasome A-type and B-type domain-containing protein AND Neospora caninum Liverpool |
|
NCLIV_020050 | NCLIV_020050-t26_1 | 6 | 6 | 1 | | | forward | protein coding | No | 1242 | NCLIV_020050 | Zinc finger (C3HC4 RING finger) protein, related | Zinc finger (C3HC4 RING finger) protein, related | 13444060 | F0VES2 | VIIa | FR823388:773,343..776,517(+) | FR823388:773343..776517(+) | FR823388 | Neospora caninum Liverpool | 22 | OG6_102074 | 0 | 413 | 1242 | 44211 | 4.63 | 2 | | | | | | | | | | | | | | | | 6.3.2.19 (Transferred entry: 2.3.2.23, 2.3.2.27 and 6.2.1.45) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_020050ORZinc finger (C3HC4 RING finger) protein, relatedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_020050 OR Zinc finger (C3HC4 RING finger) protein, related AND Neospora caninum Liverpool |
|
NCLIV_020890 | NCLIV_020890-t26_1 | 7 | 7 | 1 | | | forward | protein coding | No | 3702 | NCLIV_020890 | putative subtilase family serine protease | putative subtilase family serine protease | 13444225 | F0VF08 | VIIa | FR823388:1,370,782..1,377,732(+) | FR823388:1370782..1377732(+) | FR823388 | Neospora caninum Liverpool | 23 | OG6_223122 | 0 | 1233 | 3702 | 133475 | 5.08 | 0 | HMM: MGILGFPFRALFQSGYEARRRGVSLSQERSGFLVSRLLLGFLLHEFWSQSPGFVSAA, NN: MGILGFPFRALFQSGYEARRRGVSLSQERSGFLVSRLLLGFLLHEFWSQSPGFVSAA | NN Sum: 0, NN D: .16, HMM Prob: .89 | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.21.62 (Subtilisin) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_020890ORputative subtilase family serine proteaseANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_020890 OR putative subtilase family serine protease AND Neospora caninum Liverpool |
|
NCLIV_021050 | NCLIV_021050-t26_1 | 8 | 8 | 1 | | | forward | protein coding | No | 2598 | NCLIV_021050 | unspecified product | unspecified product | 13444241 | F0VF24 | VIIa | FR823388:1,533,187..1,539,181(+) | FR823388:1533187..1539181(+) | FR823388 | Neospora caninum Liverpool | 56 | OG6_121085 | 1 | 865 | 2598 | 93193 | 5.48 | 0 | HMM: MRASHILLACSVLIVLLCMDARGL, NN: MRASHILLACSVLIVLLCMDARGL | NN Sum: 4, NN D: .82, HMM Prob: 1 | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.21.62 (Subtilisin) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_021050ORunspecified productANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_021050 OR unspecified product AND Neospora caninum Liverpool |
|
NCLIV_021070 | NCLIV_021070-t26_1 | 5 | 5 | 1 | | | reverse | protein coding | No | 2424 | NCLIV_021070 | conserved hypothetical protein | conserved hypothetical protein | 13444242 | F0VF25 | VIIa | FR823388:1,544,283..1,548,303(-) | FR823388:1544283..1548303(-) | FR823388 | Neospora caninum Liverpool | 16 | OG6_101989 | 0 | 807 | 2424 | 86885 | 8.23 | 10 | | | GO:0016021 | integral component of membrane | GO:0004190 | aspartic-type endopeptidase activity | GO:0016485 | protein processing | | | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_021070ORconserved hypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_021070 OR conserved hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_021650 | NCLIV_021650-t26_1 | 10 | 10 | 1 | | | forward | protein coding | No | 4005 | NCLIV_021650 | hypothetical protein | hypothetical protein | 13444378 | F0VF83 | VIIa | FR823388:2,112,972..2,122,323(+) | FR823388:2112972..2122323(+) | FR823388 | Neospora caninum Liverpool | 35 | OG6_102131 | 0 | 1334 | 4005 | 143232 | 6.00 | 2 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_021650ORhypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_021650 OR hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_022010 | NCLIV_022010-t26_1 | 5 | 5 | 1 | | | forward | protein coding | No | 651 | NCLIV_022010 | conserved hypothetical protein | conserved hypothetical protein | 13444414 | F0VFB8 | VIIa | FR823388:2,440,266..2,441,155(+) | FR823388:2440266..2441155(+) | FR823388 | Neospora caninum Liverpool | 23 | OG6_162756 | 0 | 216 | 651 | 23886 | 6.67 | 0 | HMM: MKRVTAVATLAGTFVHILRASAK, NN: MKRVTAVATLAGTFVHILRASAK | NN Sum: 4, NN D: .66, HMM Prob: .99 | | | GO:0004181;GO:0008270 | metallocarboxypeptidase activity;zinc ion binding | GO:0006508 | proteolysis | | | | | | | | 3.4.17.1 (Carboxypeptidase A) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_022010ORconserved hypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_022010 OR conserved hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_022220 | NCLIV_022220-t26_1 | 8 | 8 | 1 | | | reverse | protein coding | No | 1725 | NCLIV_022220 | hypothetical protein | hypothetical protein | 13444434 | F0VFD9 | VIIa | FR823388:2,591,381..2,596,332(-) | FR823388:2591381..2596332(-) | FR823388 | Neospora caninum Liverpool | 27 | OG6_102381 | 0 | 574 | 1725 | 63200 | 8.44 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_022220ORhypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_022220 OR hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_022310 | NCLIV_022310-t26_1 | 16 | 16 | 1 | | | reverse | protein coding | No | 3240 | NCLIV_022310 | Cell division protease FtsH homolog, related | Cell division protease FtsH homolog, related | 13444443 | F0VFE8 | VIIa | FR823388:2,677,332..2,686,883(-) | FR823388:2677332..2686883(-) | FR823388 | Neospora caninum Liverpool | 42 | OG6_100384 | 0 | 1079 | 3240 | 117195 | 9.43 | 2 | | | | | GO:0005524;GO:0004222 | ATP binding;metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.24.- (Metalloendopeptidases.) | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_022310ORCell division protease FtsH homolog, relatedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_022310 OR Cell division protease FtsH homolog, related AND Neospora caninum Liverpool |
|
NCLIV_022360 | NCLIV_022360-t26_1 | 18 | 18 | 1 | | | forward | protein coding | No | 3081 | NCLIV_022360 | ATP-dependent Clp protease ATP-binding subunit clpC homolog, chloroplastic (Precursor), related | ATP-dependent Clp protease ATP-binding subunit clpC homolog, chloroplastic (Precursor), related | 13444527 | F0VFF3 | VIIa | FR823388:2,718,160..2,731,499(+) | FR823388:2718160..2731499(+) | FR823388 | Neospora caninum Liverpool | 120 | OG6_100223 | 3 | 1026 | 3081 | 111648 | 8.11 | 0 | | | | | GO:0005524 | ATP binding | GO:0019538 | protein metabolic process | | | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_022360ORATP-dependent Clp protease ATP-binding subunit clpC homolog, chloroplastic (Precursor), relatedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_022360 OR ATP-dependent Clp protease ATP-binding subunit clpC homolog, chloroplastic (Precursor), related AND Neospora caninum Liverpool |
|
NCLIV_022600 | NCLIV_022600-t26_1 | 3 | 3 | 1 | | | forward | protein coding | No | 1761 | NCLIV_022600 | putative glycoprotease family domain-containing protein | putative glycoprotease family domain-containing protein | 13444760 | F0VFH7 | VIIa | FR823388:2,946,758..2,949,391(+) | FR823388:2946758..2949391(+) | FR823388 | Neospora caninum Liverpool | 43 | OG6_100288 | 1 | 586 | 1761 | 63234 | 6.35 | 0 | HMM: MAALGAVGPVLESTAHSS, NN: MAALGAVGPVLESTAHSSVQYPASGSLLCLGIESSAN | NN Sum: 0, NN D: .09, HMM Prob: .51 | | | | | | | | | | | | | | 2.3.1.234 (N(6)-L-threonylcarbamoyladenine synthase) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_022600ORputative glycoprotease family domain-containing proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_022600 OR putative glycoprotease family domain-containing protein AND Neospora caninum Liverpool |
|
NCLIV_022920 | NCLIV_022920-t26_1 | 9 | 9 | 1 | | | forward | protein coding | No | 1746 | NCLIV_022920 | Renin, related | Renin, related | 13444583 | F0VFK9 | VIIa | FR823388:3,248,482..3,253,856(+) | FR823388:3248482..3253856(+) | FR823388 | Neospora caninum Liverpool | 50 | OG6_100536 | 1 | 581 | 1746 | 63689 | 8.40 | 0 | | | | | | | | | | | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_022920ORRenin, relatedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_022920 OR Renin, related AND Neospora caninum Liverpool |
|
NCLIV_0234 | NCLIV_0234-t26_1 | 7 | 7 | 1 | | | forward | protein coding | No | 840 | NCLIV_0234 | glutamine amidotransferase, SNO family domain-containing protein | glutamine amidotransferase, SNO family domain-containing protein | 13444716 | F0VFR2 | VIIa | FR823388:3,627,397..3,631,556(+) | FR823388:3627397..3631556(+) | FR823388 | Neospora caninum Liverpool | 19 | OG6_103407 | 0 | 279 | 840 | 29907 | 6.92 | 0 | | | | | GO:0004359 | glutaminase activity | GO:0042823;GO:0042819 | pyridoxal phosphate biosynthetic process;vitamin B6 biosynthetic process | | | | | | | | 3.5.1.2 (Glutaminase) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_0234ORglutamine amidotransferase, SNO family domain-containing proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_0234 OR glutamine amidotransferase, SNO family domain-containing protein AND Neospora caninum Liverpool |
|
NCLIV_023810 | NCLIV_023810-t26_1 | 17 | 17 | 1 | | | forward | protein coding | No | 2913 | NCLIV_023810 | ATP-dependent chaperone ClpB, related | ATP-dependent chaperone ClpB, related | 13444751 | F0VFU8 | VIIa | FR823388:3,909,024..3,916,380(+) | FR823388:3909024..3916380(+) | FR823388 | Neospora caninum Liverpool | 120 | OG6_100223 | 3 | 970 | 2913 | 106882 | 8.49 | 0 | HMM: MAGARRVPTGSRAASARRLMLAAAFAIFALTWQTRGVEAG, NN: MAGARRVPTGSRAASARRLMLAAAFAIFALTWQTRGVEAG | NN Sum: 4, NN D: .57, HMM Prob: 1 | | | GO:0005524 | ATP binding | GO:0019538 | protein metabolic process | | | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_023810ORATP-dependent chaperone ClpB, relatedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_023810 OR ATP-dependent chaperone ClpB, related AND Neospora caninum Liverpool |
|
NCLIV_024470 | NCLIV_024470-t26_1 | 3 | 3 | 1 | | | reverse | protein coding | No | 810 | NCLIV_024470 | hypothetical protein | hypothetical protein | 13444904 | F0VG15 | VIIb | FR823389:506,884..508,836(-) | FR823389:506884..508836(-) | FR823389 | Neospora caninum Liverpool | 30 | OG6_101218 | 0 | 269 | 810 | 29380 | 5.38 | 0 | | | GO:0005622 | intracellular | GO:0004843 | thiol-dependent ubiquitin-specific protease activity | GO:0006511 | ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_024470ORhypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_024470 OR hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_024510 | NCLIV_024510-t26_1 | 21 | 21 | 1 | | | forward | protein coding | No | 3327 | NCLIV_024510 | Ubiquitin carboxyl-terminal hydrolase, related | Ubiquitin carboxyl-terminal hydrolase, related | 13444908 | F0VG19 | VIIb | FR823389:530,423..539,308(+) | FR823389:530423..539308(+) | FR823389 | Neospora caninum Liverpool | 38 | OG6_101021 | 1 | 1108 | 3327 | 123089 | 5.23 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | 3.1.2.15 (Deleted entry) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_024510ORUbiquitin carboxyl-terminal hydrolase, relatedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_024510 OR Ubiquitin carboxyl-terminal hydrolase, related AND Neospora caninum Liverpool |
|
NCLIV_024640 | NCLIV_024640-t26_1 | 9 | 9 | 1 | | | reverse | protein coding | No | 852 | NCLIV_024640 | Rhomboid family protein, related | Rhomboid family protein, related | 13445000 | F0VG32 | VIIb | FR823389:611,479..616,409(-) | FR823389:611479..616409(-) | FR823389 | Neospora caninum Liverpool | 22 | OG6_183612 | 0 | 283 | 852 | 30371 | 7.86 | 7 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_024640ORRhomboid family protein, relatedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_024640 OR Rhomboid family protein, related AND Neospora caninum Liverpool |
|
NCLIV_024980 | NCLIV_024980-t26_1 | 18 | 18 | 1 | | | forward | protein coding | No | 1407 | NCLIV_024980 | Pepsinogen A1, related | Pepsinogen A1, related | 13445033 | F0VG65 | VIIb | FR823389:850,656..853,061(+) | FR823389:850656..853061(+) | FR823389 | Neospora caninum Liverpool | 50 | OG6_100536 | 1 | 468 | 1407 | 51384 | 6.62 | 0 | HMM: MRLLHTIACVAVCCSPAFAV, NN: MRLLHTIACVAVCCSPAFAV | NN Sum: 3, NN D: .58, HMM Prob: 1 | | | | | | | | | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_024980ORPepsinogen A1, relatedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_024980 OR Pepsinogen A1, related AND Neospora caninum Liverpool |
|
NCLIV_025000 | NCLIV_025000-t26_1 | 11 | 11 | 1 | | | forward | protein coding | No | 3138 | NCLIV_025000 | hypothetical protein | hypothetical protein | 13445035 | F0VG67 | VIIb | FR823389:866,344..874,354(+) | FR823389:866344..874354(+) | FR823389 | Neospora caninum Liverpool | 111 | OG6_105727 | 2 | 1045 | 3138 | 112589 | 5.95 | 1 | HMM: MMAEQRDRSQRARWTARALFLLAWLAVGLEMLFWNSNSSFVCPKAHAV, NN: MMAEQRDRSQRARWTARALFLLAWLAVGLEMLFWNSNSSF | NN Sum: 2, NN D: .47, HMM Prob: .97 | | | GO:0005515 | protein binding | | | | | | | | | | 3.4.21.108 (HtrA2 peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_025000ORhypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_025000 OR hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_025340 | NCLIV_025340-t26_1 | 5 | 5 | 1 | | | reverse | protein coding | No | 792 | NCLIV_025340 | hypothetical protein | hypothetical protein | 13445064 | F0VGA2 | VIIb | FR823389:1,145,232..1,147,397(-) | FR823389:1145232..1147397(-) | FR823389 | Neospora caninum Liverpool | 62 | OG6_100915 | 1 | 263 | 792 | 29387 | 8.32 | 0 | | | | | | | | | | | | | | | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_025340ORhypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_025340 OR hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_025680 | NCLIV_025680-t26_1 | 8 | 8 | 1 | | | forward | protein coding | No | 2484 | NCLIV_025680 | secreted alpha/beta hydrolase superfamiy protein | secreted alpha/beta hydrolase superfamiy protein | 13442652 | F0VGD6 | VIIb | FR823389:1,412,726..1,417,856(+) | FR823389:1412726..1417856(+) | FR823389 | Neospora caninum Liverpool | 25 | OG6_129556 | 0 | 827 | 2484 | 89399 | 7.03 | 0 | | | | | | | | | | | | | | | | 3.4.11.- (Aminopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_025680ORsecreted alpha/beta hydrolase superfamiy proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_025680 OR secreted alpha/beta hydrolase superfamiy protein AND Neospora caninum Liverpool |
|
NCLIV_025890 | NCLIV_025890-t26_1 | 12 | 12 | 1 | | | forward | protein coding | No | 2055 | NCLIV_025890 | Peptidase M24, related | Peptidase M24, related | 13442672 | F0VGF6 | VIIb | FR823389:1,558,480..1,565,973(+) | FR823389:1558480..1565973(+) | FR823389 | Neospora caninum Liverpool | 30 | OG6_100896 | 0 | 684 | 2055 | 74165 | 5.90 | 0 | | | | | GO:0016787 | hydrolase activity | | | | | | | | | | 3.4.11.9 (Xaa-Pro aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_025890ORPeptidase M24, relatedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_025890 OR Peptidase M24, related AND Neospora caninum Liverpool |
|
NCLIV_025950 | NCLIV_025950-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1944 | NCLIV_025950 | Aspartic protease 7, related | Aspartic protease 7, related | 13442678 | F0VGG2 | VIIb | FR823389:1,586,702..1,588,645(-) | FR823389:1586702..1588645(-) | FR823389 | Neospora caninum Liverpool | 23 | OG6_158722 | 0 | 647 | 1944 | 70247 | 5.96 | 0 | | | | | | | | | | | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_025950ORAspartic protease 7, relatedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_025950 OR Aspartic protease 7, related AND Neospora caninum Liverpool |
|
NCLIV_025990 | NCLIV_025990-t26_1 | 7 | 7 | 1 | | | reverse | protein coding | No | 1518 | NCLIV_025990 | conserved hypothetical protein | conserved hypothetical protein | 13442682 | F0VGG6 | VIIb | FR823389:1,611,306..1,614,902(-) | FR823389:1611306..1614902(-) | FR823389 | Neospora caninum Liverpool | 56 | OG6_110414 | 2 | 505 | 1518 | 53213 | 5.01 | 0 | | | | | | | | | | | | | | | | 3.-.-.- (Hydrolases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_025990ORconserved hypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_025990 OR conserved hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_026270 | NCLIV_026270-t26_1 | 8 | 8 | 1 | | | reverse | protein coding | No | 1128 | NCLIV_026270 | 26S proteasome regulatory subunit S4 like AAA ATpase, related | 26S proteasome regulatory subunit S4 like AAA ATpase, related | 13442789 | F0VGJ4 | VIIb | FR823389:1,868,285..1,873,076(-) | FR823389:1868285..1873076(-) | FR823389 | Neospora caninum Liverpool | 37 | OG6_101513 | 0 | 375 | 1128 | 42256 | 8.68 | 0 | | | | | GO:0005524 | ATP binding | | | | | | | | | | 3.6.4.3 (Transferred entry: 5.6.1.1) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_026270OR26S proteasome regulatory subunit S4 like AAA ATpase, relatedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_026270 OR 26S proteasome regulatory subunit S4 like AAA ATpase, related AND Neospora caninum Liverpool |
|
NCLIV_026530 | NCLIV_026530-t26_1 | 4 | 4 | 1 | | | reverse | protein coding | No | 930 | NCLIV_026530 | putative ubiquitin thiolesterase protein | putative ubiquitin thiolesterase protein | 13442815 | F0VGM0 | VIIb | FR823389:2,087,212..2,089,605(-) | FR823389:2087212..2089605(-) | FR823389 | Neospora caninum Liverpool | 27 | OG6_102549 | 0 | 309 | 930 | 34240 | 4.28 | 0 | | | | | | | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_026530ORputative ubiquitin thiolesterase proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_026530 OR putative ubiquitin thiolesterase protein AND Neospora caninum Liverpool |
|
NCLIV_027270 | NCLIV_027270-t26_1 | 8 | 8 | 1 | | | reverse | protein coding | No | 2880 | NCLIV_027270 | putative cell division protein | putative cell division protein | 13442968 | F0VGU4 | VIIb | FR823389:2,676,821..2,683,262(-) | FR823389:2676821..2683262(-) | FR823389 | Neospora caninum Liverpool | 26 | OG6_134869 | 0 | 959 | 2880 | 105007 | 5.26 | 0 | HMM: MFVSFLTFRLLHSLHDGADSV, NN: MFVSFLTFRLLHSLHDGADSV | NN Sum: 4, NN D: .59, HMM Prob: .54 | | | GO:0005524;GO:0004222 | ATP binding;metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_027270ORputative cell division proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_027270 OR putative cell division protein AND Neospora caninum Liverpool |
|
NCLIV_027730 | NCLIV_027730-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1104 | NCLIV_027730 | hypothetical protein | hypothetical protein | 13443015 | F0VGZ0 | VIIb | FR823389:3,041,638..3,042,741(-) | FR823389:3041638..3042741(-) | FR823389 | Neospora caninum Liverpool | 26 | OG6_110278 | 0 | 367 | 1104 | 40404 | 9.09 | 0 | | | | | | | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_027730ORhypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_027730 OR hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_028230 | NCLIV_028230-t26_1 | 6 | 6 | 1 | | | reverse | protein coding | No | 741 | NCLIV_028230 | Proteasome subunit alpha type-7, related | Proteasome subunit alpha type-7, related | 13443144 | F0VH40 | VIIb | FR823389:3,383,083..3,385,904(-) | FR823389:3383083..3385904(-) | FR823389 | Neospora caninum Liverpool | 27 | OG6_101207 | 0 | 246 | 741 | 27186 | 6.52 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_028230ORProteasome subunit alpha type-7, relatedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_028230 OR Proteasome subunit alpha type-7, related AND Neospora caninum Liverpool |
|
NCLIV_028370 | NCLIV_028370-t26_1 | 11 | 11 | 1 | | | forward | protein coding | No | 2787 | NCLIV_028370 | hypothetical protein | hypothetical protein | 13443157 | F0VH54 | VIIb | FR823389:3,496,441..3,504,505(+) | FR823389:3496441..3504505(+) | FR823389 | Neospora caninum Liverpool | 120 | OG6_100223 | 3 | 928 | 2787 | 104298 | 6.61 | 0 | | | | | GO:0005524 | ATP binding | GO:0019538 | protein metabolic process | | | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_028370ORhypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_028370 OR hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_028520 | NCLIV_028520-t26_1 | 10 | 10 | 1 | | | forward | protein coding | No | 876 | NCLIV_028520 | putative methionine aminopeptidase | putative methionine aminopeptidase | 13443172 | F0VH69 | VIIb | FR823389:3,635,377..3,640,997(+) | FR823389:3635377..3640997(+) | FR823389 | Neospora caninum Liverpool | 29 | OG6_124490 | 0 | 291 | 876 | 31323 | 5.33 | 0 | | | | | GO:0004177;GO:0008235 | aminopeptidase activity;metalloexopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_028520ORputative methionine aminopeptidaseANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_028520 OR putative methionine aminopeptidase AND Neospora caninum Liverpool |
|
NCLIV_028760 | NCLIV_028760-t26_1 | 14 | 14 | 1 | | | reverse | protein coding | No | 11928 | NCLIV_028760 | putative ubiquitin carboxyl-terminal hydrolase | putative ubiquitin carboxyl-terminal hydrolase | 13443275 | F0VH93 | VIIb | FR823389:3,853,885..3,872,994(-) | FR823389:3853885..3872994(-) | FR823389 | Neospora caninum Liverpool | 33 | OG6_104835 | 0 | 3975 | 11928 | 423551 | 5.52 | 0 | | | | | GO:0004843;GO:0036459 | thiol-dependent ubiquitin-specific protease activity;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_028760ORputative ubiquitin carboxyl-terminal hydrolaseANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_028760 OR putative ubiquitin carboxyl-terminal hydrolase AND Neospora caninum Liverpool |
|
NCLIV_029600 | NCLIV_029600-t26_1 | 3 | 3 | 1 | | | forward | protein coding | No | 2994 | NCLIV_029600 | conserved hypothetical protein | conserved hypothetical protein | 13443439 | F0VHH8 | VIIb | FR823389:4,551,720..4,555,525(+) | FR823389:4551720..4555525(+) | FR823389 | Neospora caninum Liverpool | 16 | OG6_491023 | 0 | 997 | 2994 | 107804 | 6.97 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_029600ORconserved hypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_029600 OR conserved hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_029840 | NCLIV_029840-t26_1 | 3 | 3 | 1 | | | reverse | protein coding | No | 1422 | NCLIV_029840 | conserved hypothetical protein | conserved hypothetical protein | 13443462 | F0VHK2 | VIIb | FR823389:4,742,006..4,745,218(-) | FR823389:4742006..4745218(-) | FR823389 | Neospora caninum Liverpool | 23 | OG6_102968 | 0 | 473 | 1422 | 51798 | 8.23 | 0 | | | | | GO:0004222 | metalloendopeptidase activity | | | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_029840ORconserved hypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_029840 OR conserved hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_029950 | NCLIV_029950-t26_1 | 4 | 4 | 1 | | | forward | protein coding | No | 1854 | NCLIV_029950 | hypothetical protein | hypothetical protein | 13443473 | F0VHL3 | VIIb | FR823389:4,813,456..4,816,200(+) | FR823389:4813456..4816200(+) | FR823389 | Neospora caninum Liverpool | 87 | OG6_100422 | 1 | 617 | 1854 | 69297 | 6.48 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.56 (Insulysin) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_029950ORhypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_029950 OR hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_030070 | NCLIV_030070-t26_1 | 6 | 6 | 1 | | | forward | protein coding | No | 678 | NCLIV_030070 | conserved hypothetical protein | conserved hypothetical protein | 13443579 | F0VJZ0 | VIII | FR823390:23,556..26,183(+) | FR823390:23556..26183(+) | FR823390 | Neospora caninum Liverpool | 23 | OG6_137524 | 0 | 225 | 678 | 25038 | 4.72 | 2 | | | GO:0016021;GO:0005787 | integral component of membrane;signal peptidase complex | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | | | | | | | | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_030070ORconserved hypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_030070 OR conserved hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_030480 | NCLIV_030480-t26_1 | 9 | 9 | 1 | | | reverse | protein coding | No | 1245 | NCLIV_030480 | hypothetical protein | hypothetical protein | 13443620 | F0VHQ0 | VIII | FR823390:331,387..336,214(-) | FR823390:331387..336214(-) | FR823390 | Neospora caninum Liverpool | 26 | OG6_104644 | 0 | 414 | 1245 | 46781 | 5.02 | 0 | | | | | GO:0005515;GO:0004843 | protein binding;thiol-dependent ubiquitin-specific protease activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_030480ORhypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_030480 OR hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_030520 | NCLIV_030520-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2637 | NCLIV_030520 | hypothetical protein | hypothetical protein | 13443624 | F0VHQ4 | VIII | FR823390:361,036..363,672(-) | FR823390:361036..363672(-) | FR823390 | Neospora caninum Liverpool | 25 | OG6_104209 | 0 | 878 | 2637 | 93748 | 5.13 | 0 | | | | | | | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_030520ORhypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_030520 OR hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_030650 | NCLIV_030650-t26_1 | 10 | 10 | 1 | | | forward | protein coding | No | 1251 | NCLIV_030650 | putative 26S protease regulatory subunit 6b | putative 26S protease regulatory subunit 6b | 13443633 | F0VHR7 | VIII | FR823390:450,103..455,566(+) | FR823390:450103..455566(+) | FR823390 | Neospora caninum Liverpool | 30 | OG6_101965 | 0 | 416 | 1251 | 47017 | 6.54 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | | | | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_030650ORputative 26S protease regulatory subunit 6bANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_030650 OR putative 26S protease regulatory subunit 6b AND Neospora caninum Liverpool |
|
NCLIV_031420 | NCLIV_031420-t26_1 | 5 | 5 | 1 | | | reverse | protein coding | No | 1704 | NCLIV_031420 | putative subtilase family serine protease | putative subtilase family serine protease | 13443793 | F0VHZ4 | VIII | FR823390:1,126,711..1,130,122(-) | FR823390:1126711..1130122(-) | FR823390 | Neospora caninum Liverpool | 25 | OG6_105356 | 0 | 567 | 1704 | 60781 | 5.62 | 0 | | | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.21.66 (Thermitase) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_031420ORputative subtilase family serine proteaseANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_031420 OR putative subtilase family serine protease AND Neospora caninum Liverpool |
|
NCLIV_031500 | NCLIV_031500-t26_1 | 10 | 10 | 1 | | | forward | protein coding | No | 2298 | NCLIV_031500 | hypothetical protein | hypothetical protein | 13443801 | F0VI02 | VIII | FR823390:1,166,704..1,172,078(+) | FR823390:1166704..1172078(+) | FR823390 | Neospora caninum Liverpool | 32 | OG6_104880 | 0 | 765 | 2298 | 81729 | 7.61 | 3 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_031500ORhypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_031500 OR hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_032060 | NCLIV_032060-t26_1 | 8 | 8 | 1 | | | forward | protein coding | No | 1389 | NCLIV_032060 | putative peptidase family T4 | putative peptidase family T4 | 13442593 | F0VI58 | VIII | FR823390:1,682,153..1,687,018(+) | FR823390:1682153..1687018(+) | FR823390 | Neospora caninum Liverpool | 21 | OG6_123077 | 0 | 462 | 1389 | 47586 | 5.51 | 0 | HMM: MWTGSGVSFLCHVEKPALAE, NN: MWTGSGVSFLCHVEKPALAE | NN Sum: 1, NN D: .18, HMM Prob: .61 | | | | | | | | | | | | | | 3.4.11.- (Aminopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_032060ORputative peptidase family T4ANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_032060 OR putative peptidase family T4 AND Neospora caninum Liverpool |
|
NCLIV_032340 | NCLIV_032340-t26_1 | 13 | 13 | 1 | | | reverse | protein coding | No | 5955 | NCLIV_032340 | PAB-dependent poly(A)-specific ribonuclease subunit PAN2, related | PAB-dependent poly(A)-specific ribonuclease subunit PAN2, related | 13442621 | F0VI86 | VIII | FR823390:1,906,124..1,920,534(-) | FR823390:1906124..1920534(-) | FR823390 | Neospora caninum Liverpool | 37 | OG6_102772 | 0 | 1984 | 5955 | 212643 | 4.91 | 0 | | | | | | | | | | | | | | | | 3.1.13.4 (Poly(A)-specific ribonuclease) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_032340ORPAB-dependent poly(A)-specific ribonuclease subunit PAN2, relatedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_032340 OR PAB-dependent poly(A)-specific ribonuclease subunit PAN2, related AND Neospora caninum Liverpool |
|
NCLIV_033100 | NCLIV_033100-t26_1 | 12 | 12 | 1 | | | reverse | protein coding | No | 1794 | NCLIV_033100 | putative prolidase | putative prolidase | 13442775 | F0VIG1 | VIII | FR823390:2,430,830..2,438,921(-) | FR823390:2430830..2438921(-) | FR823390 | Neospora caninum Liverpool | 28 | OG6_102295 | 0 | 597 | 1794 | 66031 | 6.51 | 0 | | | | | GO:0004177;GO:0030145 | aminopeptidase activity;manganese ion binding | | | | | | | | | | 3.4.11.9 (Xaa-Pro aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_033100ORputative prolidaseANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_033100 OR putative prolidase AND Neospora caninum Liverpool |
|
NCLIV_034640 | NCLIV_034640-t26_1 | 15 | 15 | 1 | | | reverse | protein coding | No | 3252 | NCLIV_034640 | putative peptidase family M3 domain containing protein | putative peptidase family M3 domain containing protein | 13443093 | F0VIX1 | VIII | FR823390:3,621,251..3,631,115(-) | FR823390:3621251..3631115(-) | FR823390 | Neospora caninum Liverpool | 44 | OG6_102110 | 0 | 1083 | 3252 | 116623 | 7.27 | 0 | | | | | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.24.59 (Mitochondrial intermediate peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_034640ORputative peptidase family M3 domain containing proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_034640 OR putative peptidase family M3 domain containing protein AND Neospora caninum Liverpool |
|
NCLIV_034810 | NCLIV_034810-t26_1 | 4 | 4 | 1 | | | reverse | protein coding | No | 309 | NCLIV_034810 | putative eukaryotic aspartyl protease | putative eukaryotic aspartyl protease | 13443190 | F0VIY9 | VIII | FR823390:3,761,823..3,762,385(-) | FR823390:3761823..3762385(-) | FR823390 | Neospora caninum Liverpool | 18 | OG6_139465 | 0 | 102 | 309 | 11425 | 3.91 | 0 | | | | | | | | | | | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_034810ORputative eukaryotic aspartyl proteaseANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_034810 OR putative eukaryotic aspartyl protease AND Neospora caninum Liverpool |
|
NCLIV_034880 | NCLIV_034880-t26_1 | 7 | 7 | 1 | | | reverse | protein coding | No | 2322 | NCLIV_034880 | putative 1-O-acylceramide synthase | putative 1-O-acylceramide synthase | 13443197 | F0VIZ6 | VIII | FR823390:3,815,434..3,820,249(-) | FR823390:3815434..3820249(-) | FR823390 | Neospora caninum Liverpool | 29 | OG6_101376 | 0 | 773 | 2322 | 84490 | 5.04 | 1 | HMM: MEFLIGARQGRAREKVSRFSCILCFASTLVFLVPLGCYAF, NN: MEFLIGARQGRAREKVSRFSCILCFASTLVFLVPLGCYAF | NN Sum: 4, NN D: .53, HMM Prob: .58 | | | GO:0008374 | O-acyltransferase activity | GO:0006629 | lipid metabolic process | | | | | | | 2.3.1.43 (Phosphatidylcholine--sterol O-acyltransferase) | 2.3.1.43 (Phosphatidylcholine--sterol O-acyltransferase) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_034880ORputative 1-O-acylceramide synthaseANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_034880 OR putative 1-O-acylceramide synthase AND Neospora caninum Liverpool |
|
NCLIV_035050 | NCLIV_035050-t26_1 | 7 | 7 | 1 | | | reverse | protein coding | No | 1149 | NCLIV_035050 | putative heat shock protein hslv | putative heat shock protein hslv | 13443213 | F0VJ12 | VIII | FR823390:3,955,226..3,958,595(-) | FR823390:3955226..3958595(-) | FR823390 | Neospora caninum Liverpool | 29 | OG6_107204 | 0 | 382 | 1149 | 40986 | 9.52 | 0 | HMM: MPRHAAARHVSLQGLLSFCPLASGR, NN: MPRHAAARHVSLQGLLSFCPLASGR | NN Sum: 2, NN D: .42, HMM Prob: .99 | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | | 3.4.25.2 (HslU--HslV peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_035050ORputative heat shock protein hslvANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_035050 OR putative heat shock protein hslv AND Neospora caninum Liverpool |
|
NCLIV_035270 | NCLIV_035270-t26_1 | 12 | 12 | 1 | | | reverse | protein coding | No | 2943 | NCLIV_035270 | putative zinc carboxypeptidase | putative zinc carboxypeptidase | 13443234 | F0VJ34 | VIII | FR823390:4,150,159..4,157,285(-) | FR823390:4150159..4157285(-) | FR823390 | Neospora caninum Liverpool | 27 | OG6_100142 | 0 | 980 | 2943 | 106547 | 8.19 | 1 | HMM: MSPRTTVPSRLLIRLCLPHILRLLLLRFLLNLPLRHRLHVPALFLARLVRPR, NN: MSPRTTVPSRLLIRLCLPHILRLLLLRFLLNL | NN Sum: 2, NN D: .5, HMM Prob: .73 | | | GO:0004181;GO:0008270 | metallocarboxypeptidase activity;zinc ion binding | GO:0006508 | proteolysis | | | | | | | | 3.4.17.- (Metallocarboxypeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_035270ORputative zinc carboxypeptidaseANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_035270 OR putative zinc carboxypeptidase AND Neospora caninum Liverpool |
|
NCLIV_035460 | NCLIV_035460-t26_1 | 12 | 12 | 1 | | | forward | protein coding | No | 2529 | NCLIV_035460 | Alpha/beta hydrolase, related | Alpha/beta hydrolase, related | 13443254 | F0VJ54 | VIII | FR823390:4,292,006..4,300,200(+) | FR823390:4292006..4300200(+) | FR823390 | Neospora caninum Liverpool | 26 | OG6_105308 | 0 | 842 | 2529 | 91669 | 6.68 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_035460ORAlpha/beta hydrolase, relatedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_035460 OR Alpha/beta hydrolase, related AND Neospora caninum Liverpool |
|
NCLIV_035740 | NCLIV_035740-t26_1 | 4 | 4 | 1 | | | reverse | protein coding | No | 909 | NCLIV_035740 | putative cysteine protease domain containing protein | putative cysteine protease domain containing protein | 13443361 | F0VJ82 | VIII | FR823390:4,535,580..4,537,073(-) | FR823390:4535580..4537073(-) | FR823390 | Neospora caninum Liverpool | 24 | OG6_154459 | 0 | 302 | 909 | 32694 | 6.42 | 0 | HMM: MRSLVAILTFLFVQRCAAL, NN: MRSLVAILTFLFVQRCAAL | NN Sum: 4, NN D: .89, HMM Prob: 1 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_035740ORputative cysteine protease domain containing proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_035740 OR putative cysteine protease domain containing protein AND Neospora caninum Liverpool |
|
NCLIV_036660 | NCLIV_036660-t26_1 | 13 | 13 | 1 | | | forward | protein coding | No | 8826 | NCLIV_036660 | conserved hypothetical protein | conserved hypothetical protein | 13443531 | F0VJH3 | VIII | FR823390:5,283,507..5,297,278(+) | FR823390:5283507..5297278(+) | FR823390 | Neospora caninum Liverpool | 35 | OG6_155864 | 0 | 2941 | 8826 | 319828 | 6.25 | 2 | HMM: MQHFSRSRSSPRWIPKTARLVLFWHYLFLLSLLFSVCSAA, NN: MQHFSRSRSSPRWIPKTARLVLFWHYLFLLSLLFSVCSAA | NN Sum: 4, NN D: .76, HMM Prob: .96 | | | GO:0005509 | calcium ion binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_036660ORconserved hypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_036660 OR conserved hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_036700 | NCLIV_036700-t26_1 | 11 | 11 | 1 | | | forward | protein coding | No | 4227 | NCLIV_036700 | putative M16 family peptidase | putative M16 family peptidase | 13443535 | F0VJH7 | VIII | FR823390:5,327,850..5,335,316(+) | FR823390:5327850..5335316(+) | FR823390 | Neospora caninum Liverpool | 87 | OG6_100422 | 1 | 1408 | 4227 | 157131 | 9.22 | 0 | HMM: MKQGTIRSRIGLTGVFLLLAAWSVAS, NN: MKQGTIRSRIGLTGVFLLLAAWSVAS | NN Sum: 4, NN D: .76, HMM Prob: .99 | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.56 (Insulysin) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_036700ORputative M16 family peptidaseANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_036700 OR putative M16 family peptidase AND Neospora caninum Liverpool |
|
NCLIV_036720 | NCLIV_036720-t26_1 | 6 | 6 | 1 | | | reverse | protein coding | No | 945 | NCLIV_036720 | CBR-CSN-5 protein, related | CBR-CSN-5 protein, related | 13443538 | F0VJH9 | VIII | FR823390:5,344,233..5,347,480(-) | FR823390:5344233..5347480(-) | FR823390 | Neospora caninum Liverpool | 26 | OG6_101835 | 0 | 314 | 945 | 35222 | 6.52 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_036720ORCBR-CSN-5 protein, relatedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_036720 OR CBR-CSN-5 protein, related AND Neospora caninum Liverpool |
|
NCLIV_037150 | NCLIV_037150-t26_1 | 10 | 10 | 1 | | | reverse | protein coding | No | 1035 | NCLIV_037150 | hypothetical protein | hypothetical protein | 13443659 | F0VJM2 | VIII | FR823390:5,718,415..5,722,890(-) | FR823390:5718415..5722890(-) | FR823390 | Neospora caninum Liverpool | 28 | OG6_102054 | 0 | 344 | 1035 | 38522 | 7.15 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 3.1.3.16 (Protein-serine/threonine phosphatase) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_037150ORhypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_037150 OR hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_037220 | NCLIV_037220-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1158 | NCLIV_037220 | hypothetical protein | hypothetical protein | 13443667 | F0VJM9 | VIII | FR823390:5,777,148..5,778,305(+) | FR823390:5777148..5778305(+) | FR823390 | Neospora caninum Liverpool | 0 | OG6_103852 | 0 | 385 | 1158 | 42869 | 5.15 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_037220ORhypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_037220 OR hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_037440 | NCLIV_037440-t26_1 | 3 | 3 | 1 | | | forward | protein coding | No | 648 | NCLIV_037440 | Mitochondrial inner membrane signal peptidase | Mitochondrial inner membrane signal peptidase | 13443685 | F0VJQ1 | VIII | FR823390:5,944,370..5,946,071(+) | FR823390:5944370..5946071(+) | FR823390 | Neospora caninum Liverpool | 19 | OG6_100609 | 0 | 215 | 648 | 23704 | 9.21 | 0 | | | | | | | | | | | | | | | | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_037440ORMitochondrial inner membrane signal peptidaseANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_037440 OR Mitochondrial inner membrane signal peptidase AND Neospora caninum Liverpool |
|
NCLIV_037700 | NCLIV_037700-t26_1 | 3 | 3 | 1 | | | forward | protein coding | No | 2763 | NCLIV_037700 | hypothetical protein | hypothetical protein | 13443714 | F0VJS7 | VIII | FR823390:6,109,203..6,112,777(+) | FR823390:6109203..6112777(+) | FR823390 | Neospora caninum Liverpool | 120 | OG6_100223 | 3 | 920 | 2763 | 101761 | 5.62 | 0 | | | | | GO:0005524 | ATP binding | GO:0019538 | protein metabolic process | | | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_037700ORhypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_037700 OR hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_037760 | NCLIV_037760-t26_1 | 9 | 9 | 1 | | | reverse | protein coding | No | 1941 | NCLIV_037760 | Rhomboid-6, isoform A, related | Rhomboid-6, isoform A, related | 13443720 | F0VJT3 | VIII | FR823390:6,141,082..6,145,746(-) | FR823390:6141082..6145746(-) | FR823390 | Neospora caninum Liverpool | 29 | OG6_126349 | 0 | 646 | 1941 | 70182 | 9.23 | 6 | HMM: MAGVQVWTSATVMASSTLSPVRGG, NN: MAGVQVWTSATVMASSTLSPVRGG | NN Sum: 2, NN D: .41, HMM Prob: .9 | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | 3.4.21.- (Serine endopeptidases.) | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_037760ORRhomboid-6, isoform A, relatedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_037760 OR Rhomboid-6, isoform A, related AND Neospora caninum Liverpool |
|
NCLIV_037920 | NCLIV_037920-t26_1 | 10 | 10 | 1 | | | reverse | protein coding | No | 4023 | NCLIV_037920 | Pyrrolidone-carboxylate peptidase | Pyrrolidone-carboxylate peptidase | 13443735 | F0VJU8 | VIII | FR823390:6,310,385..6,320,826(-) | FR823390:6310385..6320826(-) | FR823390 | Neospora caninum Liverpool | 26 | OG6_101530 | 0 | 1340 | 4023 | 145394 | 6.50 | 0 | | | | | | | | | | | | | | | 3.4.19.3 (Pyroglutamyl-peptidase I) | 3.4.19.3 (Pyroglutamyl-peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_037920ORPyrrolidone-carboxylate peptidaseANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_037920 OR Pyrrolidone-carboxylate peptidase AND Neospora caninum Liverpool |
|
NCLIV_038140 | NCLIV_038140-t26_1 | 5 | 5 | 1 | | | forward | protein coding | No | 759 | NCLIV_038140 | hypothetical protein | hypothetical protein | 13441942 | F0VJX1 | VIII | FR823390:6,504,534..6,507,386(+) | FR823390:6504534..6507386(+) | FR823390 | Neospora caninum Liverpool | 52 | OG6_100562 | 1 | 252 | 759 | 28529 | 8.34 | 5 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | | 3.4.21.- (Serine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_038140ORhypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_038140 OR hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_038200 | NCLIV_038200-t26_1 | 7 | 7 | 1 | | | forward | protein coding | No | 2076 | NCLIV_038200 | putative subtilase family serine protease | putative subtilase family serine protease | 13441948 | F0VJX7 | VIII | FR823390:6,545,310..6,550,311(+) | FR823390:6545310..6550311(+) | FR823390 | Neospora caninum Liverpool | 25 | OG6_156705 | 0 | 691 | 2076 | 75033 | 6.16 | 1 | HMM: MTCVGIRWKKGFQRWAAYGFLWISVVLVLTVATRAG, NN: MTCVGIRWKKGFQRWAAYGFLWISVVLVLTVATRAG | NN Sum: 4, NN D: .8, HMM Prob: .92 | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.21.62 (Subtilisin) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_038200ORputative subtilase family serine proteaseANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_038200 OR putative subtilase family serine protease AND Neospora caninum Liverpool |
|
NCLIV_038400 | NCLIV_038400-t26_1 | 8 | 8 | 1 | | | reverse | protein coding | No | 1215 | NCLIV_038400 | methionine aminopeptidase | methionine aminopeptidase | 13441799 | F0VCE1 | IX | FR823385:61,448..65,859(-) | FR823385:61448..65859(-) | FR823385 | Neospora caninum Liverpool | 28 | OG6_101895 | 0 | 404 | 1215 | 43775 | 6.32 | 0 | | | | | | | | | | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_038400ORmethionine aminopeptidaseANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_038400 OR methionine aminopeptidase AND Neospora caninum Liverpool |
|
NCLIV_039000 | NCLIV_039000-t26_1 | 11 | 11 | 1 | | | forward | protein coding | No | 1332 | NCLIV_039000 | probable 26S protease regulatory subunit 6B | probable 26S protease regulatory subunit 6B | 13441860 | F0VAW8 | IX | FR823385:514,919..519,204(+) | FR823385:514919..519204(+) | FR823385 | Neospora caninum Liverpool | 32 | OG6_101477 | 0 | 443 | 1332 | 49395 | 6.35 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | | | | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_039000ORprobable 26S protease regulatory subunit 6BANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_039000 OR probable 26S protease regulatory subunit 6B AND Neospora caninum Liverpool |
|
NCLIV_039040 | NCLIV_039040-t26_1 | 4 | 4 | 1 | | | forward | protein coding | No | 927 | NCLIV_039040 | hypothetical protein | hypothetical protein | 13441863 | F0VAX1 | IX | FR823385:526,630..529,231(+) | FR823385:526630..529231(+) | FR823385 | Neospora caninum Liverpool | 18 | OG6_106560 | 0 | 308 | 927 | 33948 | 7.17 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_039040ORhypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_039040 OR hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_039720 | NCLIV_039720-t26_1 | 7 | 7 | 1 | | | forward | protein coding | No | 8004 | NCLIV_039720 | putative zinc carboxypeptidase | putative zinc carboxypeptidase | 13439883 | F0VBB3 | IX | FR823385:1,020,780..1,031,567(+) | FR823385:1020780..1031567(+) | FR823385 | Neospora caninum Liverpool | 18 | OG6_132969 | 0 | 2667 | 8004 | 279153 | 9.90 | 0 | | | | | GO:0004181;GO:0008270 | metallocarboxypeptidase activity;zinc ion binding | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_039720ORputative zinc carboxypeptidaseANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_039720 OR putative zinc carboxypeptidase AND Neospora caninum Liverpool |
|
NCLIV_040050 | NCLIV_040050-t26_1 | 12 | 12 | 1 | | | reverse | protein coding | No | 4224 | NCLIV_040050 | putative WD domain, G-beta repeat-containing protein | putative WD domain, G-beta repeat-containing protein | 13439916 | F0VBE6 | IX | FR823385:1,244,006..1,253,214(-) | FR823385:1244006..1253214(-) | FR823385 | Neospora caninum Liverpool | 26 | OG6_102663 | 0 | 1407 | 4224 | 159703 | 6.04 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_040050ORputative WD domain, G-beta repeat-containing proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_040050 OR putative WD domain, G-beta repeat-containing protein AND Neospora caninum Liverpool |
|
NCLIV_040060 | NCLIV_040060-t26_1 | 9 | 9 | 1 | | | forward | protein coding | No | 9030 | NCLIV_040060 | gh12570, related | gh12570, related | 13439917 | F0VBE7 | IX | FR823385:1,260,431..1,272,212(+) | FR823385:1260431..1272212(+) | FR823385 | Neospora caninum Liverpool | 40 | OG6_101235 | 1 | 3009 | 9030 | 323094 | 4.87 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.68 (Ulp1 peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_040060ORgh12570, relatedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_040060 OR gh12570, related AND Neospora caninum Liverpool |
|
NCLIV_040980 | NCLIV_040980-t26_1 | 7 | 7 | 1 | | | reverse | protein coding | No | 1611 | NCLIV_040980 | conserved hypothetical protein | conserved hypothetical protein | 13440009 | F0VBN9 | IX | FR823385:2,095,724..2,100,222(-) | FR823385:2095724..2100222(-) | FR823385 | Neospora caninum Liverpool | 17 | OG6_179549 | 0 | 536 | 1611 | 58280 | 8.06 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_040980ORconserved hypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_040980 OR conserved hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_041690 | NCLIV_041690-t26_1 | 15 | 15 | 1 | | | forward | protein coding | No | 6978 | NCLIV_041690 | ubiquitin carboxyl-terminal hydrolase, related | ubiquitin carboxyl-terminal hydrolase, related | 13440080 | F0VBW0 | IX | FR823385:2,681,114..2,693,668(+) | FR823385:2681114..2693668(+) | FR823385 | Neospora caninum Liverpool | 33 | OG6_101317 | 0 | 2325 | 6978 | 251881 | 6.02 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | 3.1.2.15 (Deleted entry) | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_041690ORubiquitin carboxyl-terminal hydrolase, relatedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_041690 OR ubiquitin carboxyl-terminal hydrolase, related AND Neospora caninum Liverpool |
|
NCLIV_041870 | NCLIV_041870-t26_1 | 9 | 9 | 1 | | | reverse | protein coding | No | 2211 | NCLIV_041870 | hypothetical protein | hypothetical protein | 13440098 | F0VBX8 | IX | FR823385:2,829,425..2,834,925(-) | FR823385:2829425..2834925(-) | FR823385 | Neospora caninum Liverpool | 50 | OG6_103622 | 1 | 736 | 2211 | 79541 | 5.90 | 1 | HMM: MEGMWSLRRRCAALLLFIGPLGFLGWTGVRAD, NN: MEGMWSLRRRCAALLLFIGPLGFLGWTGVRAD | NN Sum: 4, NN D: .78, HMM Prob: .98 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.14.1 (Dipeptidyl-peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_041870ORhypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_041870 OR hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_042030 | NCLIV_042030-t26_1 | 14 | 14 | 1 | | | reverse | protein coding | No | 1584 | NCLIV_042030 | putative ATP-dependent heat shock protein | putative ATP-dependent heat shock protein | 13440114 | F0VBZ4 | IX | FR823385:2,921,226..2,928,325(-) | FR823385:2921226..2928325(-) | FR823385 | Neospora caninum Liverpool | 28 | OG6_106348 | 0 | 527 | 1584 | 58170 | 7.87 | 0 | HMM: MERGRSRLLSAYPFSCSVPTPSFAS, NN: MERGRSRLLSAYPFSCSVPTPSFAS | NN Sum: 1, NN D: .18, HMM Prob: .91 | GO:0009376;GO:0005737 | HslUV protease complex;cytoplasm | GO:0005524;GO:0016887;GO:0070011 | ATP binding;ATPase activity;peptidase activity, acting on L-amino acid peptides | | | | | | | | | | 2.7.1.71 (Shikimate kinase) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_042030ORputative ATP-dependent heat shock proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_042030 OR putative ATP-dependent heat shock protein AND Neospora caninum Liverpool |
|
NCLIV_042110 | NCLIV_042110-t26_1 | 16 | 16 | 1 | | | reverse | protein coding | No | 4140 | NCLIV_042110 | conserved hypothetical protein | conserved hypothetical protein | 13440122 | F0VC02 | IX | FR823385:2,968,868..2,978,447(-) | FR823385:2968868..2978447(-) | FR823385 | Neospora caninum Liverpool | 37 | OG6_113142 | 0 | 1379 | 4140 | 152849 | 7.54 | 2 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_042110ORconserved hypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_042110 OR conserved hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_042370 | NCLIV_042370-t26_1 | 7 | 7 | 1 | | | reverse | protein coding | No | 741 | NCLIV_042370 | hypothetical protein | hypothetical protein | 13440155 | F0VC36 | IX | FR823385:3,231,631..3,234,618(-) | FR823385:3231631..3234618(-) | FR823385 | Neospora caninum Liverpool | 27 | OG6_101631 | 0 | 246 | 741 | 26965 | 6.51 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_042370ORhypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_042370 OR hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_042660 | NCLIV_042660-t26_1 | 9 | 9 | 1 | | | forward | protein coding | No | 1695 | NCLIV_042660 | probable cytosol aminopeptidase, related | probable cytosol aminopeptidase, related | 13440184 | F0VC65 | IX | FR823385:3,470,582..3,474,972(+) | FR823385:3470582..3474972(+) | FR823385 | Neospora caninum Liverpool | 27 | OG6_100682 | 0 | 564 | 1695 | 59785 | 6.29 | 0 | | | GO:0005622 | intracellular | GO:0004177 | aminopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.11.1 (Leucyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_042660ORprobable cytosol aminopeptidase, relatedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_042660 OR probable cytosol aminopeptidase, related AND Neospora caninum Liverpool |
|
NCLIV_042710 | NCLIV_042710-t26_1 | 9 | 9 | 1 | | | forward | protein coding | No | 2859 | NCLIV_042710 | peptidase S1, chymotrypsin:PDZ/DHR/GLGF domain (Precursor), related | peptidase S1, chymotrypsin:PDZ/DHR/GLGF domain (Precursor), related | 13440189 | F0VC70 | IX | FR823385:3,520,909..3,527,775(+) | FR823385:3520909..3527775(+) | FR823385 | Neospora caninum Liverpool | 111 | OG6_105727 | 2 | 952 | 2859 | 102959 | 8.79 | 1 | HMM: MIESCHLTAFPDFSPWRFLLALTFASRSSCC, NN: MIESCHLTAFPDFSPWRFLLALTFASRSSCCL | NN Sum: 0, NN D: .37, HMM Prob: .86 | | | | | | | | | | | | | | 3.4.21.108 (HtrA2 peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_042710ORpeptidase S1, chymotrypsin:PDZ/DHR/GLGF domain (Precursor), relatedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_042710 OR peptidase S1, chymotrypsin:PDZ/DHR/GLGF domain (Precursor), related AND Neospora caninum Liverpool |
|
NCLIV_043950 | NCLIV_043950-t26_1 | 8 | 8 | 1 | | | reverse | protein coding | No | 1452 | NCLIV_043950 | hypothetical protein | hypothetical protein | 13440315 | F0VAS2 | IX | FR823385:4,554,950..4,560,045(-) | FR823385:4554950..4560045(-) | FR823385 | Neospora caninum Liverpool | 33 | OG6_100815 | 0 | 483 | 1452 | 52764 | 5.81 | 0 | | | | | GO:0004177;GO:0008235 | aminopeptidase activity;metalloexopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_043950ORhypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_043950 OR hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_044190 | NCLIV_044190-t26_1 | 4 | 4 | 1 | | | forward | protein coding | No | 10398 | NCLIV_044190 | conserved hypothetical protein | conserved hypothetical protein | 13440340 | F0VAX9 | IX | FR823385:4,762,921..4,774,645(+) | FR823385:4762921..4774645(+) | FR823385 | Neospora caninum Liverpool | 21 | OG6_100501 | 0 | 3465 | 10398 | 359460 | 5.41 | 0 | | | | | | | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_044190ORconserved hypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_044190 OR conserved hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_044210 | NCLIV_044210-t26_1 | 11 | 11 | 1 | | | reverse | protein coding | No | 2094 | NCLIV_044210 | hypothetical protein | hypothetical protein | 13440342 | F0VAY1 | IX | FR823385:4,790,945..4,798,021(-) | FR823385:4790945..4798021(-) | FR823385 | Neospora caninum Liverpool | 36 | OG6_101407 | 0 | 697 | 2094 | 76124 | 7.39 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_044210ORhypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_044210 OR hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_044230 | NCLIV_044230-t26_1 | 13 | 13 | 1 | | | reverse | protein coding | No | 6696 | NCLIV_044230 | putative peptidase M16 domain containing protein | putative peptidase M16 domain containing protein | 13440344 | F0VAY3 | IX | FR823385:4,812,830..4,824,529(-) | FR823385:4812830..4824529(-) | FR823385 | Neospora caninum Liverpool | 38 | OG6_174421 | 0 | 2231 | 6696 | 236656 | 4.99 | 0 | HMM: MKAPSRSSLPLLFLLSFLPFTSLFSEAISRASAS, NN: MKAPSRSSLPLLFLLSFLPFTSLF | NN Sum: 4, NN D: .69, HMM Prob: 1 | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.56 (Insulysin) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_044230ORputative peptidase M16 domain containing proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_044230 OR putative peptidase M16 domain containing protein AND Neospora caninum Liverpool |
|
NCLIV_044300 | NCLIV_044300-t26_1 | 2 | 2 | 1 | | | forward | protein coding | No | 1773 | NCLIV_044300 | conserved hypothetical protein | conserved hypothetical protein | 13440353 | F0VAZ2 | IX | FR823385:4,946,239..4,948,508(+) | FR823385:4946239..4948508(+) | FR823385 | Neospora caninum Liverpool | 23 | OG6_158735 | 0 | 590 | 1773 | 63020 | 6.06 | 7 | | | GO:0016020 | membrane | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_044300ORconserved hypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_044300 OR conserved hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_044460 | NCLIV_044460-t26_1 | 7 | 7 | 1 | | | forward | protein coding | No | 1653 | NCLIV_044460 | putative DNA-damage inducible protein | putative DNA-damage inducible protein | 13440369 | F0VB08 | IX | FR823385:5,093,241..5,097,571(+) | FR823385:5093241..5097571(+) | FR823385 | Neospora caninum Liverpool | 33 | OG6_101685 | 0 | 550 | 1653 | 58652 | 4.89 | 0 | | | | | GO:0004190;GO:0005515 | aspartic-type endopeptidase activity;protein binding | GO:0006508 | proteolysis | | | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_044460ORputative DNA-damage inducible proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_044460 OR putative DNA-damage inducible protein AND Neospora caninum Liverpool |
|
NCLIV_044560 | NCLIV_044560-t26_1 | 4 | 4 | 1 | | | forward | protein coding | No | 1779 | NCLIV_044560 | lysophospholipase, related | lysophospholipase, related | 13440379 | F0VB57 | IX | FR823385:5,188,444..5,191,039(+) | FR823385:5188444..5191039(+) | FR823385 | Neospora caninum Liverpool | 62 | OG6_100231 | 1 | 592 | 1779 | 63967 | 5.17 | 0 | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_044560ORlysophospholipase, relatedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_044560 OR lysophospholipase, related AND Neospora caninum Liverpool |
|
NCLIV_045220 | NCLIV_045220-t26_1 | 10 | 10 | 1 | | | reverse | protein coding | No | 1197 | NCLIV_045220 | hypothetical protein | hypothetical protein | 13442069 | F0VLG1 | X | FR823391:362,666..369,391(-) | FR823391:362666..369391(-) | FR823391 | Neospora caninum Liverpool | 39 | OG6_101751 | 0 | 398 | 1197 | 44494 | 6.92 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | | | | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_045220ORhypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_045220 OR hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_045240 | NCLIV_045240-t26_1 | 3 | 3 | 1 | | | forward | protein coding | No | 1041 | NCLIV_045240 | putative eukaryotic translation initiation factor 3 subunit 5 | putative eukaryotic translation initiation factor 3 subunit 5 | 13442071 | F0VLG3 | X | FR823391:380,874..383,091(+) | FR823391:380874..383091(+) | FR823391 | Neospora caninum Liverpool | 29 | OG6_103242 | 0 | 346 | 1041 | 38092 | 6.51 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_045240ORputative eukaryotic translation initiation factor 3 subunit 5ANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_045240 OR putative eukaryotic translation initiation factor 3 subunit 5 AND Neospora caninum Liverpool |
|
NCLIV_045460 | NCLIV_045460-t26_1 | 13 | 13 | 1 | | | forward | protein coding | No | 3936 | NCLIV_045460 | Mitochondrial presequence protease (Precursor), related | Mitochondrial presequence protease (Precursor), related | 13441994 | F0VLI5 | X | FR823391:582,202..590,931(+) | FR823391:582202..590931(+) | FR823391 | Neospora caninum Liverpool | 49 | OG6_101809 | 0 | 1311 | 3936 | 142731 | 5.98 | 0 | HMM: MATPLGLLGSASSAPPSSPGSSFLRCREAPAALARPQSAPDSWACSRRPVGVASLLSSPFRAAAA, NN: MATPLGLLGSASSA | NN Sum: 0, NN D: .13, HMM Prob: .84 | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | GO:0006508 | proteolysis | | | | | | | 3.4.24.- (Metalloendopeptidases.) | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_045460ORMitochondrial presequence protease (Precursor), relatedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_045460 OR Mitochondrial presequence protease (Precursor), related AND Neospora caninum Liverpool |
|
NCLIV_045790 | NCLIV_045790-t26_1 | 10 | 10 | 1 | | | reverse | protein coding | No | 3786 | NCLIV_045790 | putative X-Pro dipeptidyl-peptidase domain-containing protein | putative X-Pro dipeptidyl-peptidase domain-containing protein | 13442028 | F0VLL9 | X | FR823391:839,111..847,432(-) | FR823391:839111..847432(-) | FR823391 | Neospora caninum Liverpool | 29 | OG6_124529 | 0 | 1261 | 3786 | 140672 | 9.09 | 3 | HMM: MLTKQLLVFSYTFVAFHTLAL, NN: MLTKQLLVFSYTFVAFHTLAL | NN Sum: 3, NN D: .63, HMM Prob: .97 | | | GO:0008239;GO:0016787 | dipeptidyl-peptidase activity;hydrolase activity | | | | | | | | | | 3.1.1.- (Carboxylic ester hydrolases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_045790ORputative X-Pro dipeptidyl-peptidase domain-containing proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_045790 OR putative X-Pro dipeptidyl-peptidase domain-containing protein AND Neospora caninum Liverpool |
|
NCLIV_046080 | NCLIV_046080-t26_1 | 3 | 3 | 1 | | | reverse | protein coding | No | 3177 | NCLIV_046080 | hypothetical protein | hypothetical protein | 13442107 | F0VLP8 | X | FR823391:1,060,817..1,064,769(-) | FR823391:1060817..1064769(-) | FR823391 | Neospora caninum Liverpool | 2 | OG6_101457 | 0 | 1058 | 3177 | 115006 | 7.53 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_046080ORhypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_046080 OR hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_046090 | NCLIV_046090-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 3618 | NCLIV_046090 | conserved hypothetical protein | conserved hypothetical protein | 13442108 | F0VLP9 | X | FR823391:1,068,653..1,072,270(+) | FR823391:1068653..1072270(+) | FR823391 | Neospora caninum Liverpool | 19 | OG6_223067 | 0 | 1205 | 3618 | 129834 | 9.09 | 1 | HMM: MTTRRSAGPLSLFVRRSRSLSRPSLCLFIALFSFCYAA, NN: MTTRRSAGPLSLFVRRSRSLSRPSLCLFIALFSFCYAA | NN Sum: 4, NN D: .55, HMM Prob: .74 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_046090ORconserved hypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_046090 OR conserved hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_046540 | NCLIV_046540-t26_1 | 11 | 11 | 1 | | | forward | protein coding | No | 1893 | NCLIV_046540 | putative oligoendopeptidase F | putative oligoendopeptidase F | 13442153 | F0VLU4 | X | FR823391:1,470,507..1,476,352(+) | FR823391:1470507..1476352(+) | FR823391 | Neospora caninum Liverpool | 44 | OG6_110341 | 1 | 630 | 1893 | 70782 | 5.24 | 0 | HMM: MLFLLADFGFSHVHAS, NN: MLFLLADFGFSHVHAS | NN Sum: 0, NN D: .28, HMM Prob: .69 | | | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_046540ORputative oligoendopeptidase FANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_046540 OR putative oligoendopeptidase F AND Neospora caninum Liverpool |
|
NCLIV_046570 | NCLIV_046570-t26_1 | 2 | 2 | 1 | | | forward | protein coding | No | 2685 | NCLIV_046570 | PST-A protein, related | PST-A protein, related | 13442156 | F0VLU7 | X | FR823391:1,486,859..1,490,558(+) | FR823391:1486859..1490558(+) | FR823391 | Neospora caninum Liverpool | 26 | OG6_490279 | 0 | 894 | 2685 | 95509 | 6.87 | 0 | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_046570ORPST-A protein, relatedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_046570 OR PST-A protein, related AND Neospora caninum Liverpool |
|
NCLIV_046980 | NCLIV_046980-t26_1 | 11 | 11 | 1 | | | forward | protein coding | No | 4581 | NCLIV_046980 | Peptidase, M20/M25/M40 family protein, related | Peptidase, M20/M25/M40 family protein, related | 13442197 | F0VLY8 | X | FR823391:1,812,564..1,822,328(+) | FR823391:1812564..1822328(+) | FR823391 | Neospora caninum Liverpool | 26 | OG6_101747 | 0 | 1526 | 4581 | 164034 | 8.29 | 9 | | | | | | | | | | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_046980ORPeptidase, M20/M25/M40 family protein, relatedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_046980 OR Peptidase, M20/M25/M40 family protein, related AND Neospora caninum Liverpool |
|
NCLIV_047130 | NCLIV_047130-t26_1 | 3 | 3 | 1 | | | forward | protein coding | No | 726 | NCLIV_047130 | hypothetical protein | hypothetical protein | 13442212 | F0VM03 | X | FR823391:1,959,376..1,961,032(+) | FR823391:1959376..1961032(+) | FR823391 | Neospora caninum Liverpool | 27 | OG6_102356 | 0 | 241 | 726 | 26104 | 5.38 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_047130ORhypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_047130 OR hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_048090 | NCLIV_048090-t26_1 | 9 | 9 | 1 | | | forward | protein coding | No | 960 | NCLIV_048090 | putative sterol-regulatory element binding protein site 2 protease | putative sterol-regulatory element binding protein site 2 protease | 13442310 | F0VMA1 | X | FR823391:2,760,938..2,765,873(+) | FR823391:2760938..2765873(+) | FR823391 | Neospora caninum Liverpool | 24 | OG6_107106 | 0 | 319 | 960 | 35080 | 7.55 | 6 | | | | | | | | | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_048090ORputative sterol-regulatory element binding protein site 2 proteaseANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_048090 OR putative sterol-regulatory element binding protein site 2 protease AND Neospora caninum Liverpool |
|
NCLIV_048230 | NCLIV_048230-t26_1 | 13 | 13 | 1 | | | forward | protein coding | No | 2721 | NCLIV_048230 | Aminopeptidase N, related | Aminopeptidase N, related | 13442324 | F0VMB5 | X | FR823391:2,883,471..2,892,909(+) | FR823391:2883471..2892909(+) | FR823391 | Neospora caninum Liverpool | 110 | OG6_106799 | 2 | 906 | 2721 | 101672 | 5.89 | 0 | | | | | GO:0008237;GO:0008270 | metallopeptidase activity;zinc ion binding | | | | | | | | | 3.4.11.2 (Membrane alanyl aminopeptidase) | 3.4.11.2 (Membrane alanyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_048230ORAminopeptidase N, relatedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_048230 OR Aminopeptidase N, related AND Neospora caninum Liverpool |
|
NCLIV_048240 | NCLIV_048240-t26_1 | 11 | 11 | 1 | | | reverse | protein coding | No | 2820 | NCLIV_048240 | hypothetical protein | hypothetical protein | 13442325 | F0VMB6 | X | FR823391:2,894,470..2,901,566(-) | FR823391:2894470..2901566(-) | FR823391 | Neospora caninum Liverpool | 110 | OG6_106799 | 2 | 939 | 2820 | 105613 | 5.56 | 0 | | | | | GO:0008237;GO:0008270 | metallopeptidase activity;zinc ion binding | | | | | | | | | | 3.4.11.2 (Membrane alanyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_048240ORhypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_048240 OR hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_048430 | NCLIV_048430-t26_1 | 6 | 6 | 1 | | | forward | protein coding | No | 1476 | NCLIV_048430 | hypothetical protein | hypothetical protein | 13442345 | F0VMD6 | X | FR823391:3,125,600..3,129,591(+) | FR823391:3125600..3129591(+) | FR823391 | Neospora caninum Liverpool | 31 | OG6_102025 | 0 | 491 | 1476 | 52556 | 5.97 | 0 | HMM: MASGASRRLLRLSAHLSDGVLTQ, NN: MASGASRRLLRLSAHLSDGVLTQ | NN Sum: 0, NN D: .29, HMM Prob: .66 | | | GO:0003860 | 3-hydroxyisobutyryl-CoA hydrolase activity | | | | | | | | | 3.1.2.4 (3-hydroxyisobutyryl-CoA hydrolase) | 3.1.2.4 (3-hydroxyisobutyryl-CoA hydrolase) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_048430ORhypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_048430 OR hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_048550 | NCLIV_048550-t26_1 | 7 | 7 | 1 | | | reverse | protein coding | No | 1209 | NCLIV_048550 | putative 26S proteasome non-ATPase regulatory subunit 4 | putative 26S proteasome non-ATPase regulatory subunit 4 | 13442357 | F0VK25 | X | FR823391:3,222,186..3,225,916(-) | FR823391:3222186..3225916(-) | FR823391 | Neospora caninum Liverpool | 35 | OG6_102002 | 0 | 402 | 1209 | 41945 | 4.17 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_048550ORputative 26S proteasome non-ATPase regulatory subunit 4ANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_048550 OR putative 26S proteasome non-ATPase regulatory subunit 4 AND Neospora caninum Liverpool |
|
NCLIV_048880 | NCLIV_048880-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 729 | NCLIV_048880 | Proteasome subunit beta type-7, related | Proteasome subunit beta type-7, related | 13442390 | F0VK58 | X | FR823391:3,508,524..3,509,252(-) | FR823391:3508524..3509252(-) | FR823391 | Neospora caninum Liverpool | 26 | OG6_101390 | 0 | 242 | 729 | 25248 | 6.51 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_048880ORProteasome subunit beta type-7, relatedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_048880 OR Proteasome subunit beta type-7, related AND Neospora caninum Liverpool |
|
NCLIV_048960 | NCLIV_048960-t26_1 | 6 | 6 | 1 | | | reverse | protein coding | No | 1119 | NCLIV_048960 | hypothetical protein | hypothetical protein | 13442398 | F0VK66 | X | FR823391:3,547,656..3,551,146(-) | FR823391:3547656..3551146(-) | FR823391 | Neospora caninum Liverpool | 62 | OG6_100915 | 1 | 372 | 1119 | 40415 | 7.99 | 0 | | | | | | | | | | | | | | | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_048960ORhypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_048960 OR hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_049000 | NCLIV_049000-t26_1 | 7 | 7 | 1 | | | reverse | protein coding | No | 8163 | NCLIV_049000 | putative ubiquitin carboxyl-terminal hydrolase | putative ubiquitin carboxyl-terminal hydrolase | 13442402 | F0VK70 | X | FR823391:3,599,157..3,610,163(-) | FR823391:3599157..3610163(-) | FR823391 | Neospora caninum Liverpool | 38 | OG6_101021 | 1 | 2720 | 8163 | 288310 | 8.69 | 0 | HMM: MFSAVRHPGHASRTSSRPSGRRSLSRSSSSTTPSVSVPLPLSPAGAA, NN: MFSAVRHPGHASRTSSR | NN Sum: 0, NN D: .13, HMM Prob: .57 | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_049000ORputative ubiquitin carboxyl-terminal hydrolaseANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_049000 OR putative ubiquitin carboxyl-terminal hydrolase AND Neospora caninum Liverpool |
|
NCLIV_049420 | NCLIV_049420-t26_1 | 8 | 8 | 1 | | | forward | protein coding | No | 2712 | NCLIV_049420 | Serine/threonine protein phosphatase, related | Serine/threonine protein phosphatase, related | 13442444 | F0VKB2 | X | FR823391:3,957,816..3,964,521(+) | FR823391:3957816..3964521(+) | FR823391 | Neospora caninum Liverpool | 29 | OG6_124535 | 0 | 903 | 2712 | 96226 | 7.17 | 1 | | | | | | | | | | | | | | | 3.1.3.16 (Protein-serine/threonine phosphatase) | 3.1.3.16 (Protein-serine/threonine phosphatase) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_049420ORSerine/threonine protein phosphatase, relatedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_049420 OR Serine/threonine protein phosphatase, related AND Neospora caninum Liverpool |
|
NCLIV_049890 | NCLIV_049890-t26_1 | 8 | 8 | 1 | | | reverse | protein coding | No | 882 | NCLIV_049890 | putative ubiquitin-conjugating enzyme | putative ubiquitin-conjugating enzyme | 13442491 | F0VKF9 | X | FR823391:4,469,413..4,473,596(-) | FR823391:4469413..4473596(-) | FR823391 | Neospora caninum Liverpool | 24 | OG6_103192 | 0 | 293 | 882 | 32515 | 8.27 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 6.3.2.19 (Transferred entry: 2.3.2.23, 2.3.2.27 and 6.2.1.45) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_049890ORputative ubiquitin-conjugating enzymeANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_049890 OR putative ubiquitin-conjugating enzyme AND Neospora caninum Liverpool |
|
NCLIV_050050 | NCLIV_050050-t26_1 | 18 | 18 | 1 | | | reverse | protein coding | No | 4710 | NCLIV_050050 | putative M16 family peptidase | putative M16 family peptidase | 13442508 | F0VKH6 | X | FR823391:4,621,523..4,633,936(-) | FR823391:4621523..4633936(-) | FR823391 | Neospora caninum Liverpool | 65 | OG6_110270 | 1 | 1569 | 4710 | 171545 | 5.75 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_050050ORputative M16 family peptidaseANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_050050 OR putative M16 family peptidase AND Neospora caninum Liverpool |
|
NCLIV_050140 | NCLIV_050140-t26_1 | 6 | 6 | 1 | | | forward | protein coding | No | 3063 | NCLIV_050140 | putative subtilisin-like protease | putative subtilisin-like protease | 13442517 | F0VKI5 | X | FR823391:4,675,703..4,681,352(+) | FR823391:4675703..4681352(+) | FR823391 | Neospora caninum Liverpool | 56 | OG6_121085 | 1 | 1020 | 3063 | 109299 | 4.61 | 0 | | | | | GO:0005509;GO:0004252 | calcium ion binding;serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.21.62 (Subtilisin) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_050140ORputative subtilisin-like proteaseANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_050140 OR putative subtilisin-like protease AND Neospora caninum Liverpool |
|
NCLIV_050220 | NCLIV_050220-t26_1 | 4 | 4 | 1 | | | forward | protein coding | No | 5526 | NCLIV_050220 | putative subtilase family serine protease | putative subtilase family serine protease | 13442525 | F0VKJ3 | X | FR823391:4,765,262..4,771,981(+) | FR823391:4765262..4771981(+) | FR823391 | Neospora caninum Liverpool | 21 | OG6_116777 | 0 | 1841 | 5526 | 197805 | 6.33 | 0 | | | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.21.66 (Thermitase) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_050220ORputative subtilase family serine proteaseANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_050220 OR putative subtilase family serine protease AND Neospora caninum Liverpool |
|
NCLIV_050470 | NCLIV_050470-t26_1 | 10 | 10 | 1 | | | forward | protein coding | No | 1593 | NCLIV_050470 | hypothetical protein | hypothetical protein | 13442550 | F0VKL8 | X | FR823391:4,916,407..4,921,546(+) | FR823391:4916407..4921546(+) | FR823391 | Neospora caninum Liverpool | 36 | OG6_100777 | 0 | 530 | 1593 | 59464 | 7.92 | 0 | HMM: MFRFLPRAASGASTALSVHRRRIPALASLPASSSSLIQTRSLFGAAAAT, NN: MFRFLPRAASGASTAL | NN Sum: 0, NN D: .25, HMM Prob: .96 | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_050470ORhypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_050470 OR hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_051010 | NCLIV_051010-t26_1 | 8 | 8 | 1 | | | reverse | protein coding | No | 1404 | NCLIV_051010 | putative signal peptide peptidase domain-containing protein | putative signal peptide peptidase domain-containing protein | 13446379 | F0VKS3 | X | FR823391:5,326,744..5,331,413(-) | FR823391:5326744..5331413(-) | FR823391 | Neospora caninum Liverpool | 34 | OG6_102328 | 0 | 467 | 1404 | 51865 | 8.20 | 8 | | | GO:0016021 | integral component of membrane | GO:0004190 | aspartic-type endopeptidase activity | | | | | | | | | | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_051010ORputative signal peptide peptidase domain-containing proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_051010 OR putative signal peptide peptidase domain-containing protein AND Neospora caninum Liverpool |
|
NCLIV_051530 | NCLIV_051530-t26_1 | 4 | 4 | 1 | | | forward | protein coding | No | 777 | NCLIV_051530 | hypothetical protein | hypothetical protein | 13446431 | F0VKX5 | X | FR823391:5,783,021..5,784,626(+) | FR823391:5783021..5784626(+) | FR823391 | Neospora caninum Liverpool | 26 | OG6_101257 | 0 | 258 | 777 | 27859 | 8.50 | 0 | HMM: MSPLGFGSFLSPLLLFSVCPHLRTGI, NN: MSPLGFGSFLSPLLLFSVCPHLRTGI | NN Sum: 3, NN D: .5, HMM Prob: .98 | | | | | | | | | | | | | | 2.7.1.50 (Hydroxyethylthiazole kinase) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_051530ORhypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_051530 OR hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_051630 | NCLIV_051630-t26_1 | 13 | 13 | 1 | | | reverse | protein coding | No | 2082 | NCLIV_051630 | hypothetical protein | hypothetical protein | 13446598 | F0VKY5 | X | FR823391:5,845,504..5,852,476(-) | FR823391:5845504..5852476(-) | FR823391 | Neospora caninum Liverpool | 40 | OG6_101235 | 1 | 693 | 2082 | 77472 | 10.44 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.68 (Ulp1 peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_051630ORhypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_051630 OR hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_051650 | NCLIV_051650-t26_1 | 10 | 10 | 1 | | | reverse | protein coding | No | 4059 | NCLIV_051650 | putative M16 family peptidase | putative M16 family peptidase | 13446443 | F0VKY7 | X | FR823391:5,858,790..5,867,424(-) | FR823391:5858790..5867424(-) | FR823391 | Neospora caninum Liverpool | 30 | OG6_105738 | 0 | 1352 | 4059 | 148215 | 4.69 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.56 (Insulysin) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_051650ORputative M16 family peptidaseANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_051650 OR putative M16 family peptidase AND Neospora caninum Liverpool |
|
NCLIV_052030 | NCLIV_052030-t26_1 | 5 | 5 | 1 | | | forward | protein coding | No | 2235 | NCLIV_052030 | conserved hypothetical protein | conserved hypothetical protein | 13446481 | F0VL25 | X | FR823391:6,211,087..6,215,083(+) | FR823391:6211087..6215083(+) | FR823391 | Neospora caninum Liverpool | 23 | OG6_492212 | 0 | 744 | 2235 | 77464 | 7.01 | 4 | | | | | GO:0008233 | peptidase activity | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_052030ORconserved hypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_052030 OR conserved hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_053220 | NCLIV_053220-t26_1 | 4 | 4 | 1 | | | reverse | protein coding | No | 861 | NCLIV_053220 | PsmB (EC 3.4.25.1), related | PsmB (EC 3.4.25.1), related | 13446662 | F0VMF0 | XI | FR823392:80,559..82,848(-) | FR823392:80559..82848(-) | FR823392 | Neospora caninum Liverpool | 28 | OG6_101382 | 0 | 286 | 861 | 30590 | 7.02 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_053220ORPsmB (EC 3.4.25.1), relatedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_053220 OR PsmB (EC 3.4.25.1), related AND Neospora caninum Liverpool |
|
NCLIV_053270 | NCLIV_053270-t26_1 | 17 | 17 | 1 | | | forward | protein coding | No | 3942 | NCLIV_053270 | hypothetical protein | hypothetical protein | 13446607 | F0VMF5 | XI | FR823392:119,177..129,226(+) | FR823392:119177..129226(+) | FR823392 | Neospora caninum Liverpool | 39 | OG6_100411 | 0 | 1313 | 3942 | 143676 | 6.36 | 0 | HMM: MTYASRLQRPAAFAASSSSPAPAL, NN: MTYASRLQRPAAFAASSSSPAPALRSPAVRCVLTPCTTL | NN Sum: 0, NN D: .13, HMM Prob: .74 | | | GO:0005524;GO:0004176;GO:0004252 | ATP binding;ATP-dependent peptidase activity;serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_053270ORhypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_053270 OR hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_053520 | NCLIV_053520-t26_1 | 8 | 8 | 1 | | | forward | protein coding | No | 3876 | NCLIV_053520 | putative ubiquitin carboxyl-terminal hydrolase domain-containing protein | putative ubiquitin carboxyl-terminal hydrolase domain-containing protein | 13446631 | F0VMH9 | XI | FR823392:317,683..324,555(+) | FR823392:317683..324555(+) | FR823392 | Neospora caninum Liverpool | 15 | OG6_490658 | 0 | 1291 | 3876 | 140276 | 7.21 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_053520ORputative ubiquitin carboxyl-terminal hydrolase domain-containing proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_053520 OR putative ubiquitin carboxyl-terminal hydrolase domain-containing protein AND Neospora caninum Liverpool |
|
NCLIV_055070 | NCLIV_055070-t26_1 | 7 | 7 | 1 | | | forward | protein coding | No | 1884 | NCLIV_055070 | Ubiquitin carboxyl-terminal hydrolase, related | Ubiquitin carboxyl-terminal hydrolase, related | 13446797 | F0VMY6 | XI | FR823392:1,575,210..1,580,072(+) | FR823392:1575210..1580072(+) | FR823392 | Neospora caninum Liverpool | 35 | OG6_101892 | 0 | 627 | 1884 | 68621 | 5.67 | 0 | | | | | GO:0005515;GO:0036459 | protein binding;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | 3.1.2.15 (Deleted entry) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_055070ORUbiquitin carboxyl-terminal hydrolase, relatedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_055070 OR Ubiquitin carboxyl-terminal hydrolase, related AND Neospora caninum Liverpool |
|
NCLIV_055460 | NCLIV_055460-t26_1 | 6 | 6 | 1 | | | reverse | protein coding | No | 1251 | NCLIV_055460 | conserved hypothetical protein | conserved hypothetical protein | 13446836 | F0VN25 | XI | FR823392:1,970,307..1,974,027(-) | FR823392:1970307..1974027(-) | FR823392 | Neospora caninum Liverpool | 33 | OG6_102579 | 0 | 416 | 1251 | 45735 | 4.86 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_055460ORconserved hypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_055460 OR conserved hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_057270 | NCLIV_057270-t26_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 228 | NCLIV_057270 | hypothetical protein | hypothetical protein | 13440717 | F0VNK8 | XI | FR823392:3,609,462..3,610,428(-) | FR823392:3609462..3610428(-) | FR823392 | Neospora caninum Liverpool | 21 | OG6_101970 | 0 | 75 | 228 | 8442 | 7.70 | 0 | | | | | | | | | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_057270ORhypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_057270 OR hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_057550 | NCLIV_057550-t26_1 | 14 | 14 | 1 | | | reverse | protein coding | No | 3984 | NCLIV_057550 | unspecified product | unspecified product | 13440745 | F0VNN6 | XI | FR823392:3,835,645..3,846,044(-) | FR823392:3835645..3846044(-) | FR823392 | Neospora caninum Liverpool | 72 | OG6_100121 | 1 | 1327 | 3984 | 141080 | 4.40 | 2 | HMM: MAVRGGSALAVFLHLVLVLFLSHALPSLAD, NN: MAVRGGSALAVFLHLVLVLFLSHALPSLAD | NN Sum: 4, NN D: .85, HMM Prob: 1 | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.21.66 (Thermitase) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_057550ORunspecified productANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_057550 OR unspecified product AND Neospora caninum Liverpool |
|
NCLIV_057730 | NCLIV_057730-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 5334 | NCLIV_057730 | putative ubiquitin carboxyl-terminal hydrolase domain-containing protein | putative ubiquitin carboxyl-terminal hydrolase domain-containing protein | 13440763 | F0VNQ4 | XI | FR823392:4,004,831..4,010,164(-) | FR823392:4004831..4010164(-) | FR823392 | Neospora caninum Liverpool | 18 | OG6_492032 | 0 | 1777 | 5334 | 186929 | 10.41 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_057730ORputative ubiquitin carboxyl-terminal hydrolase domain-containing proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_057730 OR putative ubiquitin carboxyl-terminal hydrolase domain-containing protein AND Neospora caninum Liverpool |
|
NCLIV_057740 | NCLIV_057740-t26_1 | 13 | 13 | 1 | | | reverse | protein coding | No | 6534 | NCLIV_057740 | conserved hypothetical protein | conserved hypothetical protein | 13440764 | F0VNQ5 | XI | FR823392:4,015,099..4,027,202(-) | FR823392:4015099..4027202(-) | FR823392 | Neospora caninum Liverpool | 28 | OG6_491105 | 0 | 2177 | 6534 | 236184 | 7.03 | 1 | HMM: MASTKRKKTLAGIARLASGRLLAALILYTLTRVSLR, NN: MASTKRKKTLAGIARLASGRLLAALILYTLTRVSLR | NN Sum: 2, NN D: .5, HMM Prob: 1 | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_057740ORconserved hypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_057740 OR conserved hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_059250 | NCLIV_059250-t26_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 639 | NCLIV_059250 | Derlin-1, related | Derlin-1, related | 13440913 | F0VP54 | XI | FR823392:5,243,829..5,244,948(-) | FR823392:5243829..5244948(-) | FR823392 | Neospora caninum Liverpool | 27 | OG6_101672 | 0 | 212 | 639 | 24668 | 8.84 | 5 | HMM: MAQIDIFFSHLPPVTRFYLFCSTALMLLCTLEIVSPF, NN: MAQIDIFFSHLPPVTRFYLFCSTALMLLCTLEIVSPF | NN Sum: 3, NN D: .56, HMM Prob: .39 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_059250ORDerlin-1, relatedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_059250 OR Derlin-1, related AND Neospora caninum Liverpool |
|
NCLIV_059790 | NCLIV_059790-t26_1 | 4 | 4 | 1 | | | forward | protein coding | No | 783 | NCLIV_059790 | putative proteasome subunit alpha type 3 | putative proteasome subunit alpha type 3 | 13440967 | F0VPA8 | XI | FR823392:5,656,771..5,659,217(+) | FR823392:5656771..5659217(+) | FR823392 | Neospora caninum Liverpool | 24 | OG6_102011 | 0 | 260 | 783 | 27851 | 4.69 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_059790ORputative proteasome subunit alpha type 3ANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_059790 OR putative proteasome subunit alpha type 3 AND Neospora caninum Liverpool |
|
NCLIV_059800 | NCLIV_059800-t26_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 1635 | NCLIV_059800 | conserved hypothetical protein | conserved hypothetical protein | 13440968 | F0VPA9 | XI | FR823392:5,661,398..5,663,654(-) | FR823392:5661398..5663654(-) | FR823392 | Neospora caninum Liverpool | 15 | OG6_100428 | 0 | 544 | 1635 | 59590 | 7.01 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_059800ORconserved hypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_059800 OR conserved hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_060010 | NCLIV_060010-t26_1 | 8 | 8 | 1 | | | forward | protein coding | No | 1521 | NCLIV_060010 | putative oligoendopeptidase F | putative oligoendopeptidase F | 13440989 | F0VPD0 | XI | FR823392:5,884,765..5,889,332(+) | FR823392:5884765..5889332(+) | FR823392 | Neospora caninum Liverpool | 44 | OG6_110341 | 1 | 506 | 1521 | 56854 | 5.67 | 0 | | | | | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_060010ORputative oligoendopeptidase FANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_060010 OR putative oligoendopeptidase F AND Neospora caninum Liverpool |
|
NCLIV_060120 | NCLIV_060120-t26_1 | 7 | 7 | 1 | | | forward | protein coding | No | 2613 | NCLIV_060120 | conserved hypothetical protein | conserved hypothetical protein | 13441000 | F0VPE1 | XI | FR823392:5,966,797..5,971,440(+) | FR823392:5966797..5971440(+) | FR823392 | Neospora caninum Liverpool | 25 | OG6_102601 | 0 | 870 | 2613 | 93438 | 6.59 | 0 | | | | | | | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_060120ORconserved hypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_060120 OR conserved hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_060380 | NCLIV_060380-t26_1 | 11 | 11 | 1 | | | reverse | protein coding | No | 1248 | NCLIV_060380 | hypothetical protein | hypothetical protein | 13441044 | F0VPG7 | XII | FR823393:74,436..80,070(-) | FR823393:74436..80070(-) | FR823393 | Neospora caninum Liverpool | 42 | OG6_101915 | 0 | 415 | 1248 | 46200 | 4.81 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | | | | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_060380ORhypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_060380 OR hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_060540 | NCLIV_060540-t26_1 | 2 | 2 | 1 | | | forward | protein coding | No | 6138 | NCLIV_060540 | hypothetical protein | hypothetical protein | 13441060 | F0VPI3 | XII | FR823393:199,185..205,740(+) | FR823393:199185..205740(+) | FR823393 | Neospora caninum Liverpool | 19 | OG6_490204 | 0 | 2045 | 6138 | 223112 | 6.99 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_060540ORhypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_060540 OR hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_061100 | NCLIV_061100-t26_1 | 3 | 3 | 1 | | | reverse | protein coding | No | 6288 | NCLIV_061100 | conserved hypothetical protein | conserved hypothetical protein | 13441117 | F0VPN9 | XII | FR823393:656,965..665,029(-) | FR823393:656965..665029(-) | FR823393 | Neospora caninum Liverpool | 3 | OG6_393426 | 0 | 2095 | 6288 | 226222 | 7.85 | 0 | | | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_061100ORconserved hypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_061100 OR conserved hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_061460 | NCLIV_061460-t26_1 | 10 | 10 | 1 | | | forward | protein coding | No | 933 | NCLIV_061460 | Family T1, proteasome beta subunit, threonine peptidase, related | Family T1, proteasome beta subunit, threonine peptidase, related | 13441152 | F0VPS4 | XII | FR823393:948,450..952,944(+) | FR823393:948450..952944(+) | FR823393 | Neospora caninum Liverpool | 27 | OG6_100897 | 0 | 310 | 933 | 33994 | 6.59 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_061460ORFamily T1, proteasome beta subunit, threonine peptidase, relatedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_061460 OR Family T1, proteasome beta subunit, threonine peptidase, related AND Neospora caninum Liverpool |
|
NCLIV_061720 | NCLIV_061720-t26_1 | 40 | 40 | 1 | | | reverse | protein coding | No | 10158 | NCLIV_061720 | hypothetical protein | hypothetical protein | 13441178 | F0VPV0 | XII | FR823393:1,154,203..1,180,607(-) | FR823393:1154203..1180607(-) | FR823393 | Neospora caninum Liverpool | 4 | OG6_100368 | 0 | 3385 | 10158 | 363136 | 6.84 | 0 | | | | | GO:0005524;GO:0003989;GO:0016874;GO:0046872 | ATP binding;acetyl-CoA carboxylase activity;ligase activity;metal ion binding | GO:0006633 | fatty acid biosynthetic process | | | | | | | 6.3.4.14 (Biotin carboxylase);6.4.1.2 (Acetyl-CoA carboxylase) | 6.3.4.14 (Biotin carboxylase) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_061720ORhypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_061720 OR hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_061740 | NCLIV_061740-t26_1 | 5 | 5 | 1 | | | reverse | protein coding | No | 1215 | NCLIV_061740 | Hydrolase, alpha/beta fold family, related | Hydrolase, alpha/beta fold family, related | 13441180 | F0VPV2 | XII | FR823393:1,194,372..1,197,829(-) | FR823393:1194372..1197829(-) | FR823393 | Neospora caninum Liverpool | 27 | OG6_116896 | 0 | 404 | 1215 | 44266 | 8.74 | 1 | HMM: MGLASNWSWAGLGCGLLALAILLPPDPGL, NN: MGLASNWSWAGLGCGLLALAILL | NN Sum: 3, NN D: .58, HMM Prob: .88 | | | | | | | | | | | | | | 2.3.-.- (Acyltransferases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_061740ORHydrolase, alpha/beta fold family, relatedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_061740 OR Hydrolase, alpha/beta fold family, related AND Neospora caninum Liverpool |
|
NCLIV_062780 | NCLIV_062780-t26_1 | 11 | 11 | 1 | | | reverse | protein coding | No | 5412 | NCLIV_062780 | putative dipeptidyl peptidase IV domain-containing protein | putative dipeptidyl peptidase IV domain-containing protein | 13441283 | F0VQ55 | XII | FR823393:2,016,718..2,026,816(-) | FR823393:2016718..2026816(-) | FR823393 | Neospora caninum Liverpool | 28 | OG6_164791 | 0 | 1803 | 5412 | 195434 | 6.74 | 0 | | | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.14.5 (Dipeptidyl-peptidase IV) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_062780ORputative dipeptidyl peptidase IV domain-containing proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_062780 OR putative dipeptidyl peptidase IV domain-containing protein AND Neospora caninum Liverpool |
|
NCLIV_062860 | NCLIV_062860-t26_1 | 6 | 6 | 1 | | | reverse | protein coding | No | 1188 | NCLIV_062860 | hypothetical protein | hypothetical protein | 13445083 | F0VQ63 | XII | FR823393:2,110,292..2,113,903(-) | FR823393:2110292..2113903(-) | FR823393 | Neospora caninum Liverpool | 23 | OG6_124366 | 0 | 395 | 1188 | 43649 | 10.02 | 0 | HMM: MCSPYAPTAFSPGTPSSGLASASSFSSAA, NN: MCSPYAPTAFSPGTPSSGLASASSFSSAASCPSGGSPS | NN Sum: 0, NN D: .07, HMM Prob: .75 | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_062860ORhypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_062860 OR hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_063040 | NCLIV_063040-t26_1 | 7 | 7 | 1 | | | forward | protein coding | No | 2394 | NCLIV_063040 | conserved hypothetical protein | conserved hypothetical protein | 13445101 | F0VQ81 | XII | FR823393:2,259,547..2,265,121(+) | FR823393:2259547..2265121(+) | FR823393 | Neospora caninum Liverpool | 20 | OG6_104384 | 0 | 797 | 2394 | 85348 | 8.76 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_063040ORconserved hypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_063040 OR conserved hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_063060 | NCLIV_063060-t26_1 | 18 | 18 | 1 | | | forward | protein coding | No | 4536 | NCLIV_063060 | putative MIF4G domain-containing protein | putative MIF4G domain-containing protein | 13445103 | F0VQ83 | XII | FR823393:2,273,674..2,286,201(+) | FR823393:2273674..2286201(+) | FR823393 | Neospora caninum Liverpool | 41 | OG6_103377 | 0 | 1511 | 4536 | 164520 | 5.51 | 0 | | | | | GO:0003723;GO:0005488;GO:0005515 | RNA binding;binding;protein binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_063060ORputative MIF4G domain-containing proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_063060 OR putative MIF4G domain-containing protein AND Neospora caninum Liverpool |
|
NCLIV_063340 | NCLIV_063340-t26_1 | 9 | 9 | 1 | | | forward | protein coding | No | 1956 | NCLIV_063340 | hypothetical protein | hypothetical protein | 13445131 | F0VQB1 | XII | FR823393:2,496,157..2,500,862(+) | FR823393:2496157..2500862(+) | FR823393 | Neospora caninum Liverpool | 24 | OG6_119797 | 0 | 651 | 1956 | 70341 | 5.79 | 0 | HMM: MDTAAPSAGRRARAFCLLLSCCLVALPLSSANAL, NN: MDTAAPSAGRRARAFCLLLSCCLVALPLSSANAL | NN Sum: 4, NN D: .73, HMM Prob: 1 | | | | | | | | | | | | | | 3.4.23.1 (Pepsin A) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_063340ORhypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_063340 OR hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_063390 | NCLIV_063390-t26_1 | 2 | 2 | 1 | | | forward | protein coding | No | 5385 | NCLIV_063390 | putative ABC1 family beta-lactamase | putative ABC1 family beta-lactamase | 13445136 | F0VQB6 | XII | FR823393:2,524,162..2,530,005(+) | FR823393:2524162..2530005(+) | FR823393 | Neospora caninum Liverpool | 31 | OG6_112296 | 0 | 1794 | 5385 | 192959 | 8.51 | 0 | | | | | | | | | | | | | | | 1.14.13.- (With NADH or NADPH as one donor, and incorporation of one atom of oxygen.) | 1.14.13.- (With NADH or NADPH as one donor, and incorporation of one atom of oxygen.) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_063390ORputative ABC1 family beta-lactamaseANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_063390 OR putative ABC1 family beta-lactamase AND Neospora caninum Liverpool |
|
NCLIV_063570 | NCLIV_063570-t26_1 | 16 | 16 | 1 | | | forward | protein coding | No | 2679 | NCLIV_063570 | Peptidase, S9A/B/C family, catalytic domain protein, related | Peptidase, S9A/B/C family, catalytic domain protein, related | 13445154 | F0VQD4 | XII | FR823393:2,643,212..2,651,708(+) | FR823393:2643212..2651708(+) | FR823393 | Neospora caninum Liverpool | 33 | OG6_102438 | 0 | 892 | 2679 | 96959 | 6.90 | 0 | | | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.19.1 (Acylaminoacyl-peptidase) | 3.4.19.1 (Acylaminoacyl-peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_063570ORPeptidase, S9A/B/C family, catalytic domain protein, relatedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_063570 OR Peptidase, S9A/B/C family, catalytic domain protein, related AND Neospora caninum Liverpool |
|
NCLIV_063760 | NCLIV_063760-t26_1 | 9 | 9 | 1 | | | forward | protein coding | No | 1227 | NCLIV_063760 | hypothetical protein | hypothetical protein | 13445173 | F0VQF3 | XII | FR823393:2,818,962..2,823,785(+) | FR823393:2818962..2823785(+) | FR823393 | Neospora caninum Liverpool | 35 | OG6_102753 | 0 | 408 | 1227 | 45239 | 4.76 | 0 | | | GO:0005622 | intracellular | GO:0004843 | thiol-dependent ubiquitin-specific protease activity | GO:0006511 | ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_063760ORhypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_063760 OR hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_064430 | NCLIV_064430-t26_1 | 8 | 8 | 1 | | | reverse | protein coding | No | 1560 | NCLIV_064430 | putative subtilase family serine protease | putative subtilase family serine protease | 13445240 | F0VQM0 | XII | FR823393:3,308,475..3,315,847(-) | FR823393:3308475..3315847(-) | FR823393 | Neospora caninum Liverpool | 34 | OG6_206249 | 0 | 519 | 1560 | 56499 | 6.57 | 0 | | | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.21.66 (Thermitase) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_064430ORputative subtilase family serine proteaseANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_064430 OR putative subtilase family serine protease AND Neospora caninum Liverpool |
|
NCLIV_064590 | NCLIV_064590-t26_1 | 5 | 5 | 1 | | | reverse | protein coding | No | 1659 | NCLIV_064590 | unspecified product | unspecified product | 13445256 | F0VQN6 | XII | FR823393:3,463,451..3,466,882(-) | FR823393:3463451..3466882(-) | FR823393 | Neospora caninum Liverpool | 51 | OG6_130922 | 1 | 552 | 1659 | 60113 | 5.48 | 1 | HMM: MAAIVSLLSWRTLRPVVLVLLAHSCSSD, NN: MAAIVSLLSWRTLRPVVLVLLAHSCSSDAL | NN Sum: 4, NN D: .74, HMM Prob: 1 | GO:0016020 | membrane | | | GO:0009405 | pathogenesis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_064590ORunspecified productANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_064590 OR unspecified product AND Neospora caninum Liverpool |
|
NCLIV_064640 | NCLIV_064640-t26_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 528 | NCLIV_064640 | putative signal peptidase complex subunit 3, related | putative signal peptidase complex subunit 3, related | 13445261 | F0VQP1 | XII | FR823393:3,504,174..3,505,105(-) | FR823393:3504174..3505105(-) | FR823393 | Neospora caninum Liverpool | 28 | OG6_102447 | 0 | 175 | 528 | 19533 | 6.79 | 1 | HMM: MDTYLNRGNAVICTLLAALALAALGN, NN: MDTYLNRGNAVICTLLAALALAALGN | NN Sum: 3, NN D: .6, HMM Prob: .91 | GO:0016021;GO:0005787 | integral component of membrane;signal peptidase complex | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_064640ORputative signal peptidase complex subunit 3, relatedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_064640 OR putative signal peptidase complex subunit 3, related AND Neospora caninum Liverpool |
|
NCLIV_064680 | NCLIV_064680-t26_1 | 10 | 10 | 1 | | | forward | protein coding | No | 2991 | NCLIV_064680 | ATP-dependent metalloprotease involved in cell division, related | ATP-dependent metalloprotease involved in cell division, related | 13445265 | F0VQP5 | XII | FR823393:3,537,937..3,544,452(+) | FR823393:3537937..3544452(+) | FR823393 | Neospora caninum Liverpool | 44 | OG6_101196 | 0 | 996 | 2991 | 107317 | 8.21 | 0 | | | GO:0016020 | membrane | GO:0005524;GO:0004222 | ATP binding;metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_064680ORATP-dependent metalloprotease involved in cell division, relatedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_064680 OR ATP-dependent metalloprotease involved in cell division, related AND Neospora caninum Liverpool |
|
NCLIV_064850 | NCLIV_064850-t26_1 | 6 | 6 | 1 | | | forward | protein coding | No | 2619 | NCLIV_064850 | hypothetical protein | hypothetical protein | 13445282 | F0VQR2 | XII | FR823393:3,667,645..3,672,639(+) | FR823393:3667645..3672639(+) | FR823393 | Neospora caninum Liverpool | 16 | OG6_104646 | 0 | 872 | 2619 | 94216 | 6.70 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_064850ORhypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_064850 OR hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_064900 | NCLIV_064900-t26_1 | 3 | 3 | 1 | | | forward | protein coding | No | 1497 | NCLIV_064900 | hypothetical protein | hypothetical protein | 13445287 | F0VQR7 | XII | FR823393:3,719,712..3,721,823(+) | FR823393:3719712..3721823(+) | FR823393 | Neospora caninum Liverpool | 30 | OG6_113449 | 0 | 498 | 1497 | 52967 | 4.37 | 0 | | | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.21.66 (Thermitase) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_064900ORhypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_064900 OR hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_064990 | NCLIV_064990-t26_1 | 7 | 7 | 1 | | | forward | protein coding | No | 1272 | NCLIV_064990 | putative methionine aminopeptidase | putative methionine aminopeptidase | 13445296 | F0VQS6 | XII | FR823393:3,782,365..3,786,425(+) | FR823393:3782365..3786425(+) | FR823393 | Neospora caninum Liverpool | 64 | OG6_100342 | 1 | 423 | 1272 | 47298 | 6.64 | 0 | | | | | GO:0004177;GO:0008235 | aminopeptidase activity;metalloexopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_064990ORputative methionine aminopeptidaseANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_064990 OR putative methionine aminopeptidase AND Neospora caninum Liverpool |
|
NCLIV_065550 | NCLIV_065550-t26_1 | 8 | 8 | 1 | | | reverse | protein coding | No | 1146 | NCLIV_065550 | hypothetical protein | hypothetical protein | 13445352 | F0VQY2 | XII | FR823393:4,188,489..4,192,457(-) | FR823393:4188489..4192457(-) | FR823393 | Neospora caninum Liverpool | 29 | OG6_108842 | 0 | 381 | 1146 | 40332 | 7.17 | 0 | | | | | GO:0016787 | hydrolase activity | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_065550ORhypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_065550 OR hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_065750 | NCLIV_065750-t26_1 | 7 | 7 | 1 | | | forward | protein coding | No | 777 | NCLIV_065750 | Alpha 2 subunit of 20S proteasome (ISS), related | Alpha 2 subunit of 20S proteasome (ISS), related | 13445372 | F0VR02 | XII | FR823393:4,368,454..4,371,945(+) | FR823393:4368454..4371945(+) | FR823393 | Neospora caninum Liverpool | 25 | OG6_101621 | 0 | 258 | 777 | 28278 | 4.62 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_065750ORAlpha 2 subunit of 20S proteasome (ISS), relatedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_065750 OR Alpha 2 subunit of 20S proteasome (ISS), related AND Neospora caninum Liverpool |
|
NCLIV_066590 | NCLIV_066590-t26_1 | 6 | 6 | 1 | | | reverse | protein coding | No | 1362 | NCLIV_066590 | UPF0361 protein DC12 homolog, related | UPF0361 protein DC12 homolog, related | 13445457 | F0VR86 | XII | FR823393:5,056,682..5,060,963(-) | FR823393:5056682..5060963(-) | FR823393 | Neospora caninum Liverpool | 31 | OG6_102318 | 0 | 453 | 1362 | 49584 | 8.99 | 0 | | | | | | | | | | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_066590ORUPF0361 protein DC12 homolog, relatedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_066590 OR UPF0361 protein DC12 homolog, related AND Neospora caninum Liverpool |
|
NCLIV_066610 | NCLIV_066610-t26_1 | 5 | 5 | 1 | | | reverse | protein coding | No | 5112 | NCLIV_066610 | putative ulp1 protease family, C-terminal catalytic domain-containing protein | putative ulp1 protease family, C-terminal catalytic domain-containing protein | 13445459 | F0VR88 | XII | FR823393:5,066,251..5,072,660(-) | FR823393:5066251..5072660(-) | FR823393 | Neospora caninum Liverpool | 15 | OG6_491482 | 0 | 1703 | 5112 | 183513 | 8.57 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_066610ORputative ulp1 protease family, C-terminal catalytic domain-containing proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_066610 OR putative ulp1 protease family, C-terminal catalytic domain-containing protein AND Neospora caninum Liverpool |
|
NCLIV_066660 | NCLIV_066660-t26_1 | 3 | 3 | 1 | | | reverse | protein coding | No | 3768 | NCLIV_066660 | Homology to unknown gene, related | Homology to unknown gene, related | 13445464 | F0VR93 | XII | FR823393:5,091,707..5,096,873(-) | FR823393:5091707..5096873(-) | FR823393 | Neospora caninum Liverpool | 23 | OG6_112025 | 0 | 1255 | 3768 | 133771 | 10.18 | 6 | HMM: MIPLPLGLCLLFFSLSEVSSLAI, NN: MIPLPLGLCLLFFSLSEVSSL | NN Sum: 4, NN D: .74, HMM Prob: 1 | GO:0016020 | membrane | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_066660ORHomology to unknown gene, relatedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_066660 OR Homology to unknown gene, related AND Neospora caninum Liverpool |
|
NCLIV_067030 | NCLIV_067030-t26_1 | 9 | 9 | 1 | | | reverse | protein coding | No | 3447 | NCLIV_067030 | putative ICE-like protease (caspase) p20 domain-containing protein | putative ICE-like protease (caspase) p20 domain-containing protein | 13445501 | F0VRD0 | XII | FR823393:5,324,977..5,330,872(-) | FR823393:5324977..5330872(-) | FR823393 | Neospora caninum Liverpool | 31 | OG6_119794 | 1 | 1148 | 3447 | 122407 | 6.99 | 0 | | | | | | | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_067030ORputative ICE-like protease (caspase) p20 domain-containing proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_067030 OR putative ICE-like protease (caspase) p20 domain-containing protein AND Neospora caninum Liverpool |
|
NCLIV_067980 | NCLIV_067980-t26_1 | 9 | 9 | 1 | | | reverse | protein coding | No | 744 | NCLIV_067980 | Proteasome subunit alpha type | Proteasome subunit alpha type | 13445597 | F0VRM6 | XII | FR823393:5,919,289..5,924,828(-) | FR823393:5919289..5924828(-) | FR823393 | Neospora caninum Liverpool | 31 | OG6_102143 | 0 | 247 | 744 | 27282 | 6.09 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_067980ORProteasome subunit alpha typeANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_067980 OR Proteasome subunit alpha type AND Neospora caninum Liverpool |
|
NCLIV_068020 | NCLIV_068020-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1410 | NCLIV_068020 | putative OTU-like cysteine protease domain-containing protein | putative OTU-like cysteine protease domain-containing protein | 13445601 | F0VRN0 | XII | FR823393:5,956,144..5,957,553(-) | FR823393:5956144..5957553(-) | FR823393 | Neospora caninum Liverpool | 22 | OG6_102949 | 0 | 469 | 1410 | 50775 | 8.13 | 0 | | | | | | | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_068020ORputative OTU-like cysteine protease domain-containing proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_068020 OR putative OTU-like cysteine protease domain-containing protein AND Neospora caninum Liverpool |
|
NCLIV_068150 | NCLIV_068150-t26_1 | 10 | 10 | 1 | | | forward | protein coding | No | 2193 | NCLIV_068150 | hypothetical protein | hypothetical protein | 13445614 | F0VRP3 | XII | FR823393:6,051,637..6,057,713(+) | FR823393:6051637..6057713(+) | FR823393 | Neospora caninum Liverpool | 111 | OG6_105727 | 2 | 730 | 2193 | 79957 | 9.57 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 3.4.21.108 (HtrA2 peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_068150ORhypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_068150 OR hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_068380 | NCLIV_068380-t26_1 | 8 | 8 | 1 | | | forward | protein coding | No | 1470 | NCLIV_068380 | hypothetical protein | hypothetical protein | 13445637 | F0VRR6 | XII | FR823393:6,224,867..6,228,722(+) | FR823393:6224867..6228722(+) | FR823393 | Neospora caninum Liverpool | 30 | OG6_101899 | 0 | 489 | 1470 | 53403 | 7.71 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | | | | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_068380ORhypothetical proteinANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_068380 OR hypothetical protein AND Neospora caninum Liverpool |
|
NCLIV_069430 | NCLIV_069430-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 5988 | NCLIV_069430 | ABC1 family protein, related | ABC1 family protein, related | | | Not Assigned | CADU01000303:168,224..174,211(-) | CADU01000303:168224..174211(-) | CADU01000303 | Neospora caninum Liverpool | 28 | OG6_100510 | 1 | 1995 | 5988 | 217280 | 8.04 | 0 | | | | | | | | | | | | | | | 1.14.13.- (With NADH or NADPH as one donor, and incorporation of one atom of oxygen.) | 2.7.-.- (Transferring phosphorus-containing groups.) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_069430ORABC1 family protein, relatedANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_069430 OR ABC1 family protein, related AND Neospora caninum Liverpool |
|
NCLIV_069500 | NCLIV_069500-t26_1 | 9 | 9 | 1 | | | forward | protein coding | No | 1527 | NCLIV_069500 | Thermostable carboxypeptidase 1 (EC 3.4.17.-) | Thermostable carboxypeptidase 1 (EC 3.4.17.-) | | | Not Assigned | CADU01000303:234,323..240,778(+) | CADU01000303:234323..240778(+) | CADU01000303 | Neospora caninum Liverpool | 30 | OG6_101553 | 0 | 508 | 1527 | 54136 | 6.00 | 1 | HMM: MGGGGKKLVTKTLWDRGIISLTSYSFVFLFFLAAAELPSVGVAK, NN: MGGGGKKLVTKTLWDRGIISLTSYSFVFLFFLAAAELPSVGVAK | NN Sum: 3, NN D: .49, HMM Prob: .72 | | | GO:0016787 | hydrolase activity | GO:0008152 | metabolic process | | | | | | | | 3.5.1.14 (N-acyl-aliphatic-L-amino acid amidohydrolase) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_069500ORThermostable carboxypeptidase 1 (EC 3.4.17.-)ANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_069500 OR Thermostable carboxypeptidase 1 (EC 3.4.17.-) AND Neospora caninum Liverpool |
|
NCLIV_069550 | NCLIV_069550-t26_1 | 6 | 6 | 1 | | | forward | protein coding | No | 1392 | NCLIV_069550 | unspecified product | unspecified product | | | Not Assigned | CADU01000305:11,788..15,178(+) | CADU01000305:11788..15178(+) | CADU01000305 | Neospora caninum Liverpool | 29 | OG6_101151 | 0 | 463 | 1392 | 51365 | 6.65 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.1 (Cathepsin B) | https://pubmed.ncbi.nlm.nih.gov/?term=NCLIV_069550ORunspecified productANDNeospora caninum Liverpool | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=NCLIV_069550 OR unspecified product AND Neospora caninum Liverpool |